SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4GXT1 Cluster: Ribosomal protein S10e; n=3; Fungi/Meta...   256   3e-67
UniRef50_P46783 Cluster: 40S ribosomal protein S10; n=110; Eukar...   219   5e-56
UniRef50_Q5I678 Cluster: Ribosomal protein S10; n=3; Protostomia...   194   2e-48
UniRef50_Q7Q769 Cluster: ENSANGP00000021717; n=1; Anopheles gamb...   151   1e-35
UniRef50_Q9FFS8 Cluster: 40S ribosomal protein S10-2; n=17; Magn...   143   2e-33
UniRef50_UPI00015A7570 Cluster: 40S ribosomal protein S10.; n=1;...   140   2e-32
UniRef50_Q6CC88 Cluster: Yarrowia lipolytica chromosome C of str...   140   3e-32
UniRef50_UPI0000F1FEF3 Cluster: PREDICTED: similar to LOC398682 ...   139   5e-32
UniRef50_Q5DDJ0 Cluster: SJCHGC09089 protein; n=1; Schistosoma j...   136   2e-31
UniRef50_Q7T0R2 Cluster: LOC398682 protein; n=2; Xenopus|Rep: LO...   136   4e-31
UniRef50_Q2V3E9 Cluster: Uncharacterized protein At4g25740.2; n=...   134   1e-30
UniRef50_O77082 Cluster: 40S ribosomal protein S10; n=2; Dictyos...   124   1e-27
UniRef50_Q4YT30 Cluster: 40S ribosomal protein S10, putative; n=...   123   3e-27
UniRef50_Q15149 Cluster: Plectin-1; n=128; cellular organisms|Re...   123   3e-27
UniRef50_P46784 Cluster: 40S ribosomal protein S10-B; n=40; Fung...   120   2e-26
UniRef50_UPI0001554D31 Cluster: PREDICTED: similar to plectin 1,...   105   9e-22
UniRef50_Q5CHY3 Cluster: Ribosomal protein S10; n=4; Apicomplexa...   103   4e-21
UniRef50_Q4Q1X7 Cluster: 40S ribosomal protein S10, putative; n=...    94   2e-18
UniRef50_Q7ZZT9 Cluster: 40S ribosomal protein S10; n=2; Euteleo...    87   2e-16
UniRef50_Q7TP86 Cluster: Ab1-331; n=1; Rattus norvegicus|Rep: Ab...    87   2e-16
UniRef50_A0CR54 Cluster: Chromosome undetermined scaffold_25, wh...    83   4e-15
UniRef50_UPI0000498FD7 Cluster: 40S ribosomal protein S10; n=1; ...    79   9e-14
UniRef50_Q24F70 Cluster: Plectin/S10 domain containing protein; ...    72   8e-12
UniRef50_A2FYF5 Cluster: Plectin/S10 domain containing protein; ...    69   7e-11
UniRef50_Q98RW8 Cluster: 40S ribosomal protein S10B; n=1; Guilla...    69   1e-10
UniRef50_Q7QZU4 Cluster: GLP_609_26297_25893; n=1; Giardia lambl...    58   2e-07
UniRef50_Q8SS17 Cluster: 40S RIBOSOMAL PROTEIN S10; n=1; Encepha...    45   0.001
UniRef50_Q4RUK8 Cluster: Chromosome 8 SCAF14994, whole genome sh...    43   0.004
UniRef50_Q3LVY9 Cluster: Ribosomal protein S10; n=1; Bigelowiell...    43   0.004
UniRef50_Q178B7 Cluster: Caspase-3; n=2; Aedes aegypti|Rep: Casp...    37   0.28 
UniRef50_Q9AVH4 Cluster: Putative senescence-associated protein;...    36   0.64 
UniRef50_A6E866 Cluster: Putative uncharacterized protein; n=1; ...    36   0.85 
UniRef50_Q5YQF6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.1  
UniRef50_UPI00001CD590 Cluster: PREDICTED: similar to Mortality ...    35   1.5  
UniRef50_Q6Y201 Cluster: 40S ribosomal protein S10; n=1; Pagrus ...    35   1.5  
UniRef50_Q6UDF2 Cluster: Regulatory protein; n=1; Psittacid herp...    34   2.0  
UniRef50_A4WRE5 Cluster: Putative uncharacterized protein; n=3; ...    34   2.0  
UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074...    34   2.0  
UniRef50_UPI0000DD7D1C Cluster: PREDICTED: hypothetical protein;...    34   2.6  
UniRef50_Q1WMR1 Cluster: Quinidine resistance protein-like prote...    34   2.6  
UniRef50_UPI000155BEFB Cluster: PREDICTED: hypothetical protein,...    33   3.4  
UniRef50_Q1DF67 Cluster: Putative uncharacterized protein; n=1; ...    33   3.4  
UniRef50_Q22S36 Cluster: Putative uncharacterized protein; n=1; ...    33   3.4  
UniRef50_A6NN13 Cluster: Uncharacterized protein ENSP00000365490...    33   3.4  
UniRef50_A6G9B3 Cluster: Putative uncharacterized protein; n=1; ...    33   4.5  
UniRef50_A1HG71 Cluster: Transcriptional regulator, AraC family;...    33   4.5  
UniRef50_Q8SQS1 Cluster: UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLA...    33   4.5  
UniRef50_Q7SG28 Cluster: Putative uncharacterized protein NCU025...    33   4.5  
UniRef50_UPI0001553276 Cluster: PREDICTED: hypothetical protein;...    33   6.0  
UniRef50_UPI0000EBDD73 Cluster: PREDICTED: hypothetical protein;...    33   6.0  
UniRef50_Q4IWC1 Cluster: Similar to ABC-type phosphonate transpo...    33   6.0  
UniRef50_Q3W9H0 Cluster: Inner-membrane translocator:ABC transpo...    33   6.0  
UniRef50_O66158 Cluster: ORF E protein; n=1; Streptomyces kasuga...    33   6.0  
UniRef50_A4RJF5 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_A7HDX3 Cluster: Putative uncharacterized protein; n=1; ...    32   7.9  
UniRef50_A2YFL5 Cluster: Putative uncharacterized protein; n=2; ...    32   7.9  

>UniRef50_Q4GXT1 Cluster: Ribosomal protein S10e; n=3; Fungi/Metazoa
           group|Rep: Ribosomal protein S10e - Agriotes lineatus
           (Lined click beetle)
          Length = 157

 Score =  256 bits (626), Expect = 3e-67
 Identities = 119/159 (74%), Positives = 134/159 (84%), Gaps = 1/159 (0%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           MLMPK++R++IYEYLFKEGVMVAKKDYHAPKH ELE IPNLQVIKAMQSLKSRGYVKEQF
Sbjct: 1   MLMPKKSRISIYEYLFKEGVMVAKKDYHAPKHPELEMIPNLQVIKAMQSLKSRGYVKEQF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAP-ARSAEDR 412
           AWRHFYWYLTNEGIEYLR FLHLPPEIVPATLKR +RTET R      P    ++ +EDR
Sbjct: 61  AWRHFYWYLTNEGIEYLRTFLHLPPEIVPATLKRQIRTETARPRAAAMPGREMSKPSEDR 120

Query: 413 SAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRP 529
           + YRRT   PG    DKKADVG G+A++EF+GG+GRG+P
Sbjct: 121 AGYRRTGGPPG---SDKKADVGAGTAEMEFRGGFGRGKP 156


>UniRef50_P46783 Cluster: 40S ribosomal protein S10; n=110;
           Eukaryota|Rep: 40S ribosomal protein S10 - Homo sapiens
           (Human)
          Length = 165

 Score =  219 bits (534), Expect = 5e-56
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>UniRef50_Q5I678 Cluster: Ribosomal protein S10; n=3;
           Protostomia|Rep: Ribosomal protein S10 - Pectinaria
           gouldii (Trumpet worm) (Ice-cream cone worm)
          Length = 163

 Score =  194 bits (472), Expect = 2e-48
 Identities = 96/160 (60%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAP-KHTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           ML+P   R  IYEYLFKEGV+VAKK  +   KH  L  + NL VIKA Q LKSRG VKE 
Sbjct: 1   MLIPNAQRKEIYEYLFKEGVLVAKKANNTTGKHDILNSVRNLYVIKACQGLKSRGMVKET 60

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDR 412
           F WRH+YWYLTNEGI+YLR +LHLP EIVP+TLKR  R E  R  P    ++  R ++DR
Sbjct: 61  FCWRHYYWYLTNEGIQYLRDYLHLPAEIVPSTLKRQTRAEPARARPKEGMESGPRPSDDR 120

Query: 413 SAYRRTPAAPGVAPHD-KKADVGPGSADLEFKGGYGRGRP 529
           SAYRR   APG  P D K A++G G+AD++F+GGYGRGRP
Sbjct: 121 SAYRRN--APGGGPPDAKNAEMGAGTADMQFRGGYGRGRP 158


>UniRef50_Q7Q769 Cluster: ENSANGP00000021717; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000021717 - Anopheles gambiae
           str. PEST
          Length = 159

 Score =  151 bits (365), Expect = 1e-35
 Identities = 79/159 (49%), Positives = 101/159 (63%), Gaps = 3/159 (1%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M +PK NR AIY  L+K+GV+VA+KD+    H EL+ IPNLQVI  ++SL SR Y KE+F
Sbjct: 1   MFIPKANRNAIYTALYKDGVLVARKDHRPSMHCELKTIPNLQVIVTLKSLISRNYAKEKF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATL---KRSVRTETVRRGPVGRPDAPARSAE 406
            W  ++W LTNEGI YLR  LH P E+VPATL   +R+VR  T  +       A  R  E
Sbjct: 61  VWNTYHWTLTNEGIIYLRDCLHFPLEVVPATLIRRERAVRDSTNCKAVRQEGFAQRRDTE 120

Query: 407 DRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
            R  YRR P        DK+ DVG G+ +L+F+GG+GRG
Sbjct: 121 GREMYRRQPN----RYVDKRGDVGSGTGELQFRGGFGRG 155


>UniRef50_Q9FFS8 Cluster: 40S ribosomal protein S10-2; n=17;
           Magnoliophyta|Rep: 40S ribosomal protein S10-2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 180

 Score =  143 bits (347), Expect = 2e-33
 Identities = 78/163 (47%), Positives = 101/163 (61%), Gaps = 6/163 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ + NR  I +YLFKEGV+ AKKD++ P+H  +E +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG-RPDAPARS---- 400
           AW H+YW+LTNEGI++LR +L+LP EIVPATLK+  +      G  G RP  P R     
Sbjct: 61  AWMHYYWFLTNEGIDFLRTYLNLPSEIVPATLKKQQKPLGRPFGGGGDRPRGPPRGDGER 120

Query: 401 -AEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGR 526
              DR  YR  P + G   +  KA   P      F+GG G  R
Sbjct: 121 RFGDRDGYRGGPKSGG--EYGDKAG-APADYQPGFRGGAGGAR 160


>UniRef50_UPI00015A7570 Cluster: 40S ribosomal protein S10.; n=1;
           Danio rerio|Rep: 40S ribosomal protein S10. - Danio
           rerio
          Length = 148

 Score =  140 bits (339), Expect = 2e-32
 Identities = 84/151 (55%), Positives = 92/151 (60%), Gaps = 6/151 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H  KH EL  + +PNL V+KAMQSLKS GYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHLAKHPELADKNVPNLHVMKAMQSLKSCGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLT                       R  R ET R  P G    RP   AR
Sbjct: 61  QFAWRHFYWYLT-----------------------RQTRPETARPRPKGLEGERPARLAR 97

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA 490
              DR AYRR+ A PG    DKKA+ G G+A
Sbjct: 98  GEGDRDAYRRSAAQPGA---DKKAEAGAGAA 125


>UniRef50_Q6CC88 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=2;
           Saccharomycetales|Rep: Yarrowia lipolytica chromosome C
           of strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 185

 Score =  140 bits (338), Expect = 3e-32
 Identities = 67/134 (50%), Positives = 96/134 (71%)
 Frame = +2

Query: 53  KMLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           KML+PK++R  I++YLF++GV VAKKD++ PKH +++   NL VIKA+QSL S+G+VK Q
Sbjct: 47  KMLIPKEDRKKIHQYLFQQGVCVAKKDFNQPKHEDIDT-KNLYVIKALQSLTSKGFVKTQ 105

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDR 412
           F+W+++Y+ LT+EG+EYLR +LHLP  +VP T K++ R ET  +G  GRP+   R  E  
Sbjct: 106 FSWQYYYYTLTDEGVEYLREYLHLPEGVVPETHKKTAREETASQGRGGRPERGPRRQE-- 163

Query: 413 SAYRRTPAAPGVAP 454
             YRR  +    AP
Sbjct: 164 GEYRRYNSNKESAP 177


>UniRef50_UPI0000F1FEF3 Cluster: PREDICTED: similar to LOC398682
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           LOC398682 protein - Danio rerio
          Length = 1417

 Score =  139 bits (336), Expect = 5e-32
 Identities = 79/144 (54%), Positives = 91/144 (63%), Gaps = 16/144 (11%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAP-KHTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           M+MP  N  AIYE+LF++GVMVAKKD     KH E+  + NLQVI+AM SLKSRGYV E 
Sbjct: 1   MVMPLDNLRAIYEHLFRDGVMVAKKDKRPQTKHPEIAGVQNLQVIRAMGSLKSRGYVTET 60

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATL---KRSVRTETVRR---------GP-- 370
           FAWRHFYWYLTNEGI YLR +LHLP EIVP  L   +R V T  V R         GP  
Sbjct: 61  FAWRHFYWYLTNEGIVYLRDYLHLPAEIVPTPLQRVRRPVATLAVTRRAERVQTIEGPTS 120

Query: 371 -VGRPDAPARSAEDRSAYRRTPAA 439
            V +P       +DR  YRR  A+
Sbjct: 121 YVPKPGKMGAEKQDRQGYRRKTAS 144


>UniRef50_Q5DDJ0 Cluster: SJCHGC09089 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09089 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 159

 Score =  136 bits (330), Expect = 2e-31
 Identities = 70/160 (43%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           ML+P   R +I+E + ++GV+ A+ D     +     + NL VIK M+SLKSRGYV+EQ+
Sbjct: 1   MLLPITTRNSIFEKVIQDGVLTARNDVRPCYNHPTINVRNLYVIKTMRSLKSRGYVREQY 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAED-R 412
           AWR +YW+LT +GI YLR  LHLP +I+PATLK   R   +R    G   +  R   D R
Sbjct: 61  AWRTYYWFLTTDGINYLREVLHLPSDIIPATLKAPPR--DIRTPAAGMDQSGQRGPSDGR 118

Query: 413 SAYRRTPAAPGVAPHDKKA-DVGPGSADLEFKGGYGRGRP 529
            A+RR P  PG+        D     +++ F GGYGRGRP
Sbjct: 119 IAFRRGPVTPGMTGFGTPGKDAAIADSEVHFHGGYGRGRP 158


>UniRef50_Q7T0R2 Cluster: LOC398682 protein; n=2; Xenopus|Rep:
           LOC398682 protein - Xenopus laevis (African clawed frog)
          Length = 443

 Score =  136 bits (328), Expect = 4e-31
 Identities = 68/113 (60%), Positives = 80/113 (70%), Gaps = 1/113 (0%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAP-KHTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           MLMP     AIYE +F++GVMVAK D     +H E+  + NLQV KAM SLKSRG+V+E 
Sbjct: 5   MLMPLDQLRAIYEVVFRDGVMVAKNDERPQSRHAEVPGVTNLQVTKAMGSLKSRGFVRET 64

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAP 391
           F WRH YWYLTNEGI YLR +LHLPPEIVPA+L+R VR      G + RP AP
Sbjct: 65  FVWRHCYWYLTNEGIAYLRQYLHLPPEIVPASLQR-VRRPAPMPGVLRRPPAP 116


>UniRef50_Q2V3E9 Cluster: Uncharacterized protein At4g25740.2; n=3;
           Viridiplantae|Rep: Uncharacterized protein At4g25740.2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 149

 Score =  134 bits (324), Expect = 1e-30
 Identities = 63/119 (52%), Positives = 86/119 (72%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ + NR  I +YLFKEGV  AKKD++ PKH  ++ +PNLQVIK MQS KS+ YV+E F
Sbjct: 1   MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDR 412
           AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S +       P GRP    R  +++
Sbjct: 60  AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAK-------PGGRPFGGPRGGDEK 111


>UniRef50_O77082 Cluster: 40S ribosomal protein S10; n=2;
           Dictyostelium discoideum|Rep: 40S ribosomal protein S10
           - Dictyostelium discoideum (Slime mold)
          Length = 154

 Score =  124 bits (300), Expect = 1e-27
 Identities = 64/156 (41%), Positives = 94/156 (60%)
 Frame = +2

Query: 59  LMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFA 238
           L+P +N++AIY YLF+EGV+VA KD+H  KH ++E + NL V++ ++S KSR +V E F 
Sbjct: 3   LIPTENKLAIYRYLFQEGVLVAPKDFHLAKHPQIETVSNLDVLQILRSFKSRKFVTETFN 62

Query: 239 WRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSA 418
           W+++YW LT EGI+YLR +L +P  +VPAT+K+             RP    RS E    
Sbjct: 63  WQYYYWVLTEEGIKYLRTYLQVPESVVPATMKKQ----------ASRPSTYTRSEET--- 109

Query: 419 YRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGR 526
            +RT A+    P   + D   G    + +GG GRG+
Sbjct: 110 -KRTGASGDFDPSFNRGDRRQGG---DRRGGMGRGQ 141


>UniRef50_Q4YT30 Cluster: 40S ribosomal protein S10, putative; n=7;
           Aconoidasida|Rep: 40S ribosomal protein S10, putative -
           Plasmodium berghei
          Length = 137

 Score =  123 bits (296), Expect = 3e-27
 Identities = 58/103 (56%), Positives = 75/103 (72%)
 Frame = +2

Query: 62  MPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAW 241
           +PKQNR  IYEYLFKEGV+V +KD   P+H  L  IPNL ++  ++SLKSR YV+E++ W
Sbjct: 14  IPKQNRKLIYEYLFKEGVIVVEKDAKIPRHPHLN-IPNLHIMMTLKSLKSRKYVEEKYNW 72

Query: 242 RHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGP 370
           +H Y+ L NEGIE+LR FLHLPP I PATL +    +T+ R P
Sbjct: 73  KHQYFILNNEGIEFLREFLHLPPSIFPATLSK----KTINRAP 111


>UniRef50_Q15149 Cluster: Plectin-1; n=128; cellular organisms|Rep:
           Plectin-1 - Homo sapiens (Human)
          Length = 4684

 Score =  123 bits (296), Expect = 3e-27
 Identities = 71/140 (50%), Positives = 91/140 (65%), Gaps = 16/140 (11%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPK-HTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           MLMP+    AIYE LF+EGVMVAKKD      H  +  + NLQV++AM SL++RG V+E 
Sbjct: 5   MLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRET 64

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKR----------SVRTETVR--RGPVG 376
           FAW HF+WYLTNEGI +LR +LHLPPEIV A+L+R          + RT  V+  +GP+G
Sbjct: 65  FAWCHFFWYLTNEGIAHLRQYLHLPPEIVAASLQRVRRPVAMVMPARRTPHVQAVQGPLG 124

Query: 377 RPDAPARS---AEDRSAYRR 427
            P  P R     E++  YRR
Sbjct: 125 SP--PKRGPLPTEEQRLYRR 142


>UniRef50_P46784 Cluster: 40S ribosomal protein S10-B; n=40;
           Fungi/Metazoa group|Rep: 40S ribosomal protein S10-B -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 105

 Score =  120 bits (290), Expect = 2e-26
 Identities = 55/91 (60%), Positives = 73/91 (80%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           MLMPKQ R  I++YLF+EGV+VAKKD++  KH E++   NL VIKA+QSL S+GYVK QF
Sbjct: 1   MLMPKQERNKIHQYLFQEGVVVAKKDFNQAKHEEIDT-KNLYVIKALQSLTSKGYVKTQF 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPAT 328
           +W+++Y+ LT EG+EYLR +L+LP  IVP T
Sbjct: 60  SWQYYYYTLTEEGVEYLREYLNLPEHIVPGT 90


>UniRef50_UPI0001554D31 Cluster: PREDICTED: similar to plectin 1,
           intermediate filament binding protein 500kDa; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           plectin 1, intermediate filament binding protein 500kDa
           - Ornithorhynchus anatinus
          Length = 197

 Score =  105 bits (251), Expect = 9e-22
 Identities = 61/123 (49%), Positives = 74/123 (60%), Gaps = 21/123 (17%)
 Frame = +2

Query: 149 HTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPAT 328
           H ++ +  NLQVI+ M SLKSRG V+E FAWRHFYWYLTNEGI +LR +LHLPPEIVP +
Sbjct: 10  HQQVPRATNLQVIRVMGSLKSRGLVRETFAWRHFYWYLTNEGIAHLRQYLHLPPEIVPVS 69

Query: 329 LKRSVR----TETVRRGPVGR--------------PDAPARSAEDRSAYRRTP---AAPG 445
           L+R+ R    T   RRGP  +              PD    + E+R AYRR       P 
Sbjct: 70  LQRARRPAPVTAPPRRGPRVQAVQGPLSCPPKGPPPDVAGGAQEERRAYRRKEEEVPEPR 129

Query: 446 VAP 454
           VAP
Sbjct: 130 VAP 132


>UniRef50_Q5CHY3 Cluster: Ribosomal protein S10; n=4;
           Apicomplexa|Rep: Ribosomal protein S10 - Cryptosporidium
           hominis
          Length = 128

 Score =  103 bits (246), Expect = 4e-21
 Identities = 48/90 (53%), Positives = 67/90 (74%)
 Frame = +2

Query: 59  LMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFA 238
           L+ K+N+ AIY YLFKEG +V  K+ + P+H+EL+ IPNLQV+  M+SL S+  V E+F 
Sbjct: 13  LVSKKNQRAIYSYLFKEGAIVVHKNPNDPRHSELD-IPNLQVMLTMRSLLSKEVVTEKFT 71

Query: 239 WRHFYWYLTNEGIEYLRIFLHLPPEIVPAT 328
           W+H Y+ LT+EG+EYLR +L LP  + PAT
Sbjct: 72  WQHNYYLLTDEGVEYLRRYLDLPASVFPAT 101


>UniRef50_Q4Q1X7 Cluster: 40S ribosomal protein S10, putative; n=6;
           Trypanosomatidae|Rep: 40S ribosomal protein S10,
           putative - Leishmania major
          Length = 168

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 48/107 (44%), Positives = 65/107 (60%), Gaps = 5/107 (4%)
 Frame = +2

Query: 62  MPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELE----KIPNLQVIKAMQSLKSRGYVKE 229
           +PK +R  +Y + F EGV+  KKD        L      +P +QV++ M+SLKSR  +KE
Sbjct: 5   VPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTVPCIQVMQLMRSLKSRNLIKE 64

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLK-RSVRTETVRRG 367
           Q+AWRH+YW L +EGI Y+R +LHL P  +P T K  SV  E V  G
Sbjct: 65  QYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSSVNFEKVTEG 111


>UniRef50_Q7ZZT9 Cluster: 40S ribosomal protein S10; n=2;
           Euteleostomi|Rep: 40S ribosomal protein S10 -
           Oreochromis mossambicus (Mozambique tilapia) (Tilapia
           mossambica)
          Length = 88

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 48/86 (55%), Positives = 56/86 (65%), Gaps = 5/86 (5%)
 Frame = +2

Query: 284 LRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPARSAEDRSAYRRTPAAPGVA 451
           LR FLHLPPEIVPATL+R  R ET R  P G    RP    R   DR AYRR+ A PG  
Sbjct: 1   LRDFLHLPPEIVPATLRRQTRPETARPRPKGVEGERPARLNRGEADRDAYRRSAAPPGA- 59

Query: 452 PHDKKADVGPGSA-DLEFKGGYGRGR 526
             DKKA+ G G+A + +F+GG+GRGR
Sbjct: 60  --DKKAEAGAGAATEFQFRGGFGRGR 83


>UniRef50_Q7TP86 Cluster: Ab1-331; n=1; Rattus norvegicus|Rep:
           Ab1-331 - Rattus norvegicus (Rat)
          Length = 151

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 43/60 (71%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query: 44  AAFKMLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRG 217
           AA  MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V KA QSL+SRG
Sbjct: 92  AAVAMLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVTKATQSLESRG 151


>UniRef50_A0CR54 Cluster: Chromosome undetermined scaffold_25, whole
           genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_25,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 159

 Score = 83.0 bits (196), Expect = 4e-15
 Identities = 48/129 (37%), Positives = 76/129 (58%), Gaps = 5/129 (3%)
 Frame = +2

Query: 68  KQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRH 247
           +Q+R  +YEYL  EGV+V KKD   P H E   + NL+V   ++SL+ +  V   F+W++
Sbjct: 30  RQDRRKVYEYLLLEGVIVIKKDMALPLHAETG-VKNLEVWMLLRSLRDKKLVDLVFSWQY 88

Query: 248 FYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR--TETV--RRGPVG-RPDAPARSAEDR 412
           +Y+YL  EG++Y+R  L +  +++PAT K++ +   E V  RRGP G +P     +   R
Sbjct: 89  YYYYLKAEGVKYVRDKLGIVEDVIPATFKKADKKFEEDVPERRGPRGNKPFGRGGNRGPR 148

Query: 413 SAYRRTPAA 439
            A  +T  A
Sbjct: 149 RAEEQTETA 157


>UniRef50_UPI0000498FD7 Cluster: 40S ribosomal protein S10; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S10 - Entamoeba histolytica HM-1:IMSS
          Length = 127

 Score = 78.6 bits (185), Expect = 9e-14
 Identities = 43/98 (43%), Positives = 59/98 (60%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M +  ++ +AIY+ LF +G +V  KD+    H     IPNLQV   M+ L ++  VKE  
Sbjct: 1   MRIATKDIIAIYKQLFNDGCIVCHKDFVC-LHPVFG-IPNLQVFMLMKGLATKKCVKETC 58

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRT 349
            WR  YW L +EGI YLR  L LP + VP+TLK+S+ T
Sbjct: 59  NWRCLYWTLNDEGIAYLRQKLALPEDAVPSTLKQSIHT 96


>UniRef50_Q24F70 Cluster: Plectin/S10 domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Plectin/S10
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 162

 Score = 72.1 bits (169), Expect = 8e-12
 Identities = 36/92 (39%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +2

Query: 68  KQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRH 247
           K  ++ IY+ L ++GV V KKD+    H E   +PNL     ++SLK RG+++E F W  
Sbjct: 6   KATKIRIYKQLLQDGVFVLKKDFEG--HHEETGVPNLHCYILVRSLKDRGFLEEIFNWGF 63

Query: 248 FYWYLTNEGIEYLRIFLHLPPE-IVPATLKRS 340
            Y+YL  EG EYL+  L +  + ++P T K S
Sbjct: 64  TYYYLNKEGCEYLKTKLGISADNVIPKTFKAS 95


>UniRef50_A2FYF5 Cluster: Plectin/S10 domain containing protein;
           n=4; Trichomonas vaginalis G3|Rep: Plectin/S10 domain
           containing protein - Trichomonas vaginalis G3
          Length = 141

 Score = 68.9 bits (161), Expect = 7e-11
 Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M MP   R  I  YLF+ GV+    D  +  H EL+ + N+   +  ++  ++G+  + +
Sbjct: 1   MYMPTAIRRRILRYLFENGVLCVS-DIQSATHEELDCL-NIYPYQIGRAFVTKGFCIKTY 58

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR--TETVRRGPVGR 379
           AW H Y+ LT++GIEYLR +  LP    PATL+ +     ET R  P GR
Sbjct: 59  AWSHAYYTLTDKGIEYLRNYFGLPANAAPATLREAEAKVLETRRDRPQGR 108


>UniRef50_Q98RW8 Cluster: 40S ribosomal protein S10B; n=1;
           Guillardia theta|Rep: 40S ribosomal protein S10B -
           Guillardia theta (Cryptomonas phi)
          Length = 93

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 37/93 (39%), Positives = 57/93 (61%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M++ K+ R  IYE LFKEGV + K +     +   EK   L+++K    L S+G+V E +
Sbjct: 1   MIIEKRYRRKIYEELFKEGVYIVKDERF---NYNCEKFIALKILKG---LLSKGFVNEIY 54

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLK 334
           +W++ Y+ L  EG+EY+R  L+LP  +VP T K
Sbjct: 55  SWKYHYFVLNQEGLEYVRKLLNLPNGVVPNTHK 87


>UniRef50_Q7QZU4 Cluster: GLP_609_26297_25893; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_609_26297_25893 - Giardia lamblia
           ATCC 50803
          Length = 134

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 13/131 (9%)
 Frame = +2

Query: 62  MPKQNRVAIYEYLFKEGVMVAKKDY----HAPKHTELE---KIPN---LQVIKAMQSLKS 211
           +PK    A+Y +L+ E   +A K+Y    + P  T ++   K+ N   L V   MQSL+S
Sbjct: 4   IPKAVYKAVYAHLY-ENASLALKEYWRVGNVPGITYVDENGKLCNPTYLHVNCIMQSLES 62

Query: 212 RGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATL-KRSVRTETVRR--GPVGRP 382
           RG VK+ FAWRH Y+ LT +G +++R  L L  +++P    K S++     +     G+P
Sbjct: 63  RGVVKDTFAWRHHYYLLTEKGEQFIRKELDLTDDVLPTPYSKPSIKPPQYAQCFSSKGKP 122

Query: 383 DAPARSAEDRS 415
           D   +   D +
Sbjct: 123 DRAPQPKPDEA 133


>UniRef50_Q8SS17 Cluster: 40S RIBOSOMAL PROTEIN S10; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S10
           - Encephalitozoon cuniculi
          Length = 96

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 28/78 (35%), Positives = 42/78 (53%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           ML+P  N+  I   L ++  ++ + D     H +LE IPNL +   M+++ S GYV+   
Sbjct: 1   MLVPTANKYKIKRRLLEKKALLLE-DTVLGNHRDLE-IPNLHLKIFMKTMISYGYVQRIH 58

Query: 236 AWRHFYWYLTNEGIEYLR 289
            WRH Y+ LT  G   LR
Sbjct: 59  VWRHSYFLLTPLGESRLR 76


>UniRef50_Q4RUK8 Cluster: Chromosome 8 SCAF14994, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 8 SCAF14994, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 1375

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 22/37 (59%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYH-APKHTELE 163
           MLMP ++  AIYE LF++GVMVAKKD     KH E+E
Sbjct: 5   MLMPLRDLRAIYEVLFRDGVMVAKKDKRPQTKHPEIE 41


>UniRef50_Q3LVY9 Cluster: Ribosomal protein S10; n=1; Bigelowiella
           natans|Rep: Ribosomal protein S10 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 84

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 22/83 (26%), Positives = 43/83 (51%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           ML+ K   + IYE +  +G+++  K+++   +          + K + SL SR ++ E  
Sbjct: 1   MLVSKFKLIKIYEKILNDGIIIIPKNFNRT-YQFCNSFYAFHLKKVLISLHSRKFMNEIL 59

Query: 236 AWRHFYWYLTNEGIEYLRIFLHL 304
              ++YW LT +G  +LR + +L
Sbjct: 60  LGSNYYWTLTKKGERFLRNYFNL 82


>UniRef50_Q178B7 Cluster: Caspase-3; n=2; Aedes aegypti|Rep:
           Caspase-3 - Aedes aegypti (Yellowfever mosquito)
          Length = 391

 Score = 37.1 bits (82), Expect = 0.28
 Identities = 20/57 (35%), Positives = 32/57 (56%)
 Frame = +2

Query: 281 YLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVA 451
           Y  + +++PP+ VP++  +SV T      P   P+  AR A+  +A   TPA+PG A
Sbjct: 115 YTSLEINIPPKYVPSSSWKSVTTT-----PTRSPNIVARDAQSSNARSNTPASPGPA 166


>UniRef50_Q9AVH4 Cluster: Putative senescence-associated protein;
           n=1; Pisum sativum|Rep: Putative senescence-associated
           protein - Pisum sativum (Garden pea)
          Length = 288

 Score = 35.9 bits (79), Expect = 0.64
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = -1

Query: 411 LSSAERAGASGR-PTGPRRTVSVRTERL-SVAGTISGGRCKNILKYSIPSLV 262
           LS + R G  GR P GP   +         VAGTIS GR + +L+ SIPSL+
Sbjct: 103 LSPSNRGGPLGRSPGGPPNGLPAGLACFFKVAGTISDGRLRYVLRNSIPSLL 154


>UniRef50_A6E866 Cluster: Putative uncharacterized protein; n=1;
           Pedobacter sp. BAL39|Rep: Putative uncharacterized
           protein - Pedobacter sp. BAL39
          Length = 295

 Score = 35.5 bits (78), Expect = 0.85
 Identities = 24/84 (28%), Positives = 43/84 (51%)
 Frame = +2

Query: 62  MPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAW 241
           +P++ R+ I+     E V+V K   H P++   E IP  Q  K   ++  + + K   + 
Sbjct: 113 LPERGRIGIHNRSHYENVLVCK--VH-PEYILKENIPGYQDTK---NIDDQFWAKRYESI 166

Query: 242 RHFYWYLTNEGIEYLRIFLHLPPE 313
           R+F  +L + G   ++IFLH+  E
Sbjct: 167 RNFEQHLADNGTVLVKIFLHVSKE 190


>UniRef50_Q5YQF6 Cluster: Putative uncharacterized protein; n=1;
           Nocardia farcinica|Rep: Putative uncharacterized protein
           - Nocardia farcinica
          Length = 284

 Score = 35.1 bits (77), Expect = 1.1
 Identities = 22/51 (43%), Positives = 27/51 (52%)
 Frame = +2

Query: 308 PEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHD 460
           PE+ P TL+R V  +   R  V RP    R+ EDR+A RR     G  PHD
Sbjct: 147 PELSP-TLRRFVAADPRLRRTVARPGDSRRAIEDRAA-RRVYRPAGPEPHD 195


>UniRef50_UPI00001CD590 Cluster: PREDICTED: similar to Mortality
           factor 4-like protein 2 (MORF-related gene X protein)
           (Transcription factor-like protein MRGX) (MSL3-2
           protein); n=9; Euarchontoglires|Rep: PREDICTED: similar
           to Mortality factor 4-like protein 2 (MORF-related gene
           X protein) (Transcription factor-like protein MRGX)
           (MSL3-2 protein) - Rattus norvegicus
          Length = 2298

 Score = 34.7 bits (76), Expect = 1.5
 Identities = 25/75 (33%), Positives = 35/75 (46%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 484
           P + VPA   RS++  +  R P G  D PARS  ++S     P   G +    ++  G  
Sbjct: 508 PNKRVPAEEDRSLKNISASRRPSGGKDRPARSRSNKSG----PTKEGWSVEGSRSTSGRP 563

Query: 485 SADLEFKGGYGRGRP 529
           S   +  G  GRGRP
Sbjct: 564 SEGKDRSG--GRGRP 576


>UniRef50_Q6Y201 Cluster: 40S ribosomal protein S10; n=1; Pagrus
           major|Rep: 40S ribosomal protein S10 - Pagrus major (Red
           sea bream) (Chrysophrys major)
          Length = 60

 Score = 34.7 bits (76), Expect = 1.5
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 1/24 (4%)
 Frame = +2

Query: 458 DKKADVGPGSA-DLEFKGGYGRGR 526
           DKKA+ G G+A + +F+GG+GRGR
Sbjct: 32  DKKAEAGAGAATEFQFRGGFGRGR 55


>UniRef50_Q6UDF2 Cluster: Regulatory protein; n=1; Psittacid
            herpesvirus 1|Rep: Regulatory protein - Psittacid
            herpesvirus 1
          Length = 2033

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 25/72 (34%), Positives = 29/72 (40%), Gaps = 3/72 (4%)
 Frame = +2

Query: 323  ATLKRSVRTETVRRGPVGRPDAPARSAEDRSA---YRRTPAAPGVAPHDKKADVGPGSAD 493
            AT   S      RR PV R  +  R   DR +   +R  P     A H       PG A 
Sbjct: 1839 ATPSLSPSPSPPRRAPVDRSRSGRRRERDRPSANPFRWAPRQRSRADHSPDG-TAPGDAP 1897

Query: 494  LEFKGGYGRGRP 529
            L  + G GRGRP
Sbjct: 1898 LNLEDGPGRGRP 1909


>UniRef50_A4WRE5 Cluster: Putative uncharacterized protein; n=3;
           Rhodobacter sphaeroides|Rep: Putative uncharacterized
           protein - Rhodobacter sphaeroides ATCC 17025
          Length = 968

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 4/66 (6%)
 Frame = +2

Query: 296 LHLPPEIVPATLKRSVRT-ETVRRGPVGRPDAPARSAEDRSAYRRTPA---APGVAPHDK 463
           +H  P     +  + VRT E V R P GR   P RS   ++    +PA   APG+A    
Sbjct: 397 IHTRPAARVTSEPKPVRTAEPVLRAPGGRSALPPRSPAPQTGRAASPAAATAPGLAAARP 456

Query: 464 KADVGP 481
           KA  GP
Sbjct: 457 KAQTGP 462


>UniRef50_Q7SF15 Cluster: Putative uncharacterized protein
           NCU07438.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU07438.1 - Neurospora crassa
          Length = 636

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPA-RSAEDRSAYRRTPAAP 442
           PP   P ++  S+   T RRGPV  P  PA RS +  +   + PA P
Sbjct: 275 PPAAAPRSVSESITPSTSRRGPVPPPPPPARRSGKLDTENHQEPAPP 321


>UniRef50_UPI0000DD7D1C Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 293

 Score = 33.9 bits (74), Expect = 2.6
 Identities = 23/56 (41%), Positives = 27/56 (48%), Gaps = 2/56 (3%)
 Frame = +2

Query: 308 PEIVPATLKRSVRTETV--RRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKA 469
           P   PA L R+ R   +   RGP GR  APA SAE      R P  PG  P  K++
Sbjct: 40  PRPPPARLPRNGRRGPLWKGRGPAGR--APAASAETALPRPREPPEPGAGPSPKRS 93


>UniRef50_Q1WMR1 Cluster: Quinidine resistance protein-like protein;
           n=1; Coprinellus disseminatus|Rep: Quinidine resistance
           protein-like protein - Coprinellus disseminatus
          Length = 552

 Score = 33.9 bits (74), Expect = 2.6
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 10/80 (12%)
 Frame = +2

Query: 215 GYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPE----------IVPATLKRSVRTETVRR 364
           G + +   WR  +W+LT      L + L L PE          I P    R   +   ++
Sbjct: 205 GAISDALGWRALFWFLTIASAVCLLVMLLLQPETLRSIVGNGSIAPPKYNRPWLSVIPKQ 264

Query: 365 GPVGRPDAPARSAEDRSAYR 424
            P  RPD+ A++A   + +R
Sbjct: 265 KPTKRPDSDAKNASPGNPFR 284


>UniRef50_UPI000155BEFB Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 274

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 20/50 (40%), Positives = 23/50 (46%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAP 454
           PP   P  L R  R  T RRGP GR  A +R+   +   RR P  P   P
Sbjct: 131 PPR--PRGLPRRPRLLTERRGPTGRGSAGSRAGSWQDTPRRAPPPPHPPP 178


>UniRef50_Q1DF67 Cluster: Putative uncharacterized protein; n=1;
           Myxococcus xanthus DK 1622|Rep: Putative uncharacterized
           protein - Myxococcus xanthus (strain DK 1622)
          Length = 90

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +2

Query: 296 LHLPPEIVPATLKRSVRTETVRRGPVGRPDA 388
           LH+PPE +P    R+  TE   R P G P A
Sbjct: 25  LHIPPEAIPTAPDRNADTEDEERSPRGSPPA 55


>UniRef50_Q22S36 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 880

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = +2

Query: 68  KQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRH 247
           K +R+ +  YL +  V + KKD  A    + E I  + VIK+M SL       E      
Sbjct: 491 KMSRINLKTYLRQNYVKMLKKDLSALPTAQKENISLVWVIKSMNSL------GEAIERGD 544

Query: 248 FYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR 346
           F  Y+ ++ IE+L+    +  E+    LK S+R
Sbjct: 545 FPQYIDSQAIEFLQEAAQIEQEV--EDLKSSIR 575


>UniRef50_A6NN13 Cluster: Uncharacterized protein ENSP00000365490;
           n=8; Mammalia|Rep: Uncharacterized protein
           ENSP00000365490 - Homo sapiens (Human)
          Length = 1059

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 3/72 (4%)
 Frame = +2

Query: 299 HLPPEIVPA---TLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKA 469
           HLPP  +PA   +   +    TV  GP   P APA SA+  +A    PA  GV P     
Sbjct: 290 HLPPLGLPAPAASAATAAAPSTVSSGPPATPVAPAPSADGSAA----PAGVGVPPPATGG 345

Query: 470 DVGPGSADLEFK 505
             GP +  L +K
Sbjct: 346 GDGPFACPLCWK 357


>UniRef50_A6G9B3 Cluster: Putative uncharacterized protein; n=1;
           Plesiocystis pacifica SIR-1|Rep: Putative
           uncharacterized protein - Plesiocystis pacifica SIR-1
          Length = 610

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 24/79 (30%), Positives = 30/79 (37%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 484
           PP   P   + + RT+    GP   P APA    D +A   +P  P  AP     D    
Sbjct: 400 PPASTPPPQRTAARTKVFGAGPGAAPAAPAPINFDDTAPAASP--PAAAPAAMNFDTATA 457

Query: 485 SADLEFKGGYGRGRPAS*F 541
           +A          GRPA  F
Sbjct: 458 TAGPSASASGPIGRPAPMF 476


>UniRef50_A1HG71 Cluster: Transcriptional regulator, AraC family;
           n=3; Proteobacteria|Rep: Transcriptional regulator, AraC
           family - Ralstonia pickettii 12J
          Length = 311

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = -3

Query: 463 FIMRCNTRGSRSTSVCRSVLSRAGWGIRTTNRATAY 356
           F+ RC  RG+R  SVC   L  A  G+    RAT +
Sbjct: 90  FVQRCAARGARVASVCSGSLLLAATGLLNGRRATTH 125


>UniRef50_Q8SQS1 Cluster: UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE;
           n=1; Encephalitozoon cuniculi|Rep:
           UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE -
           Encephalitozoon cuniculi
          Length = 335

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +2

Query: 86  IYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLT 265
           I  ++FK   +   K+ + P+H   +KIP     K ++ +K  G+ KE F +  F +   
Sbjct: 233 ICNHIFKTSFIKKMKNINLPEHKAFKKIPYTISGKLIKPVKPNGFKKETFIFDSFEYTQK 292

Query: 266 N 268
           N
Sbjct: 293 N 293


>UniRef50_Q7SG28 Cluster: Putative uncharacterized protein
           NCU02592.1; n=3; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU02592.1 - Neurospora crassa
          Length = 1029

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 27/63 (42%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +2

Query: 362 RGPVGRPDAPARS-AEDRSAYRRTPA-APGVAPHDKKADVGPGSADLE---FKGGYGRGR 526
           +GP GRP  P R+ A D SA RR P   PG  P       GPG    E   F GG  RG 
Sbjct: 177 QGPGGRPGPPDRAVASDPSANRRPPMNGPGPGP-------GPGPLSPENRGFGGGNFRGP 229

Query: 527 PAS 535
           P +
Sbjct: 230 PGA 232


>UniRef50_UPI0001553276 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 393

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 24/69 (34%), Positives = 31/69 (44%)
 Frame = +2

Query: 320 PATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLE 499
           P  L+R +  E + R P  RP AP R+     A   +P     +P D +    PGS   E
Sbjct: 171 PGHLRRQL-PEELPRTPGARPSAPGRTPNKPEATASSPVGARFSPGDGRF-TWPGSGRQE 228

Query: 500 FKGGYGRGR 526
             GG  RGR
Sbjct: 229 --GGDSRGR 235


>UniRef50_UPI0000EBDD73 Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 255

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 9/75 (12%)
 Frame = +2

Query: 296 LHLPPEIVPATLK-----RSVRT-ETVRRGP---VGRPDAPARSAEDRSAYRRTPAAPGV 448
           LH PP   P T +     R+ R  E  R+G       P APARS ++RSA +R+ A  G 
Sbjct: 116 LHPPPRARPVTERSPPPPRTHRPLEPARQGAGAETRHPAAPARSGQERSAAQRSAAPRGR 175

Query: 449 APHDKKADVGPGSAD 493
           A   ++     GS D
Sbjct: 176 ASRTERELPAGGSGD 190


>UniRef50_Q4IWC1 Cluster: Similar to ABC-type phosphonate transport
           system ATPase component precursor; n=1; Azotobacter
           vinelandii AvOP|Rep: Similar to ABC-type phosphonate
           transport system ATPase component precursor -
           Azotobacter vinelandii AvOP
          Length = 687

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 21/58 (36%), Positives = 26/58 (44%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPAS 535
           RG    P A   +A+ R+A    PA  G  P D + D GP  A      G  RG PA+
Sbjct: 631 RGAAALPGALCGAADGRAA-GAAPAPAGARPRDDRRDRGPAGAQRAVAAG-RRGLPAA 686


>UniRef50_Q3W9H0 Cluster: Inner-membrane translocator:ABC
           transporter precursor; n=1; Frankia sp. EAN1pec|Rep:
           Inner-membrane translocator:ABC transporter precursor -
           Frankia sp. EAN1pec
          Length = 873

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 33/89 (37%), Positives = 42/89 (47%), Gaps = 12/89 (13%)
 Frame = +2

Query: 269 EGIEYLRIFLHLPPEIVPAT--LKRSV-RTETVRRGPVGRP-DAPARS----AEDRSAYR 424
           +G   + + L LP  +VPA   L R+V R   + R P  RP   PA        D +A R
Sbjct: 291 QGTVLIIVLLLLPSGVVPAVARLGRAVFRRAVLPRAPWLRPRPGPASGFADGMADGTADR 350

Query: 425 RT-PAAPGVAPHDKKADVG---PGSADLE 499
            T PAAPG+ P  +  D G    G AD E
Sbjct: 351 ATGPAAPGLVPAARPEDAGGTASGGADAE 379


>UniRef50_O66158 Cluster: ORF E protein; n=1; Streptomyces
           kasugaensis|Rep: ORF E protein - Streptomyces
           kasugaensis
          Length = 265

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +2

Query: 320 PATLKRSVRT--ETVRRGPVGRPDAPARSAEDRSAYRRTPAAP 442
           PATL  +V         GP+ RPD  A S ED  A +RTP  P
Sbjct: 187 PATLPEAVARLPGLPATGPIRRPDMNATSPEDTPAAQRTPLLP 229


>UniRef50_A4RJF5 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 413

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 24/79 (30%), Positives = 30/79 (37%)
 Frame = +2

Query: 320 PATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLE 499
           P T + + R        V  PDAP  +     A +R   A    P D    V P S+   
Sbjct: 22  PTTRRVNDRLTAAVEAAVENPDAPMTTKPGTDAPKRGRKAAAANPDDAVIPVSPPSSGAA 81

Query: 500 FKGGYGRGRPAS*FKQXKN 556
            KG   RGRP +     KN
Sbjct: 82  -KGRVARGRPKAAAAAKKN 99


>UniRef50_A7HDX3 Cluster: Putative uncharacterized protein; n=1;
           Anaeromyxobacter sp. Fw109-5|Rep: Putative
           uncharacterized protein - Anaeromyxobacter sp. Fw109-5
          Length = 182

 Score = 32.3 bits (70), Expect = 7.9
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)
 Frame = +2

Query: 257 YLTNEGIEYL--RIFLHLPPEI-VPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRR 427
           Y+   G E++  R F +L  E  + A L  ++RTE  RRG    P APA    +  A   
Sbjct: 49  YVAQGGAEHIHVRAFENLSTEASLGAELTSALRTELARRGAAAGPGAPAELVGEVRAGAP 108

Query: 428 TPAAP 442
            P++P
Sbjct: 109 GPSSP 113


>UniRef50_A2YFL5 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 348

 Score = 32.3 bits (70), Expect = 7.9
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 392 ARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPAS 535
           AR    RS+ RR+P+  G A    +   G  ++ L++ GG G G  AS
Sbjct: 58  ARGKRSRSSRRRSPSGSGSAATKGRWARGSPASPLDYSGGSGSGSAAS 105


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 533,133,917
Number of Sequences: 1657284
Number of extensions: 10336117
Number of successful extensions: 36893
Number of sequences better than 10.0: 56
Number of HSP's better than 10.0 without gapping: 34784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36805
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37071859483
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -