SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P61927 Cluster: 60S ribosomal protein L37; n=40; Eutele...   111   5e-24
UniRef50_Q4WWR1 Cluster: 60S ribosomal protein L37; n=4; Pezizom...   104   8e-22
UniRef50_Q8LFH7 Cluster: 60S ribosomal protein L37-1; n=9; Eukar...   100   9e-21
UniRef50_P51402 Cluster: 60S ribosomal protein L37-B; n=29; Fung...    95   5e-19
UniRef50_UPI00005A470B Cluster: PREDICTED: similar to ribosomal ...    94   8e-19
UniRef50_P49622 Cluster: 60S ribosomal protein L37; n=90; Eukary...    91   8e-18
UniRef50_Q4P4Y4 Cluster: Ribosomal protein L37; n=1; Ustilago ma...    87   1e-16
UniRef50_Q22C94 Cluster: Ribosomal protein L37e containing prote...    83   2e-15
UniRef50_Q6MVB5 Cluster: Probable ribosomal protein L37.e.A, cyt...    72   2e-14
UniRef50_Q2KGJ3 Cluster: Ribosomal protein L37; n=1; Magnaporthe...    71   1e-11
UniRef50_Q8SRH5 Cluster: 60S RIBOSOMAL PROTEIN L37; n=2; Fungi/M...    64   1e-09
UniRef50_Q97BU6 Cluster: 50S ribosomal protein L37e; n=4; Archae...    57   1e-07
UniRef50_A5UJK8 Cluster: Ribosomal protein L37e; n=1; Methanobre...    55   6e-07
UniRef50_Q4V3Y2 Cluster: Ribosomal protein L37; n=1; Drosophila ...    54   1e-06
UniRef50_Q9HPS3 Cluster: 50S ribosomal protein L37e; n=10; Eurya...    54   1e-06
UniRef50_Q8U0P5 Cluster: 50S ribosomal protein L37e; n=18; Archa...    52   4e-06
UniRef50_Q6LY46 Cluster: 50S ribosomal protein L37e; n=12; Archa...    47   2e-04
UniRef50_A3H8B0 Cluster: Ribosomal protein L37e; n=1; Caldivirga...    43   0.002
UniRef50_A2YQV5 Cluster: Putative uncharacterized protein; n=1; ...    40   0.018
UniRef50_Q4V414 Cluster: Ribosomal protein L37; n=1; Drosophila ...    40   0.024
UniRef50_UPI00006CFBEB Cluster: Protein kinase domain containing...    32   3.7  
UniRef50_Q38B22 Cluster: Putative uncharacterized protein; n=1; ...    32   3.7  
UniRef50_Q55IZ8 Cluster: Putative uncharacterized protein; n=1; ...    31   6.4  
UniRef50_Q5NNC1 Cluster: Amidophosphoribosyltransferase; n=2; Zy...    31   8.5  

>UniRef50_P61927 Cluster: 60S ribosomal protein L37; n=40;
           Euteleostomi|Rep: 60S ribosomal protein L37 - Homo
           sapiens (Human)
          Length = 97

 Score =  111 bits (267), Expect = 5e-24
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>UniRef50_Q4WWR1 Cluster: 60S ribosomal protein L37; n=4;
           Pezizomycotina|Rep: 60S ribosomal protein L37 -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 158

 Score =  104 bits (249), Expect = 8e-22
 Identities = 44/71 (61%), Positives = 51/71 (71%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HTLCRRCGR S+HIQKS CA CGYP+AK+R Y+WS KA          M HLK V R
Sbjct: 79  NKSHTLCRRCGRRSFHIQKSTCANCGYPSAKVRKYNWSEKAKRRKTTGTGRMSHLKDVHR 138

Query: 248 RFRNGFKEGKP 280
           RF+NGF+ G P
Sbjct: 139 RFKNGFQVGTP 149


>UniRef50_Q8LFH7 Cluster: 60S ribosomal protein L37-1; n=9;
           Eukaryota|Rep: 60S ribosomal protein L37-1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 95

 Score =  100 bits (240), Expect = 9e-21
 Identities = 46/82 (56%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HTLC RCGR S+HIQKS+C+ C YPAA+ R+Y+WSVKA          MR+L+ V R
Sbjct: 13  NKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRNVPR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RF+  F+EG + TP  KA ASS
Sbjct: 73  RFKTCFREGTQATPRNKAAASS 94


>UniRef50_P51402 Cluster: 60S ribosomal protein L37-B; n=29;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L37-B -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 88

 Score = 95.1 bits (226), Expect = 5e-19
 Identities = 38/69 (55%), Positives = 49/69 (71%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK+HTLC RCGR S+H+QK  C+ CGYP+AK RS++W+ KA          MR+LK V R
Sbjct: 13  NKSHTLCNRCGRRSFHVQKKTCSSCGYPSAKTRSHNWAAKAKRRHTTGTGRMRYLKHVSR 72

Query: 248 RFRNGFKEG 274
           RF+NGF+ G
Sbjct: 73  RFKNGFQTG 81


>UniRef50_UPI00005A470B Cluster: PREDICTED: similar to ribosomal
           protein L37; n=3; Eutheria|Rep: PREDICTED: similar to
           ribosomal protein L37 - Canis familiaris
          Length = 124

 Score = 94.3 bits (224), Expect = 8e-19
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NK HTLCRRCG  +YH+QKS C +C YPA   R Y+W  KA          MRHLKIV  
Sbjct: 40  NKMHTLCRRCGSKAYHLQKSTCGKCRYPAKWKRKYNWGAKAKRRNTTGTGRMRHLKIVYH 99

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           R R+GF+ G  P P + AVA+S
Sbjct: 100 RCRHGFRGGTTPKPKRAAVAAS 121


>UniRef50_P49622 Cluster: 60S ribosomal protein L37; n=90;
           Eukaryota|Rep: 60S ribosomal protein L37 -
           Caenorhabditis elegans
          Length = 91

 Score = 91.1 bits (216), Expect = 8e-18
 Identities = 37/72 (51%), Positives = 47/72 (65%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRR 250
           K+HTLC+RCG+SS+HIQK +CA CGY  AK R+Y+W  K+           RHL+ V  R
Sbjct: 14  KSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTGTGRTRHLRDVNAR 73

Query: 251 FRNGFKEGKPTP 286
           FRNGF+   P P
Sbjct: 74  FRNGFRGTTPKP 85


>UniRef50_Q4P4Y4 Cluster: Ribosomal protein L37; n=1; Ustilago
           maydis|Rep: Ribosomal protein L37 - Ustilago maydis
           (Smut fungus)
          Length = 125

 Score = 87.0 bits (206), Expect = 1e-16
 Identities = 37/68 (54%), Positives = 44/68 (64%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRR 250
           KTHT+CRRC   ++H QK  CA CGYPAAK+RSY W  KA          MR+LK V RR
Sbjct: 50  KTHTVCRRCNARAFHRQKKVCASCGYPAAKIRSYEWGQKAKRRKTTGTGRMRYLKNVSRR 109

Query: 251 FRNGFKEG 274
            +NGF+ G
Sbjct: 110 AKNGFQTG 117


>UniRef50_Q22C94 Cluster: Ribosomal protein L37e containing protein;
           n=5; Eukaryota|Rep: Ribosomal protein L37e containing
           protein - Tetrahymena thermophila SB210
          Length = 214

 Score = 83.4 bits (197), Expect = 2e-15
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYH-WSVKAXXXXXXXXXXMRHLKIVRR 247
           KTHTLCRRCG+++YH QK +CA CGYP AK+R Y  W  K           MR++K + R
Sbjct: 60  KTHTLCRRCGKATYHKQKLRCAACGYPDAKMRRYDGWGQKVRDRKGQGTGRMRYMKTIAR 119

Query: 248 RFRNGFKEG 274
           R +NGF+ G
Sbjct: 120 RAKNGFRSG 128


>UniRef50_Q6MVB5 Cluster: Probable ribosomal protein L37.e.A,
           cytosolic; n=1; Neurospora crassa|Rep: Probable
           ribosomal protein L37.e.A, cytosolic - Neurospora crassa
          Length = 124

 Score = 72.1 bits (169), Expect(2) = 2e-14
 Identities = 34/73 (46%), Positives = 41/73 (56%)
 Frame = +2

Query: 89  RRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFK 268
           R   R S H QK  CA CGYPAAK R Y+WS KA          +R+L  V R+F+NGF+
Sbjct: 52  RFTSRRSLHNQKKVCASCGYPAAKTRKYNWSEKAKRRKTTGTGRLRYLSTVSRKFKNGFQ 111

Query: 269 EGKPTPPKKAVAS 307
            G P   K  VA+
Sbjct: 112 TGVPKGSKGPVAA 124



 Score = 27.9 bits (59), Expect(2) = 2e-14
 Identities = 10/11 (90%), Positives = 10/11 (90%)
 Frame = +2

Query: 71  KTHTLCRRCGR 103
           KTH LCRRCGR
Sbjct: 14  KTHGLCRRCGR 24


>UniRef50_Q2KGJ3 Cluster: Ribosomal protein L37; n=1; Magnaporthe
           grisea 70-15|Rep: Ribosomal protein L37 - Magnaporthe
           grisea 70-15
          Length = 188

 Score = 70.5 bits (165), Expect = 1e-11
 Identities = 30/63 (47%), Positives = 37/63 (58%)
 Frame = +2

Query: 92  RCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKE 271
           +  R S H+QK  CA CGYPAAK R Y+WS KA          MR+L  V R+F+N F+ 
Sbjct: 115 KMSRRSLHVQKHTCASCGYPAAKTRKYNWSEKAKRRKTTGTGRMRYLSTVTRKFKNDFQT 174

Query: 272 GKP 280
           G P
Sbjct: 175 GTP 177


>UniRef50_Q8SRH5 Cluster: 60S RIBOSOMAL PROTEIN L37; n=2;
           Fungi/Metazoa group|Rep: 60S RIBOSOMAL PROTEIN L37 -
           Encephalitozoon cuniculi
          Length = 90

 Score = 63.7 bits (148), Expect = 1e-09
 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +2

Query: 68  NKTHT-LCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVR 244
           NK +T +CRRCGR SYH QK+ C+ CGYP  K+R+   S+KA          MR++K   
Sbjct: 12  NKRNTEMCRRCGRQSYHKQKNSCSSCGYPNPKMRN-PGSIKARRRRTIGTGRMRYMKREL 70

Query: 245 RRFRNGFKEGKP 280
           R  +NG K G P
Sbjct: 71  RAAKNGHK-GDP 81


>UniRef50_Q97BU6 Cluster: 50S ribosomal protein L37e; n=4;
           Archaea|Rep: 50S ribosomal protein L37e - Thermoplasma
           volcanium
          Length = 54

 Score = 57.2 bits (132), Expect = 1e-07
 Identities = 18/37 (48%), Positives = 28/37 (75%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWS 181
           KTH  CRRCG  +Y+++  +C+ CG+PA ++RSY W+
Sbjct: 15  KTHITCRRCGHHTYNVRTKRCSHCGFPAPRIRSYKWA 51


>UniRef50_A5UJK8 Cluster: Ribosomal protein L37e; n=1;
           Methanobrevibacter smithii ATCC 35061|Rep: Ribosomal
           protein L37e - Methanobrevibacter smithii (strain PS /
           ATCC 35061 / DSM 861)
          Length = 55

 Score = 54.8 bits (126), Expect = 6e-07
 Identities = 22/40 (55%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGYPAAK-LRSYHWSVK 187
           KTH  CRRCGR++YHI K  CA CG+  +K +R Y W  K
Sbjct: 7   KTHIRCRRCGRNTYHIHKKVCASCGFGKSKRIRRYSWQNK 46


>UniRef50_Q4V3Y2 Cluster: Ribosomal protein L37; n=1; Drosophila
           melanogaster|Rep: Ribosomal protein L37 - Drosophila
           melanogaster (Fruit fly)
          Length = 103

 Score = 54.0 bits (124), Expect = 1e-06
 Identities = 20/24 (83%), Positives = 23/24 (95%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQ 139
           NKTHT+CRRCG SSYH+QKSKC+Q
Sbjct: 13  NKTHTICRRCGNSSYHLQKSKCSQ 36


>UniRef50_Q9HPS3 Cluster: 50S ribosomal protein L37e; n=10;
           Euryarchaeota|Rep: 50S ribosomal protein L37e -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 58

 Score = 53.6 bits (123), Expect = 1e-06
 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +2

Query: 74  THTLCRRCGRSSYHIQKSKCAQCGYPA-AKLRSYHWSVK 187
           THT CRRCG  SYH +K  C+ CG+ A AK R Y W  K
Sbjct: 16  THTKCRRCGEKSYHTKKKVCSSCGFGASAKRRDYEWQGK 54


>UniRef50_Q8U0P5 Cluster: 50S ribosomal protein L37e; n=18;
           Archaea|Rep: 50S ribosomal protein L37e - Pyrococcus
           furiosus
          Length = 62

 Score = 52.0 bits (119), Expect = 4e-06
 Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 1/39 (2%)
 Frame = +2

Query: 74  THTLCRRCGRSSYHIQKSKCAQCGY-PAAKLRSYHWSVK 187
           TH  CRRCGR SY+++K  CA CG+  + +LR Y WS K
Sbjct: 16  THIRCRRCGRVSYNVKKGYCAACGFGRSRRLRKYRWSKK 54


>UniRef50_Q6LY46 Cluster: 50S ribosomal protein L37e; n=12;
           Archaea|Rep: 50S ribosomal protein L37e - Methanococcus
           maripaludis
          Length = 64

 Score = 46.8 bits (106), Expect = 2e-04
 Identities = 16/38 (42%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Frame = +2

Query: 77  HTLCRRCGRSSYHIQKSKCAQCGY-PAAKLRSYHWSVK 187
           H +CRRCGR ++H++K  CA CG+  ++K++ + W  K
Sbjct: 17  HIVCRRCGRRAFHVRKKVCAACGFGRSSKIKRFAWQWK 54


>UniRef50_A3H8B0 Cluster: Ribosomal protein L37e; n=1; Caldivirga
           maquilingensis IC-167|Rep: Ribosomal protein L37e -
           Caldivirga maquilingensis IC-167
          Length = 61

 Score = 43.2 bits (97), Expect = 0.002
 Identities = 17/26 (65%), Positives = 18/26 (69%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCGY 148
           KTH  C RCGR SY+I K  CA CGY
Sbjct: 15  KTHIRCPRCGRHSYNIVKGYCAACGY 40


>UniRef50_A2YQV5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 89

 Score = 39.9 bits (89), Expect = 0.018
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +2

Query: 143 GYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEGKPTPPKKAVA 304
           G+    + S +WSVKA          MR+++ V +RF++ F+EG    P+K  A
Sbjct: 33  GFNFCDVISDNWSVKAIRRKTTGTGRMRYMRHVPKRFKSNFREGTEATPRKRAA 86


>UniRef50_Q4V414 Cluster: Ribosomal protein L37; n=1; Drosophila
           melanogaster|Rep: Ribosomal protein L37 - Drosophila
           melanogaster (Fruit fly)
          Length = 78

 Score = 39.5 bits (88), Expect = 0.024
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYH 115
           NKTHT+CRRCG SSYH
Sbjct: 13  NKTHTICRRCGNSSYH 28


>UniRef50_UPI00006CFBEB Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 949

 Score = 32.3 bits (70), Expect = 3.7
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +3

Query: 45  PQASVSAEIRPIRYAEDVVDRHITFKNQNAPNVDILQQNY 164
           PQ  VS ++RPI     + ++    +NQ   N+D+  QNY
Sbjct: 383 PQTPVSNQVRPINGKIPIQNQQYQAQNQRPSNIDVGPQNY 422


>UniRef50_Q38B22 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 1003

 Score = 32.3 bits (70), Expect = 3.7
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 71  KTHTLCRRCGRSSYHIQKSKCAQCG 145
           +THT CR C R ++  +K +C  CG
Sbjct: 784 RTHTSCRACFRLTFLDEKERCEHCG 808


>UniRef50_Q55IZ8 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 364

 Score = 31.5 bits (68), Expect = 6.4
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +2

Query: 77  HTLCRRCGRSSYHIQKSKCAQCGYPAAK 160
           H+ C  C RSS  +QK KC  C  PA++
Sbjct: 50  HSFCSHCIRSSLDVQK-KCPSCNEPASE 76


>UniRef50_Q5NNC1 Cluster: Amidophosphoribosyltransferase; n=2;
           Zymomonas mobilis|Rep: Amidophosphoribosyltransferase -
           Zymomonas mobilis
          Length = 281

 Score = 31.1 bits (67), Expect = 8.5
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 77  HTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSY 172
           H+ C  C +S + + +  C QCG+P  + + Y
Sbjct: 41  HSFCVECWQSLHFLVEPACIQCGFPLPRDQQY 72


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 328,004,002
Number of Sequences: 1657284
Number of extensions: 5868631
Number of successful extensions: 13892
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 13545
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13890
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 17349842203
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -