SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P55828 Cluster: 40S ribosomal protein S20; n=28; Eukary...   108   8e-23
UniRef50_P60866 Cluster: 40S ribosomal protein S20; n=127; cellu...   101   9e-21
UniRef50_O74893 Cluster: 40S ribosomal protein S20; n=15; Fungi/...    99   5e-20
UniRef50_UPI00015B60B9 Cluster: PREDICTED: similar to ENSANGP000...    96   5e-19
UniRef50_Q5M8F0 Cluster: Putative uncharacterized protein; n=2; ...    83   5e-15
UniRef50_Q86H15 Cluster: 40S rRNA protein-like protein; n=10; Bi...    79   8e-14
UniRef50_UPI0000498481 Cluster: 40S ribosomal protein S20; n=2; ...    70   4e-11
UniRef50_Q22DC6 Cluster: Ribosomal protein S10 containing protei...    69   8e-11
UniRef50_Q4Q8G4 Cluster: Ribosomal protein s20, putative; n=4; T...    68   1e-10
UniRef50_UPI0000D99BC8 Cluster: PREDICTED: similar to 40S riboso...    63   4e-09
UniRef50_A0BD80 Cluster: Chromosome undetermined scaffold_10, wh...    63   4e-09
UniRef50_A2EK65 Cluster: Ribosomal protein S10p/S20e, putative; ...    62   5e-09
UniRef50_Q98S21 Cluster: 40S ribosomal protein S20; n=1; Guillar...    60   2e-08
UniRef50_O29324 Cluster: 30S ribosomal protein S10P; n=35; Archa...    55   1e-06
UniRef50_P17199 Cluster: 30S ribosomal protein S10P; n=15; Archa...    50   4e-05
UniRef50_A0RUM5 Cluster: Ribosomal protein S10; n=3; Thermoprote...    47   2e-04
UniRef50_UPI00015BAA87 Cluster: SSU ribosomal protein S10P; n=1;...    46   4e-04
UniRef50_A3H8H3 Cluster: Ribosomal protein S10; n=2; Thermoprote...    45   0.001
UniRef50_Q74MI5 Cluster: 30S ribosomal protein S10P; n=1; Nanoar...    43   0.004
UniRef50_Q9PLX0 Cluster: 30S ribosomal protein S10; n=15; Campyl...    43   0.004
UniRef50_Q4UMT0 Cluster: 30S ribosomal protein S10; n=23; Bacter...    40   0.033
UniRef50_Q9LK61 Cluster: 30S ribosomal protein S10, chloroplast ...    39   0.057
UniRef50_A4RTZ9 Cluster: Plastid ribosomal protein S10 small rib...    38   0.13 
UniRef50_Q2GEE0 Cluster: 30S ribosomal protein S10; n=5; Proteob...    38   0.17 
UniRef50_Q6MJ14 Cluster: 30S ribosomal protein S10; n=14; Bacter...    37   0.23 
UniRef50_Q7VQE9 Cluster: 30S ribosomal protein S10; n=10; Proteo...    37   0.31 
UniRef50_Q6F7R1 Cluster: 30S ribosomal protein S10; n=23; Bacter...    37   0.31 
UniRef50_Q7R349 Cluster: GLP_554_44441_44061; n=1; Giardia lambl...    36   0.53 
UniRef50_Q7U4D0 Cluster: 30S ribosomal protein S10; n=136; cellu...    36   0.53 
UniRef50_Q6MER9 Cluster: 30S ribosomal protein S10; n=7; Bacteri...    36   0.71 
UniRef50_P66331 Cluster: 30S ribosomal protein S10; n=234; Bacte...    35   0.93 
UniRef50_Q88XY7 Cluster: 30S ribosomal protein S10; n=18; Bacter...    35   0.93 
UniRef50_O21246 Cluster: Mitochondrial ribosomal protein S10; n=...    35   1.2  
UniRef50_A0T870 Cluster: Putative uncharacterized protein; n=2; ...    33   3.8  
UniRef50_Q9TLV9 Cluster: Chloroplast 30S ribosomal protein S10; ...    33   5.0  
UniRef50_Q8RC68 Cluster: Subtilisin-like serine proteases; n=4; ...    32   6.6  

>UniRef50_P55828 Cluster: 40S ribosomal protein S20; n=28;
           Eukaryota|Rep: 40S ribosomal protein S20 - Drosophila
           melanogaster (Fruit fly)
          Length = 120

 Score =  108 bits (259), Expect = 8e-23
 Identities = 53/66 (80%), Positives = 56/66 (84%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KDIEKP   + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVRMPTK LRI
Sbjct: 6   KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 66  TTRKTP 71



 Score = 99.1 bits (236), Expect = 5e-20
 Identities = 45/48 (93%), Positives = 48/48 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGVEVEVTIA+
Sbjct: 73  GEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120


>UniRef50_P60866 Cluster: 40S ribosomal protein S20; n=127; cellular
           organisms|Rep: 40S ribosomal protein S20 - Homo sapiens
           (Human)
          Length = 119

 Score =  101 bits (242), Expect = 9e-21
 Identities = 47/49 (95%), Positives = 49/49 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA
Sbjct: 71  GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119



 Score = 99.1 bits (236), Expect = 5e-20
 Identities = 50/66 (75%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KD  K   E    IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI
Sbjct: 4   KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 64  TTRKTP 69


>UniRef50_O74893 Cluster: 40S ribosomal protein S20; n=15;
           Fungi/Metazoa group|Rep: 40S ribosomal protein S20 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 118

 Score = 99.1 bits (236), Expect = 5e-20
 Identities = 46/62 (74%), Positives = 55/62 (88%)
 Frame = +1

Query: 142 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRK 321
           +K Q   S +HRIRITLTSRNVR+LEKVC+DL+N AK ++LRVKGPVR+PTKIL+ITTRK
Sbjct: 8   QKEQQIPSTVHRIRITLTSRNVRNLEKVCSDLVNRAKDKQLRVKGPVRLPTKILKITTRK 67

Query: 322 TP 327
           TP
Sbjct: 68  TP 69



 Score = 91.5 bits (217), Expect = 1e-17
 Identities = 42/51 (82%), Positives = 47/51 (92%)
 Frame = +2

Query: 320 KLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIA 472
           K   GEGSKTW+ ++MRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIA
Sbjct: 67  KTPNGEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVTIA 117


>UniRef50_UPI00015B60B9 Cluster: PREDICTED: similar to
           ENSANGP00000022492; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000022492 - Nasonia
           vitripennis
          Length = 483

 Score = 95.9 bits (228), Expect = 5e-19
 Identities = 44/48 (91%), Positives = 48/48 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKRVIDL+SPSEIVKQITSI++EPGVEVEVTIA+
Sbjct: 435 GEGSKTWDRFQMRIHKRVIDLYSPSEIVKQITSISLEPGVEVEVTIAN 482



 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 27/31 (87%), Positives = 28/31 (90%)
 Frame = +1

Query: 235 LINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           LI   KKQKL+VKGPVRMPTKILRITTRKTP
Sbjct: 403 LIQRGKKQKLKVKGPVRMPTKILRITTRKTP 433


>UniRef50_Q5M8F0 Cluster: Putative uncharacterized protein; n=2;
           Tetrapoda|Rep: Putative uncharacterized protein -
           Xenopus tropicalis (Western clawed frog) (Silurana
           tropicalis)
          Length = 82

 Score = 82.6 bits (195), Expect = 5e-15
 Identities = 41/57 (71%), Positives = 47/57 (82%), Gaps = 1/57 (1%)
 Frame = +1

Query: 133 KDIEK-PQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKI 300
           KD  K P  +   IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK+
Sbjct: 4   KDAGKAPVDQEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKV 60


>UniRef50_Q86H15 Cluster: 40S rRNA protein-like protein; n=10;
           Bilateria|Rep: 40S rRNA protein-like protein -
           Schistosoma japonicum (Blood fluke)
          Length = 121

 Score = 78.6 bits (185), Expect = 8e-14
 Identities = 39/71 (54%), Positives = 52/71 (73%)
 Frame = +1

Query: 115 AAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPT 294
           AA+++ K  + PQ  +S    +R+TLT+ +++ LEKV   LI  AK Q LRVKGPVRMPT
Sbjct: 2   AAMIAEKKADVPQ--LSTTKWVRVTLTAASIKPLEKVADGLIKKAKDQNLRVKGPVRMPT 59

Query: 295 KILRITTRKTP 327
           K+LR+TTRKTP
Sbjct: 60  KVLRVTTRKTP 70



 Score = 65.3 bits (152), Expect = 8e-10
 Identities = 29/47 (61%), Positives = 35/47 (74%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIA 472
           GEGSKTWDRFQ+RIHKRVIDL S  E   Q+  I +EPGV  +V ++
Sbjct: 72  GEGSKTWDRFQLRIHKRVIDLLSTDEATLQLKHIYLEPGVNCDVIVS 118


>UniRef50_UPI0000498481 Cluster: 40S ribosomal protein S20; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S20 - Entamoeba histolytica HM-1:IMSS
          Length = 118

 Score = 69.7 bits (163), Expect = 4e-11
 Identities = 29/48 (60%), Positives = 39/48 (81%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWD +QMRI+KRV+ + +  E VK+ITS+ +EPGVE+EV + D
Sbjct: 71  GEGSKTWDHYQMRIYKRVLSMKTTPETVKEITSLKVEPGVELEVAMFD 118



 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 33/65 (50%), Positives = 45/65 (69%)
 Frame = +1

Query: 133 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRIT 312
           KDI+ P         I IT+TS  V+++E +CA++    KK+ ++VKGPVR+PTK LRIT
Sbjct: 6   KDIKAPVTP-KVYKNITITITSTKVKAVESLCAEVKENGKKKGVQVKGPVRIPTKTLRIT 64

Query: 313 TRKTP 327
           TRKTP
Sbjct: 65  TRKTP 69


>UniRef50_Q22DC6 Cluster: Ribosomal protein S10 containing protein;
           n=5; Eukaryota|Rep: Ribosomal protein S10 containing
           protein - Tetrahymena thermophila SB210
          Length = 120

 Score = 68.5 bits (160), Expect = 8e-11
 Identities = 33/66 (50%), Positives = 51/66 (77%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKK-QKLRVKGPVRMPTKILRI 309
           K+ +K + EV  + R+RITLT +N++S+EK  +++++ AKK +++ VKGPVRMPTK L I
Sbjct: 5   KETKKGEEEVKKV-RVRITLTCKNLKSVEKATSEIVSRAKKTEQVEVKGPVRMPTKTLVI 63

Query: 310 TTRKTP 327
           T RK+P
Sbjct: 64  TVRKSP 69



 Score = 66.1 bits (154), Expect = 4e-10
 Identities = 29/46 (63%), Positives = 37/46 (80%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           GEGSKTWDRF+MRI+KR+IDL      VK IT+  I+PGVE+E+T+
Sbjct: 71  GEGSKTWDRFEMRIYKRIIDLTCNVPDVKTITNFRIDPGVEIELTM 116


>UniRef50_Q4Q8G4 Cluster: Ribosomal protein s20, putative; n=4;
           Trypanosomatidae|Rep: Ribosomal protein s20, putative -
           Leishmania major
          Length = 116

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 27/48 (56%), Positives = 39/48 (81%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           G G+ TWD F+++I+KR+IDLH+P+E VK+ITS  +E GV+V +TI D
Sbjct: 68  GNGTNTWDTFELKIYKRIIDLHAPTEQVKKITSFTMESGVDVSITILD 115



 Score = 65.3 bits (152), Expect = 8e-10
 Identities = 28/62 (45%), Positives = 45/62 (72%)
 Frame = +1

Query: 142 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRK 321
           +K QA  +    +R+T+TSRN +++E V + L+  A+ +K+ + GPVR+PT+ L+ITTRK
Sbjct: 5   KKNQAAPAEGQTVRLTITSRNAKAVESVTSQLLTRARDEKVTIHGPVRLPTRTLKITTRK 64

Query: 322 TP 327
           TP
Sbjct: 65  TP 66


>UniRef50_UPI0000D99BC8 Cluster: PREDICTED: similar to 40S ribosomal
           protein S20; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to 40S ribosomal protein S20 - Macaca mulatta
          Length = 71

 Score = 62.9 bits (146), Expect = 4e-09
 Identities = 29/39 (74%), Positives = 35/39 (89%)
 Frame = +2

Query: 362 QMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           +M+IH ++IDL SPSEIVKQITS++IEP VE EVTIADA
Sbjct: 33  KMKIHNQLIDLQSPSEIVKQITSVSIEPEVEAEVTIADA 71


>UniRef50_A0BD80 Cluster: Chromosome undetermined scaffold_10, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_10,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 123

 Score = 62.9 bits (146), Expect = 4e-09
 Identities = 27/46 (58%), Positives = 32/46 (69%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           GEGSKTWDRF+MRIHKRVID        K IT+  I PG+ VE+ +
Sbjct: 75  GEGSKTWDRFEMRIHKRVIDFQCTLPTFKDITNFKIGPGINVELNV 120



 Score = 41.5 bits (93), Expect = 0.011
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 6/68 (8%)
 Frame = +1

Query: 142 EKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAK----KQKLRV--KGPVRMPTKIL 303
           EK   +     +IR+ +TSR+ + LE     +I   +     Q  +V  KGPVRMPTK L
Sbjct: 6   EKKVEDEQQTKKIRMIVTSRSAQDLENFTNQVIEKTRGIQRDQGAQVVFKGPVRMPTKHL 65

Query: 304 RITTRKTP 327
           ++T RK+P
Sbjct: 66  KMTVRKSP 73


>UniRef50_A2EK65 Cluster: Ribosomal protein S10p/S20e, putative;
           n=3; Trichomonas vaginalis G3|Rep: Ribosomal protein
           S10p/S20e, putative - Trichomonas vaginalis G3
          Length = 123

 Score = 62.5 bits (145), Expect = 5e-09
 Identities = 31/73 (42%), Positives = 46/73 (63%)
 Frame = +1

Query: 109 MAAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRM 288
           MA  VV   D +K   E  P+ +IR+T+TS  + +L++V  +L+   KK  L V+GP+ M
Sbjct: 1   MADRVVPTGDEKKEIVEDLPVQKIRLTITSSKLPNLQRVVGNLMGKLKKGNLEVRGPIPM 60

Query: 289 PTKILRITTRKTP 327
           P + LRITTR+ P
Sbjct: 61  PRRRLRITTRRAP 73



 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 24/46 (52%), Positives = 35/46 (76%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           G G++T+D F++RI+KRVID    +E VKQ+T I +EP V VEV++
Sbjct: 75  GNGTETYDHFELRIYKRVIDFQGTAEAVKQVTQIALEPDVHVEVSV 120


>UniRef50_Q98S21 Cluster: 40S ribosomal protein S20; n=1; Guillardia
           theta|Rep: 40S ribosomal protein S20 - Guillardia theta
           (Cryptomonas phi)
          Length = 116

 Score = 60.5 bits (140), Expect = 2e-08
 Identities = 23/46 (50%), Positives = 33/46 (71%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           GEG+ TWD+F+M+IHKR+ID HS       IT IN++ G+E++  I
Sbjct: 67  GEGTNTWDKFEMKIHKRIIDFHSNKSEFNSITPINLDNGIEIDAQI 112



 Score = 55.6 bits (128), Expect = 6e-07
 Identities = 22/50 (44%), Positives = 36/50 (72%)
 Frame = +1

Query: 178 IRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +RITLTS+++ SLEK C ++I   K+    ++GP+R+PTK + +  RK+P
Sbjct: 16  LRITLTSKHLISLEKACKEIIEKNKENNYHIRGPIRIPTKKINLNVRKSP 65


>UniRef50_O29324 Cluster: 30S ribosomal protein S10P; n=35;
           Archaea|Rep: 30S ribosomal protein S10P - Archaeoglobus
           fulgidus
          Length = 106

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 23/58 (39%), Positives = 36/58 (62%)
 Frame = +2

Query: 296 RSCVSPPVKLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           R  V P  K   GEGS+TWD ++MR+HKR+ID+ +    ++QI  I +   V +E+ +
Sbjct: 47  RRMVVPVRKAPDGEGSETWDHWEMRVHKRLIDISADERALRQIMRIQVPRDVNIEIVL 104



 Score = 40.7 bits (91), Expect = 0.019
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           + RI L+  N R L+++C+ +   A K  + + GPV +PT+ + +  RK P
Sbjct: 7   KARIKLSGLNPRELDRICSQIKEIANKTGVELSGPVPLPTRRMVVPVRKAP 57


>UniRef50_P17199 Cluster: 30S ribosomal protein S10P; n=15;
           Archaea|Rep: 30S ribosomal protein S10P - Sulfolobus
           acidocaldarius
          Length = 102

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 16/53 (30%), Positives = 35/53 (66%)
 Frame = +2

Query: 311 PPVKLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           P ++L  GEG K W+ ++M++HKR+ID+ +   +++Q+  + +   V +E+ +
Sbjct: 49  PVMRLPHGEGKKKWEHWEMKVHKRIIDIAADERVMRQLMRVRVPDDVYIEIEL 101



 Score = 35.5 bits (78), Expect = 0.71
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           + RI L S N+ SL  V   + N A+K  ++V GP+ +PT  + +   + P
Sbjct: 4   KARIRLWSSNIDSLNFVVNQIRNMAQKTGIQVSGPIPLPTTRMEVPVMRLP 54


>UniRef50_A0RUM5 Cluster: Ribosomal protein S10; n=3;
           Thermoprotei|Rep: Ribosomal protein S10 - Cenarchaeum
           symbiosum
          Length = 102

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 181 RITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           R+ LTS N+  L+ VC  +++  K+  +R+KGP  +P K L I TRK+P
Sbjct: 6   RVKLTSINLLKLDGVCGIIMDIGKRTGVRIKGPTPLPVKKLHIATRKSP 54



 Score = 39.9 bits (89), Expect = 0.033
 Identities = 12/44 (27%), Positives = 32/44 (72%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEV 463
           G G++T+++++MR+H+R+ID+ +  + ++++  + I   V +E+
Sbjct: 56  GSGTETYEKWEMRMHRRIIDISADDKTIRRLIDLKIPDDVHLEL 99


>UniRef50_UPI00015BAA87 Cluster: SSU ribosomal protein S10P; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: SSU ribosomal protein
           S10P - Ignicoccus hospitalis KIN4/I
          Length = 106

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 19/51 (37%), Positives = 34/51 (66%)
 Frame = +2

Query: 317 VKLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           ++L  GEG+K +D ++MRIHKR+ID+    ++++ I  I +   V +E+ I
Sbjct: 53  LRLPHGEGTKVFDHWEMRIHKRLIDVELNDKVMRNIMRIRVPSNVYIEIQI 103



 Score = 39.9 bits (89), Expect = 0.033
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +1

Query: 166 PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           P +  RI + S +V+S+E+V   +   A++  + V+GPV +P K L I+T + P
Sbjct: 3   PKNMARIKMWSTDVKSIEEVAKQIREIAERSGVEVRGPVPLPVKRLEISTLRLP 56


>UniRef50_A3H8H3 Cluster: Ribosomal protein S10; n=2;
           Thermoproteales|Rep: Ribosomal protein S10 - Caldivirga
           maquilingensis IC-167
          Length = 121

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 17/46 (36%), Positives = 31/46 (67%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTI 469
           G+G  T+D ++MRIHKRV+D+ +    ++Q+  + I   V+VE+ +
Sbjct: 74  GQGYHTYDHWEMRIHKRVVDMDADERALRQLMRLRIPEDVKVEIEL 119



 Score = 43.2 bits (97), Expect = 0.004
 Identities = 20/55 (36%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +1

Query: 166 PIHRI-RITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           P+ RI RI +   N  S++ +  D+   AKK  ++V+GP+ +PT+ L +T R+ P
Sbjct: 18  PVPRIVRIRIWGTNTDSVDGLARDITGIAKKLGIKVRGPIPLPTRRLMVTVRRAP 72


>UniRef50_Q74MI5 Cluster: 30S ribosomal protein S10P; n=1;
           Nanoarchaeum equitans|Rep: 30S ribosomal protein S10P -
           Nanoarchaeum equitans
          Length = 109

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 15/36 (41%), Positives = 25/36 (69%)
 Frame = +2

Query: 311 PPVKLLGGEGSKTWDRFQMRIHKRVIDLHSPSEIVK 418
           P +++ G  G+K WD +QMRIH+R+ID+ +    +K
Sbjct: 48  PVLRITGHRGTKIWDTYQMRIHRRIIDIATDDRTIK 83



 Score = 34.3 bits (75), Expect = 1.6
 Identities = 14/44 (31%), Positives = 28/44 (63%)
 Frame = +1

Query: 178 IRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           +RI + S ++  L +V   +    K+  ++++GP+ +PTKILR+
Sbjct: 4   LRIKIYSTDLEELNRVVEKIKEIVKQTGVKMRGPIPLPTKILRV 47


>UniRef50_Q9PLX0 Cluster: 30S ribosomal protein S10; n=15;
           Campylobacter|Rep: 30S ribosomal protein S10 -
           Campylobacter jejuni
          Length = 103

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +1

Query: 169 IHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           + RIR+ L + + R L++  A ++   K+    ++GP+ MPTKI R T  K+P
Sbjct: 1   MERIRLKLKAYDHRVLDRTVAAIVEAVKRTGADIRGPIPMPTKIKRYTVLKSP 53


>UniRef50_Q4UMT0 Cluster: 30S ribosomal protein S10; n=23;
           Bacteria|Rep: 30S ribosomal protein S10 - Rickettsia
           felis (Rickettsia azadi)
          Length = 105

 Score = 39.9 bits (89), Expect = 0.033
 Identities = 16/52 (30%), Positives = 32/52 (61%)
 Frame = +1

Query: 172 HRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           ++I+I L S + RSL++   ++++  K+    + GP+ +P KI R T  ++P
Sbjct: 3   NKIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPRKIERFTVNRSP 54


>UniRef50_Q9LK61 Cluster: 30S ribosomal protein S10, chloroplast
           precursor; n=33; cellular organisms|Rep: 30S ribosomal
           protein S10, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 191

 Score = 39.1 bits (87), Expect = 0.057
 Identities = 22/72 (30%), Positives = 35/72 (48%)
 Frame = +1

Query: 112 AAAVVSGKDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 291
           A+ V S   I     +++P  +IRI L S  V  +E  C  +++ A+    +  GPV +P
Sbjct: 73  ASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLP 132

Query: 292 TKILRITTRKTP 327
           TK       K+P
Sbjct: 133 TKKRIYCVLKSP 144


>UniRef50_A4RTZ9 Cluster: Plastid ribosomal protein S10 small
           ribosomal subunit; n=1; Ostreococcus lucimarinus
           CCE9901|Rep: Plastid ribosomal protein S10 small
           ribosomal subunit - Ostreococcus lucimarinus CCE9901
          Length = 136

 Score = 37.9 bits (84), Expect = 0.13
 Identities = 18/49 (36%), Positives = 25/49 (51%)
 Frame = +1

Query: 151 QAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTK 297
           QA      +IRI L S     ++  C  ++  AK  + RV GPV +PTK
Sbjct: 31  QAAAVQASKIRIRLRSFETNHMQSACDKILEAAKATEARVSGPVPLPTK 79



 Score = 33.5 bits (73), Expect = 2.8
 Identities = 12/40 (30%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
 Frame = +2

Query: 353 DRFQMRIHKRVIDLHSP-SEIVKQITSINIEPGVEVEVTI 469
           + F+ R H R+ID+H P ++ +  + ++ +  GV+VE+ +
Sbjct: 97  EHFETRTHHRLIDVHQPTAQTIDALMALELPSGVDVEIKL 136


>UniRef50_Q2GEE0 Cluster: 30S ribosomal protein S10; n=5;
           Proteobacteria|Rep: 30S ribosomal protein S10 -
           Neorickettsia sennetsu (strain Miyayama)
          Length = 103

 Score = 37.5 bits (83), Expect = 0.17
 Identities = 17/51 (33%), Positives = 29/51 (56%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +IRI L S +   L +   +++  AK+    V GP+ +PT++ R T  K+P
Sbjct: 3   KIRIKLKSFDSGILHRSTKEIVMAAKRNGALVSGPIPLPTRVSRYTVNKSP 53


>UniRef50_Q6MJ14 Cluster: 30S ribosomal protein S10; n=14;
           Bacteria|Rep: 30S ribosomal protein S10 - Bdellovibrio
           bacteriovorus
          Length = 105

 Score = 37.1 bits (82), Expect = 0.23
 Identities = 14/44 (31%), Positives = 32/44 (72%), Gaps = 1/44 (2%)
 Frame = +2

Query: 344 KTWDRFQMRIHKRVIDLHSPSE-IVKQITSINIEPGVEVEVTIA 472
           K+ ++F++R HKR++D+  P++  V Q+  +++  GV+VE+ ++
Sbjct: 60  KSREQFEVRTHKRMLDILEPTQQTVDQLMKLDLSAGVDVEIKLS 103



 Score = 35.5 bits (78), Expect = 0.71
 Identities = 15/51 (29%), Positives = 32/51 (62%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +IRI L + + + L++   +++  A++   +V GP+ +PT+I R T  ++P
Sbjct: 5   KIRIRLKAFDHKLLDQSTKEIVETARRTGAKVAGPIPLPTRINRYTVLRSP 55


>UniRef50_Q7VQE9 Cluster: 30S ribosomal protein S10; n=10;
           Proteobacteria|Rep: 30S ribosomal protein S10 -
           Blochmannia floridanus
          Length = 103

 Score = 36.7 bits (81), Expect = 0.31
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           RIRI L + + R +++   D++  AK+   +V GP+ +PTK  R T   +P
Sbjct: 5   RIRIRLKAFDHRLIDRSTLDIVETAKRTGAQVHGPIPLPTKKERFTILVSP 55



 Score = 33.5 bits (73), Expect = 2.8
 Identities = 12/40 (30%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +2

Query: 353 DRFQMRIHKRVIDLHSPSE-IVKQITSINIEPGVEVEVTI 469
           D++++R HKR+ID+  P++  V  +  +++  GV+V++++
Sbjct: 63  DQYEIRTHKRLIDIVDPTDKTVDALMKLDLAAGVDVQISL 102


>UniRef50_Q6F7R1 Cluster: 30S ribosomal protein S10; n=23;
           Bacteria|Rep: 30S ribosomal protein S10 - Acinetobacter
           sp. (strain ADP1)
          Length = 103

 Score = 36.7 bits (81), Expect = 0.31
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           RIRI L S + R +++   +++  AK+   +V GP+ MPT+I R     +P
Sbjct: 5   RIRIRLKSFDHRLIDQSSQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSP 55


>UniRef50_Q7R349 Cluster: GLP_554_44441_44061; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_554_44441_44061 - Giardia lamblia
           ATCC 50803
          Length = 126

 Score = 35.9 bits (79), Expect = 0.53
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIE-PGVEVEVTIAD 475
           GEG+ TW RF++R++KR   +      +  I S  +  PG++V V + +
Sbjct: 74  GEGTNTWHRFELRMYKRTFWVTCGGNDISTILSKTVVIPGIQVTVEVEE 122


>UniRef50_Q7U4D0 Cluster: 30S ribosomal protein S10; n=136; cellular
           organisms|Rep: 30S ribosomal protein S10 - Synechococcus
           sp. (strain WH8102)
          Length = 106

 Score = 35.9 bits (79), Expect = 0.53
 Identities = 13/40 (32%), Positives = 28/40 (70%), Gaps = 1/40 (2%)
 Frame = +2

Query: 353 DRFQMRIHKRVIDLHSPS-EIVKQITSINIEPGVEVEVTI 469
           + F+ R H+R+ID++SPS + +  +  +++  GV++EV +
Sbjct: 67  EHFETRTHRRIIDIYSPSAKTIDALMKLDLPSGVDIEVKL 106


>UniRef50_Q6MER9 Cluster: 30S ribosomal protein S10; n=7;
           Bacteria|Rep: 30S ribosomal protein S10 - Protochlamydia
           amoebophila (strain UWE25)
          Length = 111

 Score = 35.5 bits (78), Expect = 0.71
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           +IRI L   + R L++   D++  AK+    + GP+ +PT   + T  ++P
Sbjct: 14  KIRIRLKGYDQRLLDRSTGDIVETAKRTGAAIAGPIPLPTSCEKFTVLRSP 64



 Score = 33.1 bits (72), Expect = 3.8
 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 293 PRSCVSPPVKLLGGEGSKTWDRFQMRIHKRVIDLHSP-SEIVKQITSINIEPGVEVEV 463
           P SC    V        K+ ++F++R H+R+ID+ +P S+ +  + ++ +  GV++++
Sbjct: 52  PTSCEKFTVLRSPNIDRKSREQFEIRTHRRLIDILNPTSKTIDALKTLTLPAGVDIKI 109


>UniRef50_P66331 Cluster: 30S ribosomal protein S10; n=234;
           Bacteria|Rep: 30S ribosomal protein S10 - Listeria
           innocua
          Length = 102

 Score = 35.1 bits (77), Expect = 0.93
 Identities = 13/40 (32%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +2

Query: 353 DRFQMRIHKRVIDLHSPS-EIVKQITSINIEPGVEVEVTI 469
           ++F+MR HKR+ID+ +P+ + V  +  +++  GV++E+ +
Sbjct: 63  EQFEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 102


>UniRef50_Q88XY7 Cluster: 30S ribosomal protein S10; n=18;
           Bacteria|Rep: 30S ribosomal protein S10 - Lactobacillus
           plantarum
          Length = 102

 Score = 35.1 bits (77), Expect = 0.93
 Identities = 13/40 (32%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +2

Query: 353 DRFQMRIHKRVIDLHSPS-EIVKQITSINIEPGVEVEVTI 469
           ++F+MR HKR+ID+ +P+ + V  +  +++  GV++E+ +
Sbjct: 63  EQFEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>UniRef50_O21246 Cluster: Mitochondrial ribosomal protein S10; n=1;
           Reclinomonas americana|Rep: Mitochondrial ribosomal
           protein S10 - Reclinomonas americana
          Length = 116

 Score = 34.7 bits (76), Expect = 1.2
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = +1

Query: 169 IHRIRITLTSRNVRSLEKVCADLI-NGAKKQKLRVKGPVRMPTKILRITTRKTP 327
           I +  + L S ++  L+  CA ++ N    Q L++ GP+ +PTKI +IT  ++P
Sbjct: 3   ITKCSLHLKSFDLDVLKDSCALILKNKINLQNLKLTGPINLPTKIKKITVLRSP 56


>UniRef50_A0T870 Cluster: Putative uncharacterized protein; n=2;
           Burkholderia ambifaria|Rep: Putative uncharacterized
           protein - Burkholderia ambifaria MC40-6
          Length = 325

 Score = 33.1 bits (72), Expect = 3.8
 Identities = 22/52 (42%), Positives = 29/52 (55%)
 Frame = +2

Query: 74  KLFISAGIQQATWQPL*CQAKTSRNPRQRSPLFTASGSLLLLAMCAHSRRSV 229
           + FI+AGI   TWQPL     T+R P   +  F+  G+L LLA  A  R S+
Sbjct: 231 RTFIAAGIHPETWQPL----ATARRPAMIA--FSIIGALGLLAFWAWGRMSL 276


>UniRef50_Q9TLV9 Cluster: Chloroplast 30S ribosomal protein S10;
           n=1; Cyanidium caldarium|Rep: Chloroplast 30S ribosomal
           protein S10 - Cyanidium caldarium
          Length = 109

 Score = 32.7 bits (71), Expect = 5.0
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 175 RIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTK 297
           ++RI L+S +   L   C +++   K+    VKGPV +PT+
Sbjct: 12  KVRIKLSSYSASLLNLSCNNVLQSIKESNTSVKGPVFLPTR 52


>UniRef50_Q8RC68 Cluster: Subtilisin-like serine proteases; n=4;
           Thermoanaerobacter|Rep: Subtilisin-like serine proteases
           - Thermoanaerobacter tengcongensis
          Length = 412

 Score = 32.3 bits (70), Expect = 6.6
 Identities = 23/75 (30%), Positives = 34/75 (45%)
 Frame = -3

Query: 284 RTGPFTRSFCFLAPLIRSAQTFSSERTLREVRVILMR*IGETSAWGFSMSLPDTTAAAML 105
           R GP+      +AP ++   T S         +++ +     SA G SM+ P    A  L
Sbjct: 309 RGGPYLYKPDVVAPGVKIVSTASGNVPFGADEIMINK--PYRSATGTSMATPMVAGAVAL 366

Query: 104 LVEFRPR*TTFQIKN 60
           L+E  PR T  +IKN
Sbjct: 367 LLEKNPRLTNVEIKN 381


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 528,671,085
Number of Sequences: 1657284
Number of extensions: 11047712
Number of successful extensions: 27373
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 26620
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27365
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 30946432294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -