SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B13
         (639 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26; B...   197   2e-49
UniRef50_A6BM65 Cluster: Cytochrome oxidase subunit I; n=1; Peri...   197   2e-49
UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30; P...   192   6e-48
UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181; ...   162   7e-39
UniRef50_Q58PB7 Cluster: Cytochrome c oxidase subunit I; n=106; ...   160   2e-38
UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861; ...   157   2e-37
UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455; ...   157   3e-37
UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941; ...   154   1e-36
UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498...   152   6e-36
UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126; ...   152   8e-36
UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI...   147   2e-34
UniRef50_Q0H8Y1 Cluster: Probable intron-encoded endonuclease aI...   147   2e-34
UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;...   146   4e-34
UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;...   143   3e-33
UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179; ...   141   1e-32
UniRef50_Q9ZZX1 Cluster: Intron-encoded DNA endonuclease aI5 alp...   134   2e-30
UniRef50_P03878 Cluster: Intron-encoded DNA endonuclease aI4 pre...   134   2e-30
UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa group|...   133   3e-30
UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2 pol...   131   2e-29
UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825; ...   129   6e-29
UniRef50_Q8M352 Cluster: I-SceII DNA endonuclease-like protein; ...   126   4e-28
UniRef50_Q0H8Y0 Cluster: Probable intron-encoded endonuclease aI...   124   2e-27
UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1; Na...   122   7e-27
UniRef50_Q6ED53 Cluster: Cox1-i5 protein; n=2; Candida stellata|...   121   2e-26
UniRef50_Q6ED52 Cluster: Cox1-i4 protein; n=1; Candida stellata|...   121   2e-26
UniRef50_Q6ED51 Cluster: Cox-i3 protein; n=1; Candida stellata|R...   121   2e-26
UniRef50_Q6ED50 Cluster: Cox-i2 protein; n=1; Candida stellata|R...   121   2e-26
UniRef50_Q9B6E6 Cluster: COX1-i5 protein; n=3; Fungi/Metazoa gro...   118   1e-25
UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5; Na...   115   8e-25
UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15; F...   109   6e-23
UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular or...   107   2e-22
UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3; Alphaproteob...   105   1e-21
UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7; Eu...    96   7e-19
UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42; N...    94   3e-18
UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388; ...    91   3e-17
UniRef50_Q59IQ0 Cluster: Cytochrome c oxidase subunit I; n=1; Wa...    87   3e-16
UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9; Co...    84   2e-15
UniRef50_Q3L2S5 Cluster: Cytochrome c oxidase subunit I; n=1; Ae...    81   2e-14
UniRef50_Q8HCX2 Cluster: Cytochrome c oxidase subunit I; n=1; Ap...    77   4e-13
UniRef50_Q0H8X8 Cluster: Probable intron-encoded endonuclease aI...    74   3e-12
UniRef50_A6XEV4 Cluster: Cytochrome c oxidase subunit 1; n=1; Mu...    73   8e-12
UniRef50_Q18JR5 Cluster: Cytochrome-c-like terminal oxidase, sub...    67   3e-10
UniRef50_A7HEB5 Cluster: Cytochrome-c oxidase; n=2; Cystobacteri...    67   4e-10
UniRef50_Q35061 Cluster: CoxI intron4 ORF; n=3; Marchantia polym...    66   5e-10
UniRef50_Q36097 Cluster: Cytochrome c oxidase subunit 1; n=3; Th...    66   7e-10
UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107; ...    66   7e-10
UniRef50_Q9B6E4 Cluster: COX1-i3 protein; n=2; Yarrowia lipolyti...    66   9e-10
UniRef50_O67935 Cluster: Cytochrome c oxidase subunit I; n=1; Aq...    65   1e-09
UniRef50_Q9XKD7 Cluster: Cytochrome c oxidase subunit I; n=1; Di...    64   3e-09
UniRef50_Q34463 Cluster: Cytochrome oxidase subunit I; n=3; Eugl...    64   4e-09
UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1; M...    60   3e-08
UniRef50_A7H8L4 Cluster: Cytochrome c oxidase subunit I type; n=...    60   6e-08
UniRef50_A1XI88 Cluster: Cytochrome c oxidase subunit I; n=1; My...    59   8e-08
UniRef50_Q5K464 Cluster: Putative DNA endonuclease; n=1; Kluyver...    59   1e-07
UniRef50_P34956 Cluster: Quinol oxidase subunit 1 (EC 1.10.3.-) ...    58   2e-07
UniRef50_A6C5X9 Cluster: Cytochrome caa3 oxidase; n=3; Bacteria|...    58   2e-07
UniRef50_Q9YDX6 Cluster: Heme-copper oxidase subunit I+III; n=1;...    56   5e-07
UniRef50_A3ZTG1 Cluster: Cytochrome c oxidase subunit I; n=1; Bl...    55   1e-06
UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517; ...    54   2e-06
UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93; A...    54   2e-06
UniRef50_P33518 Cluster: Cytochrome c oxidase polypeptide 1; n=4...    54   3e-06
UniRef50_Q0I8U1 Cluster: Cytochrome c oxidase subunit I; n=16; B...    54   4e-06
UniRef50_A5UVJ0 Cluster: Cytochrome-c oxidase; n=2; Roseiflexus|...    53   7e-06
UniRef50_Q06473 Cluster: Cytochrome c oxidase subunit 1 (EC 1.9....    53   7e-06
UniRef50_P98005 Cluster: Cytochrome c oxidase polypeptide I+III ...    52   1e-05
UniRef50_Q98P35 Cluster: Cytochrome C oxidase subunit I; n=16; c...    51   2e-05
UniRef50_A1ZL77 Cluster: Alternative Cytochrome c oxidase polype...    50   5e-05
UniRef50_Q7NQZ0 Cluster: Cytochrome o ubiquinol oxidase, subunit...    49   8e-05
UniRef50_A7BSH8 Cluster: Cytochrome c oxidase aa3, subunit 1; n=...    48   2e-04
UniRef50_Q8ZXD1 Cluster: Cytochrome C oxidase subunit I /III; n=...    48   2e-04
UniRef50_Q94WV3 Cluster: Cytochrome oxidase subunit I; n=1; Pach...    47   3e-04
UniRef50_P24010 Cluster: Cytochrome c oxidase subunit 1 (EC 1.9....    47   3e-04
UniRef50_Q9WWR2 Cluster: Ubiquinol oxidase subunit 1 (EC 1.10.3....    47   4e-04
UniRef50_P98000 Cluster: Alternative cytochrome c oxidase subuni...    46   8e-04
UniRef50_A3SJL2 Cluster: QoxA, Quinol oxidase subunit I; n=2; Rh...    45   0.001
UniRef50_Q7YI87 Cluster: Cytochrome oxidase subunit I; n=1; Cela...    45   0.001
UniRef50_Q0AI64 Cluster: Cytochrome-c oxidase; n=3; Proteobacter...    44   0.003
UniRef50_Q05FH1 Cluster: Cytochrome O ubiquinol oxidase subunit ...    44   0.004
UniRef50_A0RZ19 Cluster: Heme/copper-type cytochrome/quinol oxid...    44   0.004
UniRef50_Q9Z605 Cluster: Quinol oxidase subunit I; n=15; Proteob...    43   0.005
UniRef50_A0VUI8 Cluster: Cytochrome-c oxidase; n=1; Dinoroseobac...    43   0.007
UniRef50_A0TRU9 Cluster: Cytochrome-c oxidase; n=30; Proteobacte...    43   0.007
UniRef50_Q1H1C1 Cluster: Cytochrome-c oxidase; n=1; Methylobacil...    42   0.017
UniRef50_Q6KZG3 Cluster: Cytochrome c oxidase polypeptide I/III;...    41   0.029
UniRef50_Q2N1P8 Cluster: Cytochrome c oxidase subunit I; n=2; Eu...    40   0.038
UniRef50_Q5V018 Cluster: Cytochrome c oxidase subunit I; n=3; Ha...    40   0.051
UniRef50_P11947 Cluster: Cytochrome c oxidase subunit 1; n=48; O...    40   0.067
UniRef50_Q67ML1 Cluster: Cytochrome C oxidase subunit I; n=17; B...    39   0.088
UniRef50_A6C0L1 Cluster: Cytochrome c oxidase subunit I; n=1; Pl...    39   0.088
UniRef50_Q1IUK7 Cluster: Cytochrome-c oxidase; n=2; Acidobacteri...    36   0.62 
UniRef50_Q9RR77 Cluster: Cytochrome c oxidase, subunit I; n=2; D...    35   1.4  
UniRef50_Q11EK8 Cluster: Cytochrome c oxidase, subunit I; n=5; P...    33   7.7  
UniRef50_Q8II85 Cluster: Putative uncharacterized protein; n=2; ...    33   7.7  
UniRef50_P39481 Cluster: Quinol oxidase subunit 1/3; n=5; Sulfol...    33   7.7  

>UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Samia
           cynthia ricini (Indian eri silkmoth)
          Length = 510

 Score =  197 bits (481), Expect = 2e-49
 Identities = 108/181 (59%), Positives = 114/181 (62%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PGSLIGD QIYNTIVTAHA                 N LVPL+LGAPD+AFPR+
Sbjct: 35  RAELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRM 94

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              IVENGAGTG TVYPPLSSNIAH G SVDLAIFSLHLAGISS
Sbjct: 95  NNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISS 154

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              SFDQ+PLFV AVGITAF         AGAIT+LLTDRNLNT
Sbjct: 155 ILGAINFITTIINMRMNNLSFDQMPLFVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNT 214

Query: 635 S 637
           S
Sbjct: 215 S 215



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          +YSTNHK IGTLYFIF
Sbjct: 4  LYSTNHKDIGTLYFIF 19


>UniRef50_A6BM65 Cluster: Cytochrome oxidase subunit I; n=1;
           Periclimenes thermohydrophilus|Rep: Cytochrome oxidase
           subunit I - Periclimenes thermohydrophilus
          Length = 217

 Score =  197 bits (481), Expect = 2e-49
 Identities = 109/199 (54%), Positives = 127/199 (63%)
 Frame = -1

Query: 636 DVFKFRSVNNIVIAPAKTGSDNNNKNAVIPTAHTNKGN*SNDILFNRXXXXXXXXXXXXX 457
           +VFKFRSV +IVIAPA TGS++N+K AV  T  TN G  S  I  +R             
Sbjct: 17  EVFKFRSVKSIVIAPASTGSESNSKMAVSNTDQTNSGMRSMVIPADRMLITVVMKFTAPK 76

Query: 456 IDEIPAKCSEKIARSTDLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGGRSQNLIL 277
           I+E PAKC+EKI  STD P CAI   SGG TVHPVP P STI L  + ++EGG +QNL+L
Sbjct: 77  IEETPAKCNEKIPMSTDAPACAIPLASGGYTVHPVPTPLSTIPLNKSKVKEGGSNQNLML 136

Query: 276 FIRGNAISGAPSIRGTNQFPNPPXXXXXXXXXXXXKACAVTIVL*I*XSPINDPGFPNSA 97
           FIRGNA+SGAP++ GTNQFPNPP            KA AVT+ L I   PI  PG PNSA
Sbjct: 137 FIRGNAMSGAPNMSGTNQFPNPPIMIGMTMKKIITKAWAVTMTL-IWSFPIKLPGCPNSA 195

Query: 96  RIKXLKDVPIIPDQIPKNK 40
           RIK L DVP +P   PK K
Sbjct: 196 RIKSLSDVPTMPAHAPKMK 214


>UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30;
           Panarthropoda|Rep: Cytochrome c oxidase subunit I -
           Pagyris cymothoe
          Length = 487

 Score =  192 bits (468), Expect = 6e-48
 Identities = 104/181 (57%), Positives = 112/181 (61%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R ELG PGSLIGD QIYNTIVTAHA                 N L+PL+LGAPD+AFPR+
Sbjct: 11  RTELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMLGAPDMAFPRM 70

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              IVENGAGTG TVYPPLSSNIAH G SVDLAIFSLHLAGISS
Sbjct: 71  NNMSFWLLPPSLILLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISS 130

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              SFDQ+PLF+ AVGITA          AGAIT+LLTDRNLNT
Sbjct: 131 ILGAINFITTIINMRINKMSFDQMPLFIWAVGITALLLLLSLPVLAGAITMLLTDRNLNT 190

Query: 635 S 637
           S
Sbjct: 191 S 191


>UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Piculus
           rubiginosus
          Length = 504

 Score =  162 bits (393), Expect = 7e-39
 Identities = 92/181 (50%), Positives = 104/181 (57%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+GD QIYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 39  RAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 98

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F               VE GAGTG TVYPPL+ N+AH G SVDLAIFSLHLAGISS
Sbjct: 99  NNMSFWLXPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGISS 158

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              S  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 159 ILGAINFITTAINMKPPAISQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 218

Query: 635 S 637
           +
Sbjct: 219 T 219


>UniRef50_Q58PB7 Cluster: Cytochrome c oxidase subunit I; n=106;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Homalopoma maculosa
          Length = 219

 Score =  160 bits (389), Expect = 2e-38
 Identities = 88/181 (48%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R ELG PGS IG+ Q+YN +VTAHA                 N LVPL+LGAPD+AFPR+
Sbjct: 21  RVELGQPGSFIGNDQLYNVVVTAHAFVMIFFLVMPMMIGGFGNWLVPLMLGAPDMAFPRL 80

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F               VE+GAGTG TVYPPLS N AH G SVDLAIFSLHLAG+SS
Sbjct: 81  NNMSFWFLPPSLSLLLMSAAVESGAGTGWTVYPPLSGNTAHAGPSVDLAIFSLHLAGVSS 140

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                                + + LFV +V ITA          AGAIT+LLTDRN NT
Sbjct: 141 ILGAVNFITTVINMRWGAMKIELVSLFVWSVKITAILLLLSLPVLAGAITMLLTDRNFNT 200

Query: 635 S 637
           S
Sbjct: 201 S 201


>UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861;
           root|Rep: Cytochrome c oxidase subunit 1 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 516

 Score =  157 bits (381), Expect = 2e-37
 Identities = 88/181 (48%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAEL  PG+L+GD QIYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F               VE GAGTG TVYPPL+ N+AH G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              S  Q PLFV AV +TA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTTINMKPPTISQYQTPLFVWAVLVTAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218


>UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455;
           cellular organisms|Rep: Cytochrome c oxidase subunit I -
           Pandaka lidwilli
          Length = 507

 Score =  157 bits (380), Expect = 3e-37
 Identities = 88/181 (48%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAEL  PG+L+GD QIYN IVTAHA                 N L+PL++GAPD+AFPR+
Sbjct: 27  RAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRM 86

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F               +E GAGTG TVYPPL+ N+AH G SVDL IFSLHLAGISS
Sbjct: 87  NNMSFWLLPPSFLLLLASSGIEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISS 146

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              S  Q PLFV AV ITA          A  IT+LLTDRNLNT
Sbjct: 147 ILGAINFITTIMNMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNT 206

Query: 635 S 637
           +
Sbjct: 207 T 207


>UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Ophisurus macrorhynchos
          Length = 546

 Score =  154 bits (374), Expect = 1e-36
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAEL  PG+L+GD QIYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPVMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F               VE GAGTG TVYPPL+ N+AH G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V +TA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAITQYQTPLFVWSVLVTAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218


>UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498;
           root|Rep: Cytochrome c oxidase subunit 1 - Homo sapiens
           (Human)
          Length = 513

 Score =  152 bits (369), Expect = 6e-36
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218


>UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Placozoan sp. BZ2423
          Length = 498

 Score =  152 bits (368), Expect = 8e-36
 Identities = 83/181 (45%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL +PGS++GD  +YN IVTAHA                 N  VPL++GAPD+AFPR+
Sbjct: 39  RLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTMIGGFGNWFVPLMIGAPDMAFPRL 98

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NNI F              +VE GAGTG TVYPPL+S  AH G SVD+AIFSLHLAG+SS
Sbjct: 99  NNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAGLSS 158

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  ++PLFV +V ITA          AGAIT+LLTDR  NT
Sbjct: 159 ILGAMNFITTVMNMRTPGMTMSRIPLFVWSVLITAILLLLSLPVLAGAITMLLTDRYFNT 218

Query: 635 S 637
           +
Sbjct: 219 T 219


>UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI8
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI8 (EC
           3.1.-.-)]; n=103; Eukaryota|Rep: Probable intron-encoded
           endonuclease aI8 precursor [Contains: Truncated
           non-functional cytochrome oxidase 1; Intron-encoded
           endonuclease aI8 (EC 3.1.-.-)] - Ustilago maydis (Smut
           fungus)
          Length = 645

 Score =  147 bits (357), Expect = 2e-34
 Identities = 85/183 (46%), Positives = 99/183 (54%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG   L GD Q+YN I+TAHA                 N LVP+++GAPD+AFP
Sbjct: 36  RMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMPAMVGGFGNYLVPVMIGAPDMAFP 95

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NNI F               VE GAGTG TVYPPLS   +H G SVDLAIFSLHL+GI
Sbjct: 96  RLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSGI 155

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  +LPLFV A+ +TA          AGAIT+LLTDRN 
Sbjct: 156 SSMLGAMNFITTVLNMRNPGMTLHKLPLFVWAIFVTAILLLLSLPVLAGAITMLLTDRNF 215

Query: 629 NTS 637
           NTS
Sbjct: 216 NTS 218


>UniRef50_Q0H8Y1 Cluster: Probable intron-encoded endonuclease aI5
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI5 (EC
           3.1.-.-)]; n=2; Ustilago maydis|Rep: Probable
           intron-encoded endonuclease aI5 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI5 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 536

 Score =  147 bits (357), Expect = 2e-34
 Identities = 85/183 (46%), Positives = 99/183 (54%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG   L GD Q+YN I+TAHA                 N LVP+++GAPD+AFP
Sbjct: 36  RMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMPAMVGGFGNYLVPVMIGAPDMAFP 95

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NNI F               VE GAGTG TVYPPLS   +H G SVDLAIFSLHL+GI
Sbjct: 96  RLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSGI 155

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  +LPLFV A+ +TA          AGAIT+LLTDRN 
Sbjct: 156 SSMLGAMNFITTVLNMRNPGMTLHKLPLFVWAIFVTAILLLLSLPVLAGAITMLLTDRNF 215

Query: 629 NTS 637
           NTS
Sbjct: 216 NTS 218


>UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Cotesia
           melitaearum (Parasitoid wasp)
          Length = 499

 Score =  146 bits (354), Expect = 4e-34
 Identities = 81/181 (44%), Positives = 99/181 (54%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R ELG PGSLIG+ QIYN+IVT+HA                 N L+PL+LG+PD++FPR+
Sbjct: 22  RLELGMPGSLIGNDQIYNSIVTSHAFIMIFFMVMPVMIGGFGNWLIPLMLGSPDMSFPRM 81

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F               +  G GTG TVYPPLS  + H G SVDL IFSLHLAG SS
Sbjct: 82  NNMSFWLLIPSLLLLILSMFINVGVGTGWTVYPPLSLILGHGGMSVDLGIFSLHLAGASS 141

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              + D++ LF  +V ITA          AGAIT+LLTDRN+NT
Sbjct: 142 IMGAVNFITTILNMRSNLFNMDKMSLFSWSVFITAILLLLSLPVLAGAITMLLTDRNMNT 201

Query: 635 S 637
           S
Sbjct: 202 S 202


>UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 527

 Score =  143 bits (347), Expect = 3e-33
 Identities = 79/183 (43%), Positives = 100/183 (54%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGSLI--GDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG  I  G+ Q+YN ++TAHA                 N  VP+++GAPD+AFP
Sbjct: 39  RMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGFGNWFVPILIGAPDMAFP 98

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NNI F              +VE G+GTG TVYPPLS   +H G +VDLAIFSLHL+G+
Sbjct: 99  RLNNISFWLLPPSLLLLLSSALVEVGSGTGWTVYPPLSGITSHSGGAVDLAIFSLHLSGV 158

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  +LPLFV +V +TAF         AGAIT+LLTDRN 
Sbjct: 159 SSILGSINFITTIFNMRGPGMTMHRLPLFVWSVLVTAFLLLLSLPVLAGAITMLLTDRNF 218

Query: 629 NTS 637
           NT+
Sbjct: 219 NTT 221



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLYFIF
Sbjct: 8  LFSTNHKDIGTLYFIF 23


>UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Chondrus crispus (Carragheen)
          Length = 532

 Score =  141 bits (342), Expect = 1e-32
 Identities = 79/183 (43%), Positives = 101/183 (55%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  P +  L+G+ QIYN ++TAHA                 N LVP+++G+PD+AFP
Sbjct: 44  RMELAQPSNHLLLGNHQIYNVLITAHAFLMIFFMVMPVMIGGFGNWLVPIMIGSPDMAFP 103

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NNI F              +VE G GTG TVYPPLSS  +H G +VDLAIFSLH++G 
Sbjct: 104 RLNNISFWLLPPSLCLLLMSALVEVGVGTGWTVYPPLSSIQSHSGGAVDLAIFSLHISGA 163

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   S  ++PLFV ++ +TAF         AGAIT+LLTDRN 
Sbjct: 164 SSILGAVNFISTILNMRSPGQSMYRIPLFVWSILVTAFLLLLAVPVLAGAITMLLTDRNF 223

Query: 629 NTS 637
           NTS
Sbjct: 224 NTS 226


>UniRef50_Q9ZZX1 Cluster: Intron-encoded DNA endonuclease aI5 alpha
           precursor (DNA endonuclease I-SceIV) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI5 alpha (EC 3.1.-.-) (Intron-encoded
           endonuclease I- SceIV)]; n=2; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI5 alpha precursor (DNA
           endonuclease I-SceIV) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI5 alpha (EC 3.1.-.-) (Intron-encoded endonuclease I-
           SceIV)] - Saccharomyces cerevisiae (Baker's yeast)
          Length = 630

 Score =  134 bits (323), Expect = 2e-30
 Identities = 79/183 (43%), Positives = 95/183 (51%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PGS  L G+ Q++N +V  HA                 N L+PL++GA D AFP
Sbjct: 37  RLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFP 96

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           RINNI F              +VE+GAGTG TVYPPLSS  AH G SVDLAIF+LHL  I
Sbjct: 97  RINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSI 156

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  +LPLFV ++ ITAF         +  IT+LL DRN 
Sbjct: 157 SSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNF 216

Query: 629 NTS 637
           NTS
Sbjct: 217 NTS 219


>UniRef50_P03878 Cluster: Intron-encoded DNA endonuclease aI4
           precursor (DNA endonuclease I- SceII) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI4 (EC 3.1.-.-) (Intron-encoded
           endonuclease I-SceII)]; n=4; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI4 precursor (DNA
           endonuclease I- SceII) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI4 (EC 3.1.-.-) (Intron-encoded endonuclease I-SceII)]
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 556

 Score =  134 bits (323), Expect = 2e-30
 Identities = 79/183 (43%), Positives = 95/183 (51%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PGS  L G+ Q++N +V  HA                 N L+PL++GA D AFP
Sbjct: 37  RLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFP 96

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           RINNI F              +VE+GAGTG TVYPPLSS  AH G SVDLAIF+LHL  I
Sbjct: 97  RINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSI 156

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  +LPLFV ++ ITAF         +  IT+LL DRN 
Sbjct: 157 SSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNF 216

Query: 629 NTS 637
           NTS
Sbjct: 217 NTS 219


>UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa
           group|Rep: Endonuclease - Saccharomyces servazzii
           (Yeast)
          Length = 675

 Score =  133 bits (322), Expect = 3e-30
 Identities = 78/183 (42%), Positives = 96/183 (52%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PGS  L G+ Q++N +V  HA                 N ++PL++GA D++FP
Sbjct: 37  RMELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLAMPALIGGFGNYMLPLMIGATDMSFP 96

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           RIN+I F              +VE+GAGTG TVYPPLSS  AH G SVDLAIFSLHL  I
Sbjct: 97  RINSIGFWLLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFSLHLTSI 156

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   S  ++PLFV A+ ITAF         +  IT+LL DRN 
Sbjct: 157 SSLLGAINFIVTTLNMRTNGMSMHKMPLFVWAIFITAFLLLLSLPVLSAGITMLLMDRNF 216

Query: 629 NTS 637
           NTS
Sbjct: 217 NTS 219


>UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2
           polyprotein; n=1; Phaeosphaeria nodorum SN15|Rep:
           Cytochrome oxidase subunits 1 and 2 polyprotein -
           Phaeosphaeria nodorum SN15
          Length = 789

 Score =  131 bits (316), Expect = 2e-29
 Identities = 77/182 (42%), Positives = 91/182 (50%), Gaps = 1/182 (0%)
 Frame = +2

Query: 95  RAELGNPG-SLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 271
           R EL  PG   I D Q+YN+I+TAHA                 N L+PL LG PD+ FPR
Sbjct: 38  RLELSGPGVQYIADNQLYNSIITAHAIIMIFFMVMPALIGGFGNFLLPLGLGGPDMGFPR 97

Query: 272 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           +NNI +               +ENG GTG T+YPPLS   +H G SVDLAIF LHL+GIS
Sbjct: 98  LNNISYLLLIPSIVLFLFAGGIENGVGTGWTLYPPLSGIQSHSGPSVDLAIFGLHLSGIS 157

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
           S                      +L LF  AV ITA          AG IT++LTDRN N
Sbjct: 158 SLLGAMNFMTTTFNMRSPGIRLHKLILFAWAVVITAVLLLLSLPVLAGGITMVLTDRNFN 217

Query: 632 TS 637
           TS
Sbjct: 218 TS 219


>UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Paracoccidioides brasiliensis
          Length = 710

 Score =  129 bits (311), Expect = 6e-29
 Identities = 73/182 (40%), Positives = 91/182 (50%), Gaps = 1/182 (0%)
 Frame = +2

Query: 95  RAELGNPG-SLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 271
           R EL  PG   I D Q+YN+I+T+H                  N L+P+++G PD+AFPR
Sbjct: 64  RLELSGPGIQYIEDNQLYNSIITSHGVIMIFFMVMPALIGGFGNFLLPILIGGPDMAFPR 123

Query: 272 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           +NN+ +              I+ENG GTG T+YPPLS   +H    VDL IF LHL+GIS
Sbjct: 124 LNNVSYWLLIPSLFLFVFAAIIENGVGTGWTLYPPLSGIQSHSSMGVDLGIFGLHLSGIS 183

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
           S                      +L LF  AV ITA          A AIT+LLTDRNLN
Sbjct: 184 SLLGAINFIATLLNMRSPGIKLHKLALFGWAVVITAVLLLLSLPVLAAAITMLLTDRNLN 243

Query: 632 TS 637
           TS
Sbjct: 244 TS 245


>UniRef50_Q8M352 Cluster: I-SceII DNA endonuclease-like protein;
           n=1; Saccharomyces castellii|Rep: I-SceII DNA
           endonuclease-like protein - Saccharomyces castellii
           (Yeast)
          Length = 598

 Score =  126 bits (304), Expect = 4e-28
 Identities = 74/183 (40%), Positives = 93/183 (50%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG   L G+ Q++N +V  HA                 N ++PL++GA D AFP
Sbjct: 37  RLELAAPGQQYLHGNNQLFNVLVVGHAILMIFFMVMPALIGGFGNYMLPLMIGATDTAFP 96

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           RINNI F              +VE+GAGTG TVYPPL+S  AH G SVDLAIF+LH+  I
Sbjct: 97  RINNIGFWLLPMGLVCLVTSTLVESGAGTGWTVYPPLASIQAHSGPSVDLAIFALHMTSI 156

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  +LPLFV A+ ITA          +  +T+LL DRN 
Sbjct: 157 SSLLGAINFIVTTLNMRTNGMTMHKLPLFVWAILITAVLLLLTLPVLSAGVTMLLLDRNF 216

Query: 629 NTS 637
           NTS
Sbjct: 217 NTS 219


>UniRef50_Q0H8Y0 Cluster: Probable intron-encoded endonuclease aI4
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI4 (EC
           3.1.-.-)]; n=3; Basidiomycota|Rep: Probable
           intron-encoded endonuclease aI4 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI4 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 530

 Score =  124 bits (298), Expect = 2e-27
 Identities = 73/169 (43%), Positives = 86/169 (50%), Gaps = 2/169 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG   L GD Q+YN I+TAHA                 N LVP+++GAPD+AFP
Sbjct: 36  RMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMPAMVGGFGNYLVPVMIGAPDMAFP 95

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NNI F               VE GAGTG TVYPPLS   +H G SVDLAIFSLHL+GI
Sbjct: 96  RLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSGI 155

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAG 595
           SS                   +  +LPLFV A+ +TA          AG
Sbjct: 156 SSMLGAMNFITTVLNMRNPGMTLHKLPLFVWAIFVTAILLLLSLPVLAG 204


>UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Naegleria gruberi|Rep: Cytochrome c oxidase subunit 1 -
           Naegleria gruberi
          Length = 633

 Score =  122 bits (294), Expect = 7e-27
 Identities = 72/183 (39%), Positives = 84/183 (45%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG   L G+   YN I T H                  N  VP+++GAPD++FP
Sbjct: 40  RLELAFPGDQILFGEYHFYNMITTVHGVLMLFVVVMPILFGGFGNYFVPILIGAPDMSFP 99

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NN  F                E G GTG TVYPPLSS  +H G SVDL IFS HL GI
Sbjct: 100 RLNNFSFWLLPGAILLAVLATYSEGGPGTGWTVYPPLSSLQSHSGASVDLMIFSFHLVGI 159

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
            S                       LPLFV +V +T+F         A AIT+LL DRN 
Sbjct: 160 GSIVAAINFICTIFYYKNEAMFNKDLPLFVWSVAVTSFLVIVAIPVLAAAITLLLFDRNF 219

Query: 629 NTS 637
           NTS
Sbjct: 220 NTS 222


>UniRef50_Q6ED53 Cluster: Cox1-i5 protein; n=2; Candida
           stellata|Rep: Cox1-i5 protein - Candida stellata (Yeast)
          Length = 763

 Score =  121 bits (291), Expect = 2e-26
 Identities = 65/176 (36%), Positives = 91/176 (51%)
 Frame = +2

Query: 110 NPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF 289
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPRINN+ F
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAF 120

Query: 290 XXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXX 469
                         +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G+SS     
Sbjct: 121 VVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAI 180

Query: 470 XXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                          + +LPLFV +V ITA          A  +T+LL DRN NTS
Sbjct: 181 NLMVTIINMRANGMDYSKLPLFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTS 236


>UniRef50_Q6ED52 Cluster: Cox1-i4 protein; n=1; Candida
           stellata|Rep: Cox1-i4 protein - Candida stellata (Yeast)
          Length = 676

 Score =  121 bits (291), Expect = 2e-26
 Identities = 65/176 (36%), Positives = 91/176 (51%)
 Frame = +2

Query: 110 NPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF 289
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPRINN+ F
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAF 120

Query: 290 XXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXX 469
                         +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G+SS     
Sbjct: 121 VVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAI 180

Query: 470 XXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                          + +LPLFV +V ITA          A  +T+LL DRN NTS
Sbjct: 181 NLMVTIINMRANGMDYSKLPLFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTS 236


>UniRef50_Q6ED51 Cluster: Cox-i3 protein; n=1; Candida stellata|Rep:
           Cox-i3 protein - Candida stellata (Yeast)
          Length = 588

 Score =  121 bits (291), Expect = 2e-26
 Identities = 65/176 (36%), Positives = 91/176 (51%)
 Frame = +2

Query: 110 NPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF 289
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPRINN+ F
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAF 120

Query: 290 XXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXX 469
                         +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G+SS     
Sbjct: 121 VVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAI 180

Query: 470 XXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                          + +LPLFV +V ITA          A  +T+LL DRN NTS
Sbjct: 181 NLMVTIINMRANGMDYSKLPLFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTS 236


>UniRef50_Q6ED50 Cluster: Cox-i2 protein; n=1; Candida stellata|Rep:
           Cox-i2 protein - Candida stellata (Yeast)
          Length = 586

 Score =  121 bits (291), Expect = 2e-26
 Identities = 65/176 (36%), Positives = 91/176 (51%)
 Frame = +2

Query: 110 NPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF 289
           NP  L+ + Q++N ++TAHA                 N LVPL +G+ D AFPRINN+ F
Sbjct: 61  NPQILMHNGQLWNVLITAHALFMVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAF 120

Query: 290 XXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXX 469
                         +++ G G+G T+YPPL+S  +H G S+D+AIF+LHL+G+SS     
Sbjct: 121 VVLLPSMLFAVLSCLIDEGPGSGWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAI 180

Query: 470 XXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                          + +LPLFV +V ITA          A  +T+LL DRN NTS
Sbjct: 181 NLMVTIINMRANGMDYSKLPLFVWSVLITAVLIILALPVLAAGLTMLLMDRNFNTS 236


>UniRef50_Q9B6E6 Cluster: COX1-i5 protein; n=3; Fungi/Metazoa
           group|Rep: COX1-i5 protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 608

 Score =  118 bits (284), Expect = 1e-25
 Identities = 71/183 (38%), Positives = 90/183 (49%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL N GS  L G+ Q +N ++TAHA                 N L+PL+LGA D+AF 
Sbjct: 42  RLELANTGSPFLHGNTQAFNVVITAHAILMIFFFVMPALVGGFGNYLMPLMLGASDMAFA 101

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NNI F              +VE GAGTG TVY PL+   +H G +VDLAIFSLHL+G 
Sbjct: 102 RLNNISFWLLVPSLILILTSALVEAGAGTGWTVYFPLAGIQSHSGPAVDLAIFSLHLSGF 161

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                    ++ +PLF  AV  TA          A  +T+ + DRN 
Sbjct: 162 SSLLGAINFITTFINMRTIGMKYENVPLFAWAVLFTAILLLLSLPVLAAGLTMGIFDRNF 221

Query: 629 NTS 637
           NTS
Sbjct: 222 NTS 224


>UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5;
           Naupactini|Rep: Cytochrome c oxidase subunit I -
           Galapaganus collaris
          Length = 406

 Score =  115 bits (277), Expect = 8e-25
 Identities = 67/134 (50%), Positives = 76/134 (56%)
 Frame = +2

Query: 236 LILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVD 415
           L LGAPD  FPR  N+ F               VE GAGTG TV PPLS+NIAH G SVD
Sbjct: 4   LXLGAPDXXFPRXINMSFWFLPPXLSFFLXSSXVEKGAGTGWTVSPPLSANIAHEGSSVD 63

Query: 416 LAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAG 595
           LAIFSLH+AG+ S                   +  ++PLFV AV ITA          AG
Sbjct: 64  LAIFSLHMAGVXSILGAINFISTVLNMRPSGMTPXRMPLFVWAVEITAILLLLSLPVLAG 123

Query: 596 AITILLTDRNLNTS 637
           AIT+LLTDRN+NTS
Sbjct: 124 AITMLLTDRNINTS 137


>UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Trichoderma reesei (Hypocrea jecorina)
          Length = 635

 Score =  109 bits (262), Expect = 6e-23
 Identities = 69/186 (37%), Positives = 88/186 (47%), Gaps = 5/186 (2%)
 Frame = +2

Query: 95  RAELGNPG-SLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 271
           R EL  PG   I + Q+YN+I+TAHA                 N L+PL++G PD+AFPR
Sbjct: 66  RLELSGPGVQFIANNQLYNSIITAHAILMIFFMVMPALIGGFGNFLMPLMIGGPDMAFPR 125

Query: 272 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TV----YPPLSSNIAHRGRSVDLAIFSLHL 439
           +NNI F              I+E G GTG T+    YPPLS   +H G SVDLAIF+LHL
Sbjct: 126 LNNISFWLLPPSLLLLVFSAIIEGGVGTGWTLLKDKYPPLSGLQSHSGPSVDLAIFALHL 185

Query: 440 AGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTD 619
           +G+SS                      +L LF        +            IT++LTD
Sbjct: 186 SGVSSLLGSINFITTVANMRTPGIKLHKLALF-------GWATWSSRSRYFLGITMVLTD 238

Query: 620 RNLNTS 637
           RN NTS
Sbjct: 239 RNFNTS 244


>UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular
           organisms|Rep: Cytochrome-c oxidase - Jannaschia sp.
           (strain CCS1)
          Length = 628

 Score =  107 bits (257), Expect = 2e-22
 Identities = 59/183 (32%), Positives = 89/183 (48%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGSLIG--DXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           +A LG    L G  D  ++N ++T H                  N  +PL++GAPD+AFP
Sbjct: 142 QALLGTMDQLDGNPDGHLWNVLITGHGVLMMFFVVIPALFGGFGNYFMPLMIGAPDMAFP 201

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+NN+ +              +++ GAG G T YPP+S+      R+VD AIF++H++G 
Sbjct: 202 RLNNLSYWMYVAGTCLAFCSVMIDGGAGPGWTFYPPISAQGVETSRAVDFAIFAVHVSGA 261

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           SS                   +  ++PLF  +V +TA+         AGAIT+LLTDRN 
Sbjct: 262 SSILGSINFITTFLNMRAPGMTLHKVPLFAWSVFVTAWLLLLSLPVLAGAITMLLTDRNF 321

Query: 629 NTS 637
            T+
Sbjct: 322 GTT 324


>UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3;
           Alphaproteobacteria|Rep: Cytochrome-c oxidase -
           Sphingomonas sp. SKA58
          Length = 556

 Score =  105 bits (251), Expect = 1e-21
 Identities = 63/170 (37%), Positives = 84/170 (49%), Gaps = 4/170 (2%)
 Frame = +2

Query: 140 IYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXX 319
           ++N ++TAH                  N  VP+++GAPD+AFPR+NNI F          
Sbjct: 93  LWNVLITAHGLIMVFFMVMPAMIGGFGNWFVPIMIGAPDMAFPRMNNISFWLLIPAFALL 152

Query: 320 XXXXIVE----NGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXX 487
                V     NGAGTG TVY PLS++    G +VD+AI SLH+AG SS           
Sbjct: 153 LGSTFVPGGTGNGAGTGWTVYAPLSTS-GSAGPAVDMAILSLHIAGASSILGAINFITTI 211

Query: 488 XXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                   +  ++PLFV +V +TAF         A AIT+LLTDRN  T+
Sbjct: 212 LNMRAPGMTLHKMPLFVWSVLVTAFLLLLALPVLAAAITMLLTDRNFGTT 261


>UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7;
           Eukaryota|Rep: Cytochrome c oxidase subunit 1 -
           Leishmania tarentolae (Sauroleishmania tarentolae)
          Length = 549

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 55/174 (31%), Positives = 74/174 (42%)
 Frame = +2

Query: 116 GSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXX 295
           G L GD Q YN ++T+H                  N  +P++ G PD+ FPR+NN+ F  
Sbjct: 48  GILFGDYQFYNVLITSHGLIMVFAFIMPVMMGGLVNYFIPVMAGFPDMVFPRLNNMSFWM 107

Query: 296 XXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXX 475
                       + E G G G T+YP L     H   + D  +F++HL GISS       
Sbjct: 108 YLAGFGCVVNGFLTEEGMGVGWTLYPTLICIDFHSSLACDFVMFAVHLLGISSILNSINL 167

Query: 476 XXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                       SF    LF+ A  ITA          AG +T++L DRN NTS
Sbjct: 168 LGTLFCCRRKFFSFLSWSLFIWAALITAILLIITLPVLAGGVTLILCDRNFNTS 221


>UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42;
           Nematoda|Rep: Cytochrome c oxidase subunit I -
           Onchocerca volvulus
          Length = 548

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 56/183 (30%), Positives = 78/183 (42%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL +PG     G  Q+YN+++T H                  N ++PL+LGAP++AFP
Sbjct: 47  RFELSSPGGHLFFGSGQVYNSVLTMHGVLMIFFLVMPILIGGFGNWMLPLMLGAPEMAFP 106

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           R+N + F               +  G G+  T YPPLS        S+D  I  LH  GI
Sbjct: 107 RVNALSFWFTFVALLMVYQSFFIGGGPGSSWTFYPPLSVE-GQPELSLDTMILGLHTVGI 165

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
            S                   + DQ+ +FV    +T+F         AG++  LL DRN 
Sbjct: 166 GSLLGAINFMVTTQNMRSTAVTLDQISMFVWTSYLTSFLLVLSVPVLAGSLLFLLLDRNF 225

Query: 629 NTS 637
           NTS
Sbjct: 226 NTS 228


>UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Picoides
           borealis
          Length = 513

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 49/96 (51%), Positives = 57/96 (59%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+GD Q  N IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 39  RAELGQPGTLLGDDQXXNVIVTAHAFVMIFXMXMPIMIGGFGNWLVPLMIGAPDMAFPRM 98

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLS 382
           NN+ F               VE GAGTG TVYPPL+
Sbjct: 99  NNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLA 134


>UniRef50_Q59IQ0 Cluster: Cytochrome c oxidase subunit I; n=1;
           Watasenia scintillans|Rep: Cytochrome c oxidase subunit
           I - Watasenia scintillans (Sparkling enope)
          Length = 217

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 51/120 (42%), Positives = 61/120 (50%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R ELG PGSL+ D Q+YN +VTAH                  N LVPL+LGAPD+AFPR+
Sbjct: 22  RTELGQPGSLLNDDQLYNVVVTAHGFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRM 81

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +   G      +  PL       G SVDLAIF LHLAG+SS
Sbjct: 82  NNMSFGFFPLHWHYYSFFTV--KGGLARDELSTPLYLVTISAGPSVDLAIFPLHLAGVSS 139


>UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Lingula
           unguis
          Length = 573

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 51/182 (28%), Positives = 80/182 (43%), Gaps = 1/182 (0%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL +PG  +    +Y++I+T HA                 N  +PL++   D++ PR+
Sbjct: 40  RIELSHPGEWLQVGYMYHSIMTMHAFMMIFFFVMPTSIGGLGNWFIPLMIKIKDLSMPRL 99

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+                +   G G G T+YPPLS++    G  +DLA+FSLH+AG+SS
Sbjct: 100 NNLSVWLALGSLFLMCMAFLSSGGLGCGWTMYPPLSNSEFMDGLPIDLAVFSLHMAGMSS 159

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQL-PLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
                               F  L P+ +  +  T+          A  +T+LL DR+ +
Sbjct: 160 IAGSINFLVTIFNMRMGALFFMSLNPMLIWTLFGTSILLVTSVPVLAAGLTLLLLDRHFS 219

Query: 632 TS 637
           TS
Sbjct: 220 TS 221


>UniRef50_Q3L2S5 Cluster: Cytochrome c oxidase subunit I; n=1; Aedes
           cretinus|Rep: Cytochrome c oxidase subunit I - Aedes
           cretinus
          Length = 153

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 39/65 (60%), Positives = 45/65 (69%)
 Frame = +2

Query: 236 LILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVD 415
           L+LGAPD+AFPR+NN+ F              +VENGAGTG TVYPPLSS  AH G SVD
Sbjct: 1   LMLGAPDMAFPRMNNMSFWMLPPSLTLLLSSSMVENGAGTGWTVYPPLSSGTAHAGASVD 60

Query: 416 LAIFS 430
           LAI+S
Sbjct: 61  LAIYS 65



 Score = 36.3 bits (80), Expect = 0.62
 Identities = 17/35 (48%), Positives = 19/35 (54%)
 Frame = +1

Query: 535 CMSCRDYSXXXXXXTTCFSWSYYNIINRSKLKYII 639
           CM C +Y        TCFS S+Y IIN  K KY I
Sbjct: 97  CMICCNYCYFITSFFTCFSSSHYYIINWPKSKYFI 131


>UniRef50_Q8HCX2 Cluster: Cytochrome c oxidase subunit I; n=1;
           Aplidium nordmanni|Rep: Cytochrome c oxidase subunit I -
           Aplidium nordmanni
          Length = 227

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 62/181 (34%), Positives = 73/181 (40%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R  L   G +IG  QI    VTA A                   L PL +GAP +A PR+
Sbjct: 28  RXXLSXXGQVIGXGQIXXVGVTAXALVMIFFFVMPTLXGGFGXXLXPLXVGAPXMAXPRL 87

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
            N+ F               +  G G    VYPP SS +AH   +VDL IF LHLAGISS
Sbjct: 88  XNMSFWLLPPSLXXLCLSVFIGXGVGXXWXVYPPXSSGLAHSSGAVDLGIFXLHLAGISS 147

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              ++    LF                  A AIT+L   R  N 
Sbjct: 148 XLGSMNFLVTLGNMKXKGLNYGNFSLFCWXXVXXXXXLILSXPVLAAAITMLXXXRXXNX 207

Query: 635 S 637
           S
Sbjct: 208 S 208


>UniRef50_Q0H8X8 Cluster: Probable intron-encoded endonuclease aI2
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI2 (EC
           3.1.-.-)]; n=2; Ustilago maydis|Rep: Probable
           intron-encoded endonuclease aI2 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI2 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 533

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 44/101 (43%), Positives = 51/101 (50%), Gaps = 2/101 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG   L GD Q+YN I+TAHA                 N LVP+++GAPD+AFP
Sbjct: 36  RMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMPAMVGGFGNYLVPVMIGAPDMAFP 95

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNI 391
           R+NNI F               VE GAGTG TV   LS  I
Sbjct: 96  RLNNISFWLLPPSLILLLASAFVEQGAGTGWTVKCKLSQII 136


>UniRef50_A6XEV4 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Munidopsis verrucosus|Rep: Cytochrome c oxidase subunit
           1 - Munidopsis verrucosus
          Length = 154

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 39/83 (46%), Positives = 48/83 (57%)
 Frame = +2

Query: 374 PLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGI 553
           PL+S+IAH G SVD+AIFSLHLAG+SS                   + D++PLF+ AV I
Sbjct: 72  PLASSIAHAGASVDMAIFSLHLAGVSSILGSVNFMTTVINMRAKGMTLDRVPLFIWAVFI 131

Query: 554 TAFXXXXXXXXXAGAITILLTDR 622
           T           AGAIT+LLTDR
Sbjct: 132 TTVLLLLSLPVLAGAITMLLTDR 154



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 18/42 (42%), Positives = 19/42 (45%)
 Frame = +1

Query: 208 WRIWKLXXXXXXXXXXXXXPTNK*YKILTPTPLPYIINFKKN 333
           W IWKL             P NK YKILT  PL Y    K+N
Sbjct: 28  WWIWKLINSANVSGPWYGFPANKQYKILTSAPLTYTPINKRN 69


>UniRef50_Q18JR5 Cluster: Cytochrome-c-like terminal oxidase,
           subunit I; n=2; Halobacteriaceae|Rep: Cytochrome-c-like
           terminal oxidase, subunit I - Haloquadratum walsbyi
           (strain DSM 16790)
          Length = 634

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 57/189 (30%), Positives = 78/189 (41%), Gaps = 8/189 (4%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL +PG  +     YN+++T+H                  N L+PL++GA D+AFPRI
Sbjct: 120 RIELADPGMTVISNTFYNSLLTSHGITMLFLFATPIIAAFS-NYLIPLLIGADDMAFPRI 178

Query: 275 NNIRFXXX--XXXXXXXXXXXIVE-NGAGTG*TVYPPLS-----SNIAHRGRSVDLAIFS 430
           N I F                I E   A TG T+Y PLS      N A+ G  VDL +  
Sbjct: 179 NAIAFWLLPPAALLIWAGFFPIPEVIPAQTGWTMYTPLSVGEGMGNQANAG--VDLMLLG 236

Query: 431 LHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITIL 610
           LHL+G+S+                   S+  L +F   +   +            AI +L
Sbjct: 237 LHLSGVSATMGSINFIATIFTERGKNVSWANLDIFSWTILTQSGLILFAFPLLGSAIMML 296

Query: 611 LTDRNLNTS 637
           L DRN  TS
Sbjct: 297 LFDRNFGTS 305


>UniRef50_A7HEB5 Cluster: Cytochrome-c oxidase; n=2;
           Cystobacterineae|Rep: Cytochrome-c oxidase -
           Anaeromyxobacter sp. Fw109-5
          Length = 596

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 43/165 (26%), Positives = 63/165 (38%), Gaps = 1/165 (0%)
 Frame = +2

Query: 143 YNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXX 322
           Y  I T H                  N L+PL++GA D+AFPR+N   F           
Sbjct: 86  YQQIFTTHGLVMIFFAVTPVLIGTFGNLLIPLMIGARDMAFPRLNMYSFWTFLLSQLLVL 145

Query: 323 XXXIVENG-AGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXX 499
                  G AG G T Y PLS+N+   G    L + ++ + G+SS               
Sbjct: 146 ASFFAPLGSAGAGWTTYTPLSTNVGMPGMGQTLVVAAIFVTGVSSTMGAVNYITTVIRLR 205

Query: 500 XXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
               ++ +LPL +  + +TA            A  +LL DR+  T
Sbjct: 206 APGMTYMRLPLTIWGLWLTAILNALFVPVLGSAALLLLLDRSFGT 250


>UniRef50_Q35061 Cluster: CoxI intron4 ORF; n=3; Marchantia
           polymorpha|Rep: CoxI intron4 ORF - Marchantia polymorpha
           (Liverwort)
          Length = 434

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 35/93 (37%), Positives = 48/93 (51%), Gaps = 2/93 (2%)
 Frame = +2

Query: 95  RAELGNPGSLI--GDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG+ I  G+ Q+YN ++TAHA                 N  VP+++G+PD+AFP
Sbjct: 40  RMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGFGNWFVPILIGSPDMAFP 99

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 367
           R+NNI F              +VE G G+G TV
Sbjct: 100 RLNNISFWLLPPSLLLLLSSALVEVGCGSGWTV 132


>UniRef50_Q36097 Cluster: Cytochrome c oxidase subunit 1; n=3;
           Theileria|Rep: Cytochrome c oxidase subunit 1 -
           Theileria parva
          Length = 481

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 41/166 (24%), Positives = 67/166 (40%)
 Frame = +2

Query: 137 QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXX 316
           +IYN + T H                  N L P++LG  D+ +PR+N             
Sbjct: 60  EIYNLLFTLHGLIMVFFNIMTGLFGGIGNYLYPVLLGYCDVVYPRVNLYSLLFQPIGFVL 119

Query: 317 XXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXX 496
                 +E G+GTG T+YPPLS+++++ G  +D  IF L  AGI+S              
Sbjct: 120 VVSSIYLEIGSGTGWTLYPPLSTSLSNVG--IDFIIFGLLAAGIASTLSSVNFITTFTSV 177

Query: 497 XXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                  D++     ++ +T+F              ++  DR+ NT
Sbjct: 178 KTIGFVIDRISPAAWSIVLTSFLLLLSLPVVTAVFLMVFLDRHYNT 223


>UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107;
           Alveolata|Rep: Cytochrome c oxidase subunit 1 -
           Plasmodium falciparum
          Length = 476

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 1/166 (0%)
 Frame = +2

Query: 140 IYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXX 319
           +YN I T H                  N  +P++ G+P++A+PRIN+I            
Sbjct: 58  LYNMIFTIHGIIMIFFNIMPGLFGGFGNYFLPILCGSPELAYPRINSISLLLQPIAFVLV 117

Query: 320 XXXXIVENGAGTG*TVYPPLSSNIAHRGR-SVDLAIFSLHLAGISSXXXXXXXXXXXXXX 496
                 E G GTG T+YPPLS+++      +VD+ IF L ++G++S              
Sbjct: 118 ILSTAAEFGGGTGWTLYPPLSTSLMSLSPVAVDVIIFGLLVSGVASIMSSLNFITTVMHL 177

Query: 497 XXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                +   L +   ++ IT+           G + +LL+D + NT
Sbjct: 178 RAKGLTLGILSVSTWSLIITSGMLLLTLPVLTGGVLMLLSDLHFNT 223


>UniRef50_Q9B6E4 Cluster: COX1-i3 protein; n=2; Yarrowia
           lipolytica|Rep: COX1-i3 protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 457

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 40/101 (39%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL N GS  L G+ Q +N ++TAHA                 N L+PL+LGA D+AF 
Sbjct: 42  RLELANTGSPFLHGNTQAFNVVITAHAILMIFFFVMPALVGGFGNYLMPLMLGASDMAFA 101

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNI 391
           R+NNI F              +VE GAGTG TV    SS +
Sbjct: 102 RLNNISFWLLVPSLILILTSALVEAGAGTGWTVKKICSSKM 142


>UniRef50_O67935 Cluster: Cytochrome c oxidase subunit I; n=1;
           Aquifex aeolicus|Rep: Cytochrome c oxidase subunit I -
           Aquifex aeolicus
          Length = 485

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 47/175 (26%), Positives = 68/175 (38%)
 Frame = +2

Query: 113 PGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFX 292
           PG  + D + YN ++T H                  N L+PL++GA D+AFPR+N + + 
Sbjct: 2   PGMQVVDFKTYNYLLTGHGVGMLFWWAIAAHIGGFGNFLLPLMIGAKDVAFPRLNALSWW 61

Query: 293 XXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXX 472
                        I  N   T  T YPP S N  +      L +F +HL G SS      
Sbjct: 62  AFFAANVLFLMTLIPGNHIMTMWTGYPPFSLN--NDAGVTALYVFVMHLLGASSIATAVN 119

Query: 473 XXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                        +F +  LFV  +              AGA+T+L  D+ L T+
Sbjct: 120 FLVTYITMRAPGYTFFKTNLFVHTLIAANVIQLVGVPSLAGAVTMLFLDKYLGTN 174


>UniRef50_Q9XKD7 Cluster: Cytochrome c oxidase subunit I; n=1;
           Dicyema misakiense|Rep: Cytochrome c oxidase subunit I -
           Dicyema misakiense
          Length = 473

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 51/180 (28%), Positives = 73/180 (40%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P  L  D  +YN  VT H                  N L+P     PD+ FPR+
Sbjct: 35  RLQLAFPSILTSD--VYNAFVTLHGLVMVFFAAMPTAIGFFANLLIPYHCNLPDLLFPRM 92

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N + F              ++ + A  G T YPPLSS       SV+ ++FSLHLAGI+S
Sbjct: 93  NALSF-----WLMPFSLSLLLFSMASAGWTFYPPLSS----LSPSVEFSVFSLHLAGIAS 143

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                               +  L LF  ++ + +          A  IT++LTD++L T
Sbjct: 144 LISSCNFLVTMLATRTSL--WYSLSLFCWSIVLVSLLLVLSLPVLAVGITLILTDKHLGT 201


>UniRef50_Q34463 Cluster: Cytochrome oxidase subunit I; n=3; Euglena
           gracilis|Rep: Cytochrome oxidase subunit I - Euglena
           gracilis
          Length = 495

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 2/173 (1%)
 Frame = +2

Query: 125 IGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF-XXXX 301
           + +  IYN  +T H                  N L+P+++G  +++ PR+N I F     
Sbjct: 58  VKEVTIYNNWITIHGLIMLFVFIMPVGIGFYGNYLIPMLIGTSELSMPRMNGISFWMLIV 117

Query: 302 XXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHR-GRSVDLAIFSLHLAGISSXXXXXXXX 478
                     ++     +G T+YPPLS+  A   G ++DL++  +H+ GISS        
Sbjct: 118 GVVIFVISNVLMSKPISSGWTLYPPLSTRDADNIGVNIDLSLLVVHVLGISSTIGSVNYI 177

Query: 479 XXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                      +F  + ++  ++ +T+            AIT LL DRN+N++
Sbjct: 178 TTNKYNRHVGLTFMNINIYNFSIIVTSILLIGSLPILGVAITGLLLDRNINST 230


>UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1;
           Myxococcus xanthus DK 1622|Rep: Cytochrome c oxidase,
           subunit I - Myxococcus xanthus (strain DK 1622)
          Length = 556

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 48/178 (26%), Positives = 68/178 (38%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL  PG  I D   YN   T H                  N ++PL+LGA D+AFPR+
Sbjct: 68  RVELLTPGPTIMDAMTYNRTFTLHGLVMIFLFMIPAIPAVFGNFMLPLMLGAKDVAFPRL 127

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N +                ++  G  TG T Y P S   AH   +V   +F   + G SS
Sbjct: 128 NLLSL-YIYLAGAVLALWGMLNGGLDTGWTFYTPYS---AHTTTTVAPVLFGAFIIGFSS 183

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
                              ++ ++PLFV A+  T+           G + +L+T  NL
Sbjct: 184 IVTGINFIVTCHTMRAPGITWFKMPLFVWAIYATS-CIQVLATPVIGLLLVLVTVENL 240


>UniRef50_A7H8L4 Cluster: Cytochrome c oxidase subunit I type; n=38;
           Bacteria|Rep: Cytochrome c oxidase subunit I type -
           Anaeromyxobacter sp. Fw109-5
          Length = 555

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 44/155 (28%), Positives = 62/155 (40%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL  PG  I D   YN + T H                  N L+P+++GA D+AFP++
Sbjct: 61  RLELLTPGPTIMDAMTYNRMFTLHGVVMIFLFMIPAIPSGFGNFLLPIMIGAKDVAFPKL 120

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N + F              +V+ GA TG T Y P S+    +   V L  F L   G SS
Sbjct: 121 NLLSF-YVYLAGAVVALFGMVQGGADTGWTFYTPYSTTTITKVVPVLLGAFIL---GFSS 176

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITA 559
                               + +LPLFV ++  T+
Sbjct: 177 ILTGLNFIVTTHTMRAPGMGWTRLPLFVWSIYATS 211


>UniRef50_A1XI88 Cluster: Cytochrome c oxidase subunit I; n=1;
           Myrmarachne sp. G FSC-2006|Rep: Cytochrome c oxidase
           subunit I - Myrmarachne sp. G FSC-2006
          Length = 129

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/41 (68%), Positives = 31/41 (75%)
 Frame = +2

Query: 332 IVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           +VE G G G TVYPPL+S + H G SVD AIFSLHLAG SS
Sbjct: 12  MVEMGVGAGWTVYPPLASVVGHGGSSVDFAIFSLHLAGASS 52


>UniRef50_Q5K464 Cluster: Putative DNA endonuclease; n=1;
           Kluyveromyces thermotolerans|Rep: Putative DNA
           endonuclease - Kluyveromyces thermotolerans (Yeast)
          Length = 542

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/93 (36%), Positives = 47/93 (50%), Gaps = 2/93 (2%)
 Frame = +2

Query: 95  RAELGNPGS--LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL  PG+  L G+ Q++N +V  HA                 N L+PL++GA D++F 
Sbjct: 37  RLELAAPGNQYLGGNHQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGASDMSFA 96

Query: 269 RINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 367
           R+NNI F              +VE+GAGTG TV
Sbjct: 97  RLNNISFWLLPPALVCLVTSTLVESGAGTGWTV 129


>UniRef50_P34956 Cluster: Quinol oxidase subunit 1 (EC 1.10.3.-)
           (Quinol oxidase polypeptide I) (Quinol oxidase aa3-600,
           subunit qoxB) (Oxidase aa(3)-600 subunit 1); n=45;
           Bacillales|Rep: Quinol oxidase subunit 1 (EC 1.10.3.-)
           (Quinol oxidase polypeptide I) (Quinol oxidase aa3-600,
           subunit qoxB) (Oxidase aa(3)-600 subunit 1) - Bacillus
           subtilis
          Length = 649

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 43/176 (24%), Positives = 63/176 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RA+L  P +   D   YN I T H                  N +VPL +GA D+AFP +
Sbjct: 79  RAQLALPNNSFLDSNHYNEIFTTHGTIMIIFMAMPFLIGLI-NVVVPLQIGARDVAFPYL 137

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              ++      G T Y PL+SN    G   +  +  L +AGI +
Sbjct: 138 NNLSFWTFFVGAMLFNISFVIGGSPNAGWTSYMPLASNDMSPGPGENYYLLGLQIAGIGT 197

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDR 622
                              +  ++P+F     IT             A+ +L  DR
Sbjct: 198 LMTGINFMVTILKMRTKGMTLMRMPMFTWTTLITMVIIVFAFPVLTVALALLSFDR 253


>UniRef50_A6C5X9 Cluster: Cytochrome caa3 oxidase; n=3;
           Bacteria|Rep: Cytochrome caa3 oxidase - Planctomyces
           maris DSM 8797
          Length = 754

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 44/181 (24%), Positives = 67/181 (37%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P +     +++N + T H                  N  VPL++GA D+AFPR+
Sbjct: 58  RIQLAFPNNTFLSPEMFNQLFTMHGTTMVFLVGMPVLTGFA-NYFVPLMIGARDVAFPRL 116

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N+  F              +  +    G   Y PLSS      + VD  I  L + GI S
Sbjct: 117 NSFGFWMFFFGAALLHFSFLTGSAPNAGWFSYVPLSSKAYSSLQGVDYWIIGLLIMGIGS 176

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              S  ++PLFV  + + A            A+ +LL DR L +
Sbjct: 177 VSGAINIFATIINLRAPGMSLQRVPLFVWMMLMQAILIILALPALNSALAMLLIDRWLGS 236

Query: 635 S 637
           +
Sbjct: 237 A 237


>UniRef50_Q9YDX6 Cluster: Heme-copper oxidase subunit I+III; n=1;
           Aeropyrum pernix|Rep: Heme-copper oxidase subunit I+III
           - Aeropyrum pernix
          Length = 815

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 45/181 (24%), Positives = 67/181 (37%), Gaps = 1/181 (0%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P S       Y   VT H                  N +VPL +GA D+AFPR+
Sbjct: 47  RVQLAIPKSNFLTGDAYYEAVTVHGLIMLLWFASPFAFGLA-NYIVPLQIGARDLAFPRL 105

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGA-GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           N + +                E+GA   G T+Y PL++ I   G  +DLA  ++ L  +S
Sbjct: 106 NALSYWLYLLSGLVLLASFFTESGAPNVGWTLYAPLTARIYTPGIGLDLAALAIFLFSLS 165

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
                                + ++P+F  ++  T                +LL DRNL 
Sbjct: 166 VTLGTINFLVTIAAMRAPGIGWFKMPMFTWSILFTVILMLWAFPPLMVGGALLLLDRNLG 225

Query: 632 T 634
           T
Sbjct: 226 T 226


>UniRef50_A3ZTG1 Cluster: Cytochrome c oxidase subunit I; n=1;
           Blastopirellula marina DSM 3645|Rep: Cytochrome c
           oxidase subunit I - Blastopirellula marina DSM 3645
          Length = 595

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 42/170 (24%), Positives = 66/170 (38%), Gaps = 4/170 (2%)
 Frame = +2

Query: 137 QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXX 316
           + Y  +VT HA                 N L+PL++GA D+AFP +N + +         
Sbjct: 86  EFYTVLVTMHATVMIFLVIIPILAGAFGNFLIPLMIGADDMAFPTLNMLSYWFMWPAFFF 145

Query: 317 XXXXXIVE-NGAGTG*TVYPPLS---SNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXX 484
                  + +GA  G T YPPLS   ++    G +  L +  +   G+SS          
Sbjct: 146 FGGAFFCDGHGAAAGWTSYPPLSDMTTSAPSSGAAQTLWLLGVTTVGVSSMLGSVNYMTT 205

Query: 485 XXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                    +  +LPL + A+ ITA            A  ++L DR + T
Sbjct: 206 IIQMRAPGMTMFRLPLTIWAMFITALLQAFALPVLTAAGFMMLADRLIGT 255


>UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Schistosoma mansoni (Blood fluke)
          Length = 609

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 50/181 (27%), Positives = 68/181 (37%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R  L +P   +    +YN +VT H                  N  +P+ L   D+  PR+
Sbjct: 136 RLNLCDPYYNLVSVDVYNYLVTNHGVAMIFFFLMPILIGGFGNYFLPIFLCLDDLLLPRL 195

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N++                    G G G T+YPPLS      G  VD  +FSLHLAG+SS
Sbjct: 196 NSLSLWLMVPSIFYMELSLYY--GCGIGWTLYPPLSI-WEGSGFGVDYLMFSLHLAGVSS 252

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              SF+   + V A   T+          A  IT+LL DRN  T
Sbjct: 253 ----LIGSVNFISTIFSRLSFN-CSIIVWAYLFTSVLLLLSLPVLASGITMLLFDRNFGT 307

Query: 635 S 637
           +
Sbjct: 308 A 308


>UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93;
           Actinobacteria (class)|Rep: Cytochrome c oxidase subunit
           1 - Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 584

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 44/179 (24%), Positives = 64/179 (35%), Gaps = 1/179 (0%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAEL  PG      + +N + T H                  N ++PL +GAPD+AFPR+
Sbjct: 64  RAELFTPGLQFLSNEQFNQLFTMHGTVMLLLYGTPIVWGFA-NYVLPLQIGAPDVAFPRL 122

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGT-G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           N   F              +   GA   G T+Y PLS  I   G   D+ I  +   GI 
Sbjct: 123 NAFGFWITTVGGVAMLTGFLTPGGAADFGWTMYSPLSDAIHSPGLGSDMWIVGVGATGIG 182

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           S                   +  ++P+F   + + +            A   +L DR L
Sbjct: 183 SVASAINMLTTILCLRAPGMTMFRMPIFTWNIFVVSVLALLIFPLLLAAALGVLYDRKL 241


>UniRef50_P33518 Cluster: Cytochrome c oxidase polypeptide 1; n=4;
           Halobacteriaceae|Rep: Cytochrome c oxidase polypeptide 1
           - Halobacterium salinarium (Halobacterium halobium)
          Length = 593

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 43/183 (23%), Positives = 69/183 (37%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL      +    +YN ++T+H                  N  +PL++ A D+AFPRI
Sbjct: 94  RTELATSSETLISPSLYNGLLTSHGITMLFLFGTPMIAAFG-NYFIPLLIDADDMAFPRI 152

Query: 275 NNIRFXXXXXXXXXXXXXXIVEN--GAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGI 448
           N I F              ++     A T  T+Y PLS  ++    +VD+ +  LHL G+
Sbjct: 153 NAIAFWLLPPGAILIWSGFLIPGIATAQTSWTMYTPLSLQMS--SPAVDMMMLGLHLTGV 210

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           S+                    +  L +F   +   +            A+ +LL DRN 
Sbjct: 211 SATMGAINFIATIFTERGEDVGWPDLDIFSWTMLTQSGLILFAFPLFGSALIMLLLDRNF 270

Query: 629 NTS 637
            T+
Sbjct: 271 GTT 273


>UniRef50_Q0I8U1 Cluster: Cytochrome c oxidase subunit I; n=16;
           Bacteria|Rep: Cytochrome c oxidase subunit I -
           Synechococcus sp. (strain CC9311)
          Length = 564

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 46/184 (25%), Positives = 68/184 (36%), Gaps = 3/184 (1%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL  P + + D  +YN + T H                  N L+P ++GAPD+AFP++
Sbjct: 62  RGELITPPADLVDPSVYNGLYTMHGTVMLFLFLFPILNGFN-NLLIPTMIGAPDMAFPKL 120

Query: 275 NNIRFXXXXXXXXXXXXXXIVENG-AGTG*TVYPPLS--SNIAHRGRSVDLAIFSLHLAG 445
           N   F                  G A +G   YPP+S  + + H      L I ++ L+G
Sbjct: 121 NAAAFWLVPVFSIVLMGSFFAPGGPASSGWWSYPPMSLQNPLGHFINGEFLWILAVALSG 180

Query: 446 ISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRN 625
           ISS                    F ++P+FV                  G   +LL D +
Sbjct: 181 ISSIMGAINFVTTIIRMRAPGMGFFRMPVFVWTAWAAQTIQLIGLPALTGGAVMLLFDLS 240

Query: 626 LNTS 637
             TS
Sbjct: 241 FGTS 244


>UniRef50_A5UVJ0 Cluster: Cytochrome-c oxidase; n=2;
           Roseiflexus|Rep: Cytochrome-c oxidase - Roseiflexus sp.
           RS-1
          Length = 641

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 43/180 (23%), Positives = 63/180 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +LG P +      +YN + T H                  N +VPL++GA D+AFPR+
Sbjct: 57  RIQLGVPDNTFLTPDVYNQMFTMHGTTMIFLGLMPLNVGLG-NYMVPLMIGARDMAFPRL 115

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N +                 V      G   Y PL+         VD  I  + L G++S
Sbjct: 116 NALSIWLFIFGGLMLYVSFFVGGAPNVGWFAYAPLTQKQFAPTAGVDYWIVGIGLTGVAS 175

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              + +++PLFV    + AF           A   LL DR+  T
Sbjct: 176 IAGALNFIVTILNMRAPGMTLNRMPLFVWMQLVVAFILIFAFPVLTVATIQLLFDRHFGT 235


>UniRef50_Q06473 Cluster: Cytochrome c oxidase subunit 1 (EC
           1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Oxidase aa(3) subunit 1);
           n=59; Cyanobacteria|Rep: Cytochrome c oxidase subunit 1
           (EC 1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Oxidase aa(3) subunit 1) -
           Synechocystis sp. (strain PCC 6803)
          Length = 551

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 48/181 (26%), Positives = 64/181 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL  P       ++YN ++T H                  N L+PL++G  D+AFPR+
Sbjct: 53  RTELATPSPDFVQPEMYNQLMTLHGTIMIFLWIVPAGAAFA-NYLIPLMVGTEDMAFPRL 111

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N + F               V      G T YPPLS      G   +L I SL L G SS
Sbjct: 112 NAVAFWLTPPGGILLISSFFV-GAPQAGWTSYPPLSLLSGKWGE--ELWILSLLLVGTSS 168

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                                  +PLF  A+  T+          A A+ +L  D    T
Sbjct: 169 ILGAINFVTTILKMRIKDMDLHSMPLFCWAMLATSSLILLSTPVLASALILLSFDLIAGT 228

Query: 635 S 637
           S
Sbjct: 229 S 229


>UniRef50_P98005 Cluster: Cytochrome c oxidase polypeptide I+III (EC
           1.9.3.1) (Cytochrome c aa(3) subunit 1); n=2; Thermus
           thermophilus|Rep: Cytochrome c oxidase polypeptide I+III
           (EC 1.9.3.1) (Cytochrome c aa(3) subunit 1) - Thermus
           thermophilus (strain HB8 / ATCC 27634 / DSM 579)
          Length = 791

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 42/182 (23%), Positives = 64/182 (35%), Gaps = 1/182 (0%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P +     + YN I+T H                  N +VPL+LGA D+A PR+
Sbjct: 50  RTQLAVPNNQFLTGEQYNQILTLHGATMLFFFIIQAGLTGFGNFVVPLMLGARDVALPRV 109

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGA-GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           N   +                  GA   G T Y P S   A     VD  + ++ L G S
Sbjct: 110 NAFSYWAFLGAIVLALMSYFFPGGAPSVGWTFYYPFS---AQSESGVDFYLAAILLLGFS 166

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
           S                   S  ++P++V +V   +            A  ++L +R + 
Sbjct: 167 SLLGNANFVATIYNLRAQGMSLWKMPIYVWSVFAASVLNLFSLAGLTAATLLVLLERKIG 226

Query: 632 TS 637
            S
Sbjct: 227 LS 228


>UniRef50_Q98P35 Cluster: Cytochrome C oxidase subunit I; n=16;
           cellular organisms|Rep: Cytochrome C oxidase subunit I -
           Rhizobium loti (Mesorhizobium loti)
          Length = 623

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 43/180 (23%), Positives = 63/180 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P +       YN I T H                    LVPL++G   IAFPR+
Sbjct: 55  RLQLAQPEARFIGPDRYNQIFTMHGSNMMFLFAVPVMQAMAIY-LVPLMVGTRHIAFPRL 113

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N   +               V+ G   G   Y PLS      G+  D+    +    +S+
Sbjct: 114 NAFSYWMYLAGGLLLWIAFAVDTGPDIGWFAYVPLSGPQYAAGKRADIWAQMITFTEVSA 173

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              S D++PLFV ++ +T+F           A T L+ DR + T
Sbjct: 174 LAIAVEIVVTVFKQRAPGMSLDRIPLFVWSMLVTSFLVILAMPAIMIASTSLILDRLVGT 233


>UniRef50_A1ZL77 Cluster: Alternative Cytochrome c oxidase
           polypeptide I (Cytochrome BB3 subunit 1) (Oxidase BB(3)
           subunit 1); n=20; cellular organisms|Rep: Alternative
           Cytochrome c oxidase polypeptide I (Cytochrome BB3
           subunit 1) (Oxidase BB(3) subunit 1) - Microscilla
           marina ATCC 23134
          Length = 635

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 42/171 (24%), Positives = 65/171 (38%), Gaps = 4/171 (2%)
 Frame = +2

Query: 137 QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXX 316
           + Y  +VT H                  N L+PL +GA D+A   +N + +         
Sbjct: 100 EFYLALVTMHGTIMVFFVLTAGLSGTFSNFLIPLQIGARDMASGFMNMLSYWFFFGSSVI 159

Query: 317 XXXXXIVENGAGTG-*TVYPPLSS---NIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXX 484
                 +E G  +G   +YPPLS+    ++  G  + + + S+ L  IS           
Sbjct: 160 MFASIFLETGPASGSWVIYPPLSALPQAMSGSGAGMTMWLISMALFIISVLLGGINYITT 219

Query: 485 XXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                    SF +LPL + A  ITA            A  +L+ DR+L TS
Sbjct: 220 VINLRVKGMSFTRLPLTIWAFFITAIIGLLSFPVLFSAALLLIFDRSLGTS 270


>UniRef50_Q7NQZ0 Cluster: Cytochrome o ubiquinol oxidase, subunit I;
           n=22; Bacteria|Rep: Cytochrome o ubiquinol oxidase,
           subunit I - Chromobacterium violaceum
          Length = 680

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 40/163 (24%), Positives = 58/163 (35%)
 Frame = +2

Query: 143 YNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXX 322
           Y+ I TAH                  N +VPL +GA D+AFP +N++ F           
Sbjct: 100 YDQIFTAHGVIMIIFMAMPFMTGLM-NIVVPLQIGARDVAFPFLNSLSFWLLVSAVILVN 158

Query: 323 XXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXX 502
               V N A TG   YPPL+         VD  I++L ++GI +                
Sbjct: 159 LSLGVGNFARTGWVAYPPLAELGFSPDVGVDYYIWALQISGIGTTLTAINFLVTVIKMRA 218

Query: 503 XXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
                  +P+F                   GA+ +L  DR L+
Sbjct: 219 PGMKLMDMPIFTWTCTWANVLIATSFPILTGALAMLALDRYLD 261


>UniRef50_A7BSH8 Cluster: Cytochrome c oxidase aa3, subunit 1; n=1;
           Beggiatoa sp. PS|Rep: Cytochrome c oxidase aa3, subunit
           1 - Beggiatoa sp. PS
          Length = 525

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 45/182 (24%), Positives = 67/182 (36%), Gaps = 2/182 (1%)
 Frame = +2

Query: 95  RAELGNPGSLIGDX-QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 271
           R EL   G  I D   +YNT +  H                  N  +PL++GA D+AFPR
Sbjct: 40  RLELSQIGPTITDDPSVYNTWLYFHGAAMILAFQIPALTGFFANYFIPLMIGAKDVAFPR 99

Query: 272 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           +N +                 + +      T YPP S  I H   +     FS+ L G +
Sbjct: 100 VNALSVWLFYAGVLVALTTFFIPDPPDIMWTGYPPYSI-ITHGNTA--FYTFSVLLLGFA 156

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAG-AITILLTDRNL 628
           S                    +++L +FV A  + AF          G A+T+L  D+ +
Sbjct: 157 SILGGVNFLTTVTFMRAPGIGWNKLNIFVWAT-LAAFVLQLIFVPVLGTAVTMLTFDKYI 215

Query: 629 NT 634
            T
Sbjct: 216 GT 217


>UniRef50_Q8ZXD1 Cluster: Cytochrome C oxidase subunit I /III; n=4;
           cellular organisms|Rep: Cytochrome C oxidase subunit I
           /III - Pyrobaculum aerophilum
          Length = 800

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 36/137 (26%), Positives = 56/137 (40%), Gaps = 1/137 (0%)
 Frame = +2

Query: 221 N*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIV-ENGAGTG*TVYPPLSSNIAH 397
           N LVP ++GAPD+ +PRIN + F              +  ++G   G T+YPPLS+    
Sbjct: 86  NILVPKLIGAPDMYWPRINALSFWMQVPATVFMWSSLLFWQHGDSIGWTLYPPLST--IS 143

Query: 398 RGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXX 577
           +   VDL +  + +AG SS                       + LF  +V   +      
Sbjct: 144 KSIGVDLILLGIIIAGFSSTLTGINFILTITRLRRPDIKMLDMSLFAWSVLAASMLMVTA 203

Query: 578 XXXXAGAITILLTDRNL 628
               A    +LL +R+L
Sbjct: 204 LPPLAAGAIMLLLERHL 220


>UniRef50_Q94WV3 Cluster: Cytochrome oxidase subunit I; n=1;
           Pachymerium ferrugineum|Rep: Cytochrome oxidase subunit
           I - Pachymerium ferrugineum
          Length = 219

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 37/140 (26%), Positives = 44/140 (31%)
 Frame = +1

Query: 214 IWKLXXXXXXXXXXXXXPTNK*YKILTPTPLPYIINFKKNCRKWCRNRMNSLPPTFI*YR 393
           I KL             P NK +KIL  TPL Y  N    C K C + +NSLP     Y 
Sbjct: 62  IRKLNTPSNIGSTSHGFPPNKQFKILIITPLTYTTNSIYGCSKRCSHSVNSLPAPCCKYL 121

Query: 394 T*RKIRRSCYFFTTFSXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXCMSCRDYSXXXXX 573
           T    R   +F  T                                 CM   +YS     
Sbjct: 122 TLGPFRSYNHFCPTSCSSVFNSSLNQLYYNNHQYARYSNNPWTNPSVCMKSNNYSCTSTS 181

Query: 574 XTTCFSWSYYNIINRSKLKY 633
            +     S+YNI    K KY
Sbjct: 182 FSPSIGSSHYNITYWPKPKY 201


>UniRef50_P24010 Cluster: Cytochrome c oxidase subunit 1 (EC
           1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Caa-3605 subunit 1) (Oxidase
           aa(3) subunit 1); n=13; Bacillaceae|Rep: Cytochrome c
           oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c oxidase
           polypeptide I) (Cytochrome aa3 subunit 1) (Caa-3605
           subunit 1) (Oxidase aa(3) subunit 1) - Bacillus subtilis
          Length = 622

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 35/181 (19%), Positives = 64/181 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P +     Q YN ++T H                  N +VPL +GA D++FP +
Sbjct: 50  RIQLAKPENAFLSAQAYNEVMTMHGTTMIFLAAMPLLFALM-NAVVPLQIGARDVSFPFL 108

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N + F               +      G T Y  LS  +  +G  +D  +  L ++G+ +
Sbjct: 109 NALGFWLFFFGHIFLNLSWFLGGAPDAGWTSYASLS--LHSKGHGIDFFVLGLQISGLGT 166

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              ++ +LPLF     + +             + +++ DR   T
Sbjct: 167 LIAGINFLATIINMRAPGMTYMRLPLFTWTTFVASALILFAFPPLTVGLALMMLDRLFGT 226

Query: 635 S 637
           +
Sbjct: 227 N 227


>UniRef50_Q9WWR2 Cluster: Ubiquinol oxidase subunit 1 (EC 1.10.3.-)
           (Ubiquinol oxidase polypeptide I) (Cytochrome o subunit
           1) (Oxidase BO(3) subunit 1); n=240; Bacteria|Rep:
           Ubiquinol oxidase subunit 1 (EC 1.10.3.-) (Ubiquinol
           oxidase polypeptide I) (Cytochrome o subunit 1) (Oxidase
           BO(3) subunit 1) - Pseudomonas putida
          Length = 672

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 39/163 (23%), Positives = 56/163 (34%)
 Frame = +2

Query: 143 YNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXX 322
           Y+ I TAH                  N  VPL +GA D+AFP +N++ F           
Sbjct: 99  YDQIFTAHGVIMIIFMAMPFFTGLM-NLAVPLQIGARDVAFPFLNSLSFYLLLAGVLLVN 157

Query: 323 XXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXX 502
               V   A TG   YPPL+      G  VD  I++L L+G+ +                
Sbjct: 158 ISLGVGEFAKTGWVAYPPLAGIQYSPGVGVDYYIWALQLSGLGTTLTGVNFLVTVMKMRA 217

Query: 503 XXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
                  +P+F                    A+ +L  DR L+
Sbjct: 218 PGMKLMDMPIFTWTCTWANVLIVASFPILTAALALLTVDRYLD 260


>UniRef50_P98000 Cluster: Alternative cytochrome c oxidase subunit 1
           (EC 1.9.3.1) (Alternative cytochrome c oxidase
           polypeptide I) (Cytochrome BB3 subunit 1) (Oxidase BB(3)
           subunit 1); n=25; Bacteria|Rep: Alternative cytochrome c
           oxidase subunit 1 (EC 1.9.3.1) (Alternative cytochrome c
           oxidase polypeptide I) (Cytochrome BB3 subunit 1)
           (Oxidase BB(3) subunit 1) - Bradyrhizobium japonicum
          Length = 591

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 46/186 (24%), Positives = 67/186 (36%), Gaps = 5/186 (2%)
 Frame = +2

Query: 95  RAELGNPGSL-IGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 271
           R +LG PG+    D   Y   +T H                  N L+PL++GA D+ FP 
Sbjct: 64  RLQLGFPGTFSFIDANQYLQFITMHGMIMVIYLLTALFLGGFGNYLIPLMVGARDMVFPY 123

Query: 272 INNIRFXXXXXXXXXXXXXXIVENG-AGTG*TVYPP--LSSNIAHRGRSVDLAIFSLHLA 442
           +N + +               V  G  G G T+YPP  + S    +   + L + SL L 
Sbjct: 124 VNMLSYWVYLLAVLVLASAFFVPGGPTGAGWTLYPPQAILSGTPGQDWGIVLMLSSLILF 183

Query: 443 GISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AV-GITAFXXXXXXXXXAGAITILLTD 619
            I                     +  +LPL V  +   T            G++ +LL D
Sbjct: 184 IIGFTMGGLNYVVTVLQARTRGMTLMRLPLTVWGIFTATVMALLAFPALFVGSVMLLL-D 242

Query: 620 RNLNTS 637
           R L TS
Sbjct: 243 RLLGTS 248


>UniRef50_A3SJL2 Cluster: QoxA, Quinol oxidase subunit I; n=2;
           Rhodobacteraceae|Rep: QoxA, Quinol oxidase subunit I -
           Roseovarius nubinhibens ISM
          Length = 818

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 35/155 (22%), Positives = 55/155 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RA+L  P S     + YN + T H                    L+P +LG+ D+AFPR+
Sbjct: 55  RAQLATPRSAFLGPEHYNQVFTMHGTIMMFLFAIPVFEGFAVY-LLPKLLGSRDLAFPRL 113

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
               F              +      +G  +YPPLSS +   G + D  +  +    IS+
Sbjct: 114 TAYGFWCYVFGGSMMIFSLLWGIAPDSGWFMYPPLSSTLGAPGINSDFWLIGITFVEISA 173

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITA 559
                              S  ++P+F     +TA
Sbjct: 174 IAAAVEITVTVLRYRAPGMSLSKMPIFAWYALVTA 208


>UniRef50_Q7YI87 Cluster: Cytochrome oxidase subunit I; n=1;
           Celatoblatta vulgaris|Rep: Cytochrome oxidase subunit I
           - Celatoblatta vulgaris
          Length = 134

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/34 (55%), Positives = 22/34 (64%)
 Frame = +1

Query: 538 MSCRDYSXXXXXXTTCFSWSYYNIINRSKLKYII 639
           M C +YS      +TC  WSYYN IN SKLKYI+
Sbjct: 84  MICSNYSFTIIIVSTCSCWSYYNTINWSKLKYIL 117


>UniRef50_Q0AI64 Cluster: Cytochrome-c oxidase; n=3;
           Proteobacteria|Rep: Cytochrome-c oxidase - Nitrosomonas
           eutropha (strain C71)
          Length = 703

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 26/78 (33%), Positives = 38/78 (48%)
 Frame = +2

Query: 221 N*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHR 400
           N +VPL +GA D+AFP +N+I                +V   +  G   YPP +  + + 
Sbjct: 144 NYVVPLQIGARDVAFPILNSISLWLTAAGAALVMISLVVGAFSTGGWFGYPPYTETLYNP 203

Query: 401 GRSVDLAIFSLHLAGISS 454
           G  VD  I+SL LA + S
Sbjct: 204 GIGVDYWIWSLTLASLGS 221


>UniRef50_Q05FH1 Cluster: Cytochrome O ubiquinol oxidase subunit I;
           n=1; Candidatus Carsonella ruddii PV|Rep: Cytochrome O
           ubiquinol oxidase subunit I - Carsonella ruddii (strain
           PV)
          Length = 606

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/106 (24%), Positives = 44/106 (41%)
 Frame = +2

Query: 221 N*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHR 400
           N ++PL +G+ D+AFP +N + F              I+   A TG   YPPLS      
Sbjct: 119 NIIIPLQIGSKDVAFPSLNLLSFWLTFFSVLLINISLIIGEFAKTGWLGYPPLSEKTFSP 178

Query: 401 GRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 538
              VD   +S+ ++GI +                    F+++ +F+
Sbjct: 179 WVGVDYWNWSIQISGIGTIISSINFITTILKLRKKKLFFNKISIFM 224


>UniRef50_A0RZ19 Cluster: Heme/copper-type cytochrome/quinol
           oxidase, subunit 1; n=2; Thermoprotei|Rep:
           Heme/copper-type cytochrome/quinol oxidase, subunit 1 -
           Cenarchaeum symbiosum
          Length = 508

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 45/177 (25%), Positives = 66/177 (37%), Gaps = 1/177 (0%)
 Frame = +2

Query: 95  RAELGNPGS-LIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 271
           RAEL  PG+  I D   +N + T H                  N  VP+++   D+A+P+
Sbjct: 46  RAELFFPGTQFIADSMTFNRMFTVHGTTLIFLFILPFASAVG-NYFVPIMVRYKDMAYPK 104

Query: 272 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 451
           +N I F                 +   T     PP S  I+  G + D+ IF L + GIS
Sbjct: 105 LNAIAFWMIPPAGALVWLGFADFSWYAT-----PPYSV-ISAPGPAADMWIFGLKILGIS 158

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDR 622
           S                   S  Q+PL   +   ++          A A+ +LLTDR
Sbjct: 159 SILGSINFIVTILKCKHPDMSLGQVPLLAWSYLSSSLIVLVALPTFAAALLMLLTDR 215


>UniRef50_Q9Z605 Cluster: Quinol oxidase subunit I; n=15;
           Proteobacteria|Rep: Quinol oxidase subunit I -
           Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)
          Length = 825

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 30/147 (20%), Positives = 54/147 (36%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RA+L +P S     + Y  + T H                    L+P +LG+ D+A+PR+
Sbjct: 55  RAQLASPRSAFVGAETYAQLFTMHGTIMMFLFAIPMFEGLTIY-LLPKMLGSRDLAYPRL 113

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           +   F              +      +G  +YPPL+S +   G + D  +  +    IS+
Sbjct: 114 SAYGFWCYVLGGSMLIVALLAGIAPDSGWFMYPPLASTLGSPGINSDFWLLGITFVEISA 173

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLF 535
                              S D++P++
Sbjct: 174 IAAAVEIVVTVLRFRAPGMSLDRMPIY 200


>UniRef50_A0VUI8 Cluster: Cytochrome-c oxidase; n=1; Dinoroseobacter
           shibae DFL 12|Rep: Cytochrome-c oxidase -
           Dinoroseobacter shibae DFL 12
          Length = 853

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 33/156 (21%), Positives = 56/156 (35%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P +     + YN + T H                    L+PL++GA D+ FPR+
Sbjct: 81  RLQLMVPENTFLSSETYNQLFTMHGTIMMFLFAIPMLEGFAVY-LIPLMIGARDLVFPRL 139

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
               +              + +     G  +Y PLS++    G S D  +  + LA I+S
Sbjct: 140 GAFGYYCYLFGGIIVLSSFLFDAAPDGGWFMYVPLSTSAYTEGLSADFWLIGITLAEIAS 199

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAF 562
                              S  ++P+ +  +  TAF
Sbjct: 200 VTAAVEIIAAILCSRAPGMSLTKMPILMWYLLATAF 235


>UniRef50_A0TRU9 Cluster: Cytochrome-c oxidase; n=30;
           Proteobacteria|Rep: Cytochrome-c oxidase - Burkholderia
           cenocepacia MC0-3
          Length = 1004

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 39/180 (21%), Positives = 62/180 (34%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P + +     Y+++ T H                  N L PL+LG+ D+AFPR+
Sbjct: 75  RIQLARPNATVLTPAQYDSLFTMHGVTMIFLYALPVLSGFA-NYLWPLMLGSRDMAFPRL 133

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
               +               +      G   Y PL+S     G ++D+    + L GIS+
Sbjct: 134 TAFSYWSFLFAGLFLYASFPLGAVPDGGWFNYVPLTSLDYSAGANIDIYGLGMILLGIST 193

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              S D+LP+ V      +          + A  +L  DRN  T
Sbjct: 194 TGGAANFVVTLLRMRAHGMSIDRLPIIVWGTLTASVSNLVAVPSVSLAFLLLWLDRNAGT 253


>UniRef50_Q1H1C1 Cluster: Cytochrome-c oxidase; n=1; Methylobacillus
           flagellatus KT|Rep: Cytochrome-c oxidase -
           Methylobacillus flagellatus (strain KT / ATCC 51484 /
           DSM 6875)
          Length = 631

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 36/176 (20%), Positives = 60/176 (34%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P +   D + YN + + H                    ++PL+LG  D+ FPR+
Sbjct: 62  RLQLAVPENDFMDPETYNQVFSMHGITMMFLFAIPVMEGFAVY-IIPLMLGTRDMTFPRL 120

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           N   +              ++      G   YPPL+      G  +D     +    IS+
Sbjct: 121 NAFGYYIYLIAGVMMYAALLLRIAPDAGWFSYPPLAGASFSPGLGLDFYTTVVTFMEISA 180

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDR 622
                              S +++P+FV AV + +F           A  +L  DR
Sbjct: 181 LVAAIELIATIFKCKVPGMSLNRMPIFVWAVLVMSFMIVFALPPLVIASLMLALDR 236


>UniRef50_Q6KZG3 Cluster: Cytochrome c oxidase polypeptide I/III;
           n=2; Thermoplasmatales|Rep: Cytochrome c oxidase
           polypeptide I/III - Picrophilus torridus
          Length = 841

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 41/170 (24%), Positives = 57/170 (33%), Gaps = 1/170 (0%)
 Frame = +2

Query: 131 DXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXX 310
           D   YN +VT H                    L+PL +G+ D+ +PR+N + +       
Sbjct: 80  DALQYNQLVTIHGLTMLIWFLGPLGTGFGIY-LIPLAIGSRDMIYPRMNALGYWLFLFSG 138

Query: 311 XXXXXXXIVENG-AGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXX 487
                   +  G   TG TVY PLSS         D A  ++ L GI +           
Sbjct: 139 IMLWSGFFLPGGNLDTGWTVYEPLSSFKFTPYLGADTAAAAVVLRGIGTIIASTEILATI 198

Query: 488 XXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNTS 637
                       LPLFV AV   A           G   +LL    ++ S
Sbjct: 199 FKARAKGYRMMNLPLFVWAVFWVAAISWFVFPEITGLFFLLLVGNLMHAS 248


>UniRef50_Q2N1P8 Cluster: Cytochrome c oxidase subunit I; n=2;
           Eutetramorium sp. BLF m1|Rep: Cytochrome c oxidase
           subunit I - Eutetramorium sp. BLF m1
          Length = 201

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +2

Query: 401 GRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXX 580
           G    L IFSL +   S                    + D++ L   ++ ITA       
Sbjct: 124 GSXXXLXIFSLXIXXXSXIFSAXNFISXIINMRHTMLTMDKISLLSWSILITAVLLLLSL 183

Query: 581 XXXAGAITILLTDRNLNT 634
              AGAIT+LLTDRN+NT
Sbjct: 184 PVLAGAITMLLTDRNMNT 201


>UniRef50_Q5V018 Cluster: Cytochrome c oxidase subunit I; n=3;
           Halobacteriaceae|Rep: Cytochrome c oxidase subunit I -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 854

 Score = 39.9 bits (89), Expect = 0.051
 Identities = 38/183 (20%), Positives = 63/183 (34%), Gaps = 2/183 (1%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R EL + G+ +     YN  V+ H                  N LVPL +GA D+AFPR+
Sbjct: 48  RLELISSGADLLGSMGYNQAVSTHGLLMVFWFISPFAFGFA-NYLVPLQIGADDLAFPRL 106

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLS--SNIAHRGRSVDLAIFSLHLAGI 448
           N + +                      G T+Y PL+  + I   G      + +L +   
Sbjct: 107 NALSYWLYLFSGILMGVSFFQGTTFAGGWTMYAPLNTPAYIPGEGLGATSVVLALIMFTA 166

Query: 449 SSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNL 628
           +                        +P+F  ++ +T +           A+ IL +D  L
Sbjct: 167 AVTLGSVNFLTTMYRMRAEGLRMRDIPIFSLSINLTVWMMLFAFAALLAALMILASDHIL 226

Query: 629 NTS 637
            T+
Sbjct: 227 GTT 229


>UniRef50_P11947 Cluster: Cytochrome c oxidase subunit 1; n=48;
           Oligohymenophorea|Rep: Cytochrome c oxidase subunit 1 -
           Tetrahymena pyriformis
          Length = 698

 Score = 39.5 bits (88), Expect = 0.067
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +2

Query: 95  RAELGNPGSLI--GDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFP 268
           R EL +P S    GD   Y  +VTAH                  N L+P  +G+ D+A+P
Sbjct: 86  RMELAHPESPFFKGDSLRYLQVVTAHGLIMVFFVVVPILFGGFANFLIPYHVGSKDVAYP 145

Query: 269 RINNIRF 289
           R+N+I F
Sbjct: 146 RLNSIGF 152


>UniRef50_Q67ML1 Cluster: Cytochrome C oxidase subunit I; n=17;
           Bacteria|Rep: Cytochrome C oxidase subunit I -
           Symbiobacterium thermophilum
          Length = 628

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 38/180 (21%), Positives = 62/180 (34%), Gaps = 4/180 (2%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  PG  +   + +N + T HA                 N  +PL++GA D+AFPR+
Sbjct: 55  RLQLARPGLEVVTARTFNALFTMHATTMIFLGVMPLLSAFM-NYFLPLMIGARDVAFPRL 113

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAG----TG*TVYPPLSSNIAHRGRSVDLAIFSLHLA 442
           N   +              ++    G     G   Y  L+S     G   D     L L 
Sbjct: 114 NAFSYWIYLFGALFINAGWLMGTAGGHVPDIGWFGYANLTSVQFTSGLGPDFWTLGLLLL 173

Query: 443 GISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDR 622
           GI +                   +  ++P+FV    +T+            A+ +L+ DR
Sbjct: 174 GIGTLVSGFNFIVTILNMRAPGMTLMKMPVFVWTTLVTSAIIIFAFPSVTVALIMLMFDR 233


>UniRef50_A6C0L1 Cluster: Cytochrome c oxidase subunit I; n=1;
           Planctomyces maris DSM 8797|Rep: Cytochrome c oxidase
           subunit I - Planctomyces maris DSM 8797
          Length = 606

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 31/144 (21%), Positives = 50/144 (34%), Gaps = 3/144 (2%)
 Frame = +2

Query: 137 QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXX 316
           + Y  + T HA                 N L+PL++GA D+AFP++N + +         
Sbjct: 90  EFYTMLFTMHATVMIFLVIIPILAGMFGNFLIPLMIGADDMAFPKLNMLSYWFMWPAIAC 149

Query: 317 XXXXXIVENGAGTG*TVYP---PLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXX 487
                    G   G T YP    L+      G +    +  +   G SS           
Sbjct: 150 FGMSFKYAGGPAAGWTSYPVLADLAQAAPGSGTAQTYWLLGVTFVGFSSMMGSINYMTTI 209

Query: 488 XXXXXXXXSFDQLPLFV*AVGITA 559
                   +F +LP+ +  + ITA
Sbjct: 210 INMRAPGMTFFRLPMTIWGLFITA 233


>UniRef50_Q1IUK7 Cluster: Cytochrome-c oxidase; n=2;
           Acidobacteria|Rep: Cytochrome-c oxidase - Acidobacteria
           bacterium (strain Ellin345)
          Length = 595

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 39/182 (21%), Positives = 65/182 (35%), Gaps = 5/182 (2%)
 Frame = +2

Query: 107 GNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIR 286
           G PG ++   + Y +++T H                  N  +P+ +GA D+AFPR N + 
Sbjct: 75  GAPGDVMTP-EYYLSLLTMHGTLMVFFVLTNAPFAAFGNYFLPIQIGAEDMAFPRFNMMS 133

Query: 287 FXXXXXXXXXXXXXXIVENGAG-TG*TVYPPLSS--NIAHRGRSVDLAIFSLHLA--GIS 451
           F               + +G   +G T Y  LS+    A  G +    ++ + +A   I+
Sbjct: 134 FWTTFAAFCVLIAAFFIPDGPPISGWTAYATLSAVGGDAGPGMAYGQTLWGISIAIFCIA 193

Query: 452 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLN 631
           S                   S  ++P+   A  IT+            A  +L  DR   
Sbjct: 194 SLLGSLNFIATTLDLRTKGMSLMRMPICTWAWFITSCIALLAFAVLLPACILLCLDRVAG 253

Query: 632 TS 637
           TS
Sbjct: 254 TS 255


>UniRef50_Q9RR77 Cluster: Cytochrome c oxidase, subunit I; n=2;
           Deinococcus|Rep: Cytochrome c oxidase, subunit I -
           Deinococcus radiodurans
          Length = 820

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 28/117 (23%), Positives = 39/117 (33%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P   +     YN ++T HA                 N  +PL LG  D+A PR+
Sbjct: 58  RVQLALPEQTLLVGTTYNQVLTMHAAIMLFFFLIPLGLFGFGNYFLPLQLGVRDVALPRL 117

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAG 445
           N                          G T Y PL+ +    G SV +    L+  G
Sbjct: 118 NTFAVWLFIASLILVVLGLFNGGAPSVGWTFYYPLTMDGNQTGVSVFMVAVILNGLG 174


>UniRef50_Q11EK8 Cluster: Cytochrome c oxidase, subunit I; n=5;
           Proteobacteria|Rep: Cytochrome c oxidase, subunit I -
           Mesorhizobium sp. (strain BNC1)
          Length = 845

 Score = 32.7 bits (71), Expect = 7.7
 Identities = 31/155 (20%), Positives = 50/155 (32%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           R +L  P + +     YN I T H                    L+P +L A D+ FPR+
Sbjct: 65  RTQLAVPENDLVGQDFYNQIFTVHGTTMMFLFAVPVVEALGVM-LLPQMLAARDLPFPRL 123

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           +                    +     G  +YPPL+      G + D  +  +    IS+
Sbjct: 124 SAFAIWAYIVGGLVFFSTVFYDLAPKGGWFMYPPLTLKEYSPGDNADFWLLGIGFIEISA 183

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITA 559
                              S  ++P+F  A+ I A
Sbjct: 184 IAGAIEIIVGTLRTRPPGMSLTRMPIFAWAMLIFA 218


>UniRef50_Q8II85 Cluster: Putative uncharacterized protein; n=2;
            Plasmodium|Rep: Putative uncharacterized protein -
            Plasmodium falciparum (isolate 3D7)
          Length = 1420

 Score = 32.7 bits (71), Expect = 7.7
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = -1

Query: 621  RSVNNIVIAPAKTGSDNNNKNAVIPTAHTNKGN*SNDILFN 499
            +++NN +I      S NNN N++  T  TN  + +N+I +N
Sbjct: 1038 KTINNNIINDTSQSSYNNNMNSIQNTNRTNSSSSNNNISYN 1078


>UniRef50_P39481 Cluster: Quinol oxidase subunit 1/3; n=5;
           Sulfolobaceae|Rep: Quinol oxidase subunit 1/3 -
           Sulfolobus acidocaldarius
          Length = 788

 Score = 32.7 bits (71), Expect = 7.7
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +2

Query: 221 N*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLS-SNIAH 397
           N LVP ++GA D+ +P+IN + F              ++      G  +Y PLS     +
Sbjct: 80  NYLVPRMIGAHDLYWPKINALSFWMLVPAVILAAISPLL-GAVDLGWYMYAPLSVETTVN 138

Query: 398 RGRSVDLAIFSLHLAGISS 454
            G   +L   +L L+G+SS
Sbjct: 139 YGLGTNLIQIALILSGLSS 157


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 431,094,939
Number of Sequences: 1657284
Number of extensions: 6721168
Number of successful extensions: 15478
Number of sequences better than 10.0: 94
Number of HSP's better than 10.0 without gapping: 14225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15306
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47711253245
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -