SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RJC6 Cluster: Ubiquitin; n=1; Plasmodium yoelii yoeli...   142   9e-33
UniRef50_Q9WR81 Cluster: Polyprotein; n=31; root|Rep: Polyprotei...   141   2e-32
UniRef50_UPI000155314F Cluster: PREDICTED: similar to ubiquitin ...   138   1e-31
UniRef50_UPI00006CFD8F Cluster: Ubiquitin family protein; n=1; T...   136   3e-31
UniRef50_Q9WR79 Cluster: Polyprotein; n=3; Bovine viral diarrhea...   136   6e-31
UniRef50_A2YRX2 Cluster: Putative uncharacterized protein; n=2; ...   136   6e-31
UniRef50_Q0WRN6 Cluster: Polyubiquitin 4 UBQ4; n=6; Eukaryota|Re...   135   8e-31
UniRef50_A0CI21 Cluster: Chromosome undetermined scaffold_187, w...   135   8e-31
UniRef50_A0PDJ3 Cluster: Polyprotein; n=65; root|Rep: Polyprotei...   134   2e-30
UniRef50_Q868B2 Cluster: Polyubiquitin; n=3; Eukaryota|Rep: Poly...   130   2e-29
UniRef50_Q9E2W4 Cluster: Polyprotein; n=1; Bovine viral diarrhea...   129   7e-29
UniRef50_Q7XBP6 Cluster: Ubiquitin/ribosomal protein P1 fusion; ...   128   1e-28
UniRef50_A6SBB4 Cluster: 60S ribosomal protein L40; n=1; Botryot...   125   1e-27
UniRef50_Q91BI7 Cluster: Ubiquitin GP37 fusion protein; n=2; Spo...   122   6e-27
UniRef50_A1TWA7 Cluster: Ubiquitin precursor; n=1; Acidovorax av...   122   8e-27
UniRef50_Q9FWV0 Cluster: Putative ubiquitin/ribosomal protein S2...   122   1e-26
UniRef50_Q6WMU7 Cluster: Ubiquitin-like protein Ublp94.4; n=1; A...   119   7e-26
UniRef50_P16709 Cluster: Ubiquitin-like protein precursor; n=19;...   113   3e-24
UniRef50_Q9YMT1 Cluster: Viral ubiquitin; n=1; Lymantria dispar ...   111   1e-23
UniRef50_Q9SYE9 Cluster: F15I1.1 protein; n=1; Arabidopsis thali...   109   8e-23
UniRef50_Q5D8K9 Cluster: SJCHGC02785 protein; n=1; Schistosoma j...   103   5e-21
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   100   3e-20
UniRef50_UPI0000DA4142 Cluster: PREDICTED: similar to ribosomal ...    99   5e-20
UniRef50_A2YRX0 Cluster: Putative uncharacterized protein; n=1; ...   100   6e-20
UniRef50_UPI00005A2EE8 Cluster: PREDICTED: similar to ubiquitin ...    98   2e-19
UniRef50_Q22T79 Cluster: Ubiquitin family protein; n=1; Tetrahym...    98   2e-19
UniRef50_UPI000155E27A Cluster: PREDICTED: similar to ubiquitin ...    97   2e-19
UniRef50_Q0V3T0 Cluster: Putative uncharacterized protein; n=1; ...    97   3e-19
UniRef50_UPI0000ECA612 Cluster: UPI0000ECA612 related cluster; n...    96   7e-19
UniRef50_Q9SYF2 Cluster: F15I1.4 protein; n=4; Arabidopsis thali...    93   4e-18
UniRef50_Q9SHE7 Cluster: NEDD8-like protein RUB1 precursor; n=19...    93   5e-18
UniRef50_Q6A1P6 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_Q4Q216 Cluster: Ubiquitin/ribosomal protein S27a, putat...    92   1e-17
UniRef50_Q6ZCA5 Cluster: Monoubiquitin/carboxy-extension protein...    91   2e-17
UniRef50_A0C9Z8 Cluster: Chromosome undetermined scaffold_160, w...    91   2e-17
UniRef50_P62979 Cluster: 40S ribosomal protein S27a; n=188; root...    91   2e-17
UniRef50_Q9VJ33 Cluster: NEDD8 precursor; n=546; root|Rep: NEDD8...    91   2e-17
UniRef50_Q5CQW0 Cluster: Ribosomal protein S27a, ubiquitin plus ...    89   9e-17
UniRef50_Q15843 Cluster: NEDD8 precursor; n=1233; root|Rep: NEDD...    88   2e-16
UniRef50_Q8IM64 Cluster: Ribosomal S27a, putative; n=6; Plasmodi...    87   3e-16
UniRef50_Q54V68 Cluster: Putative uncharacterized protein; n=3; ...    85   1e-15
UniRef50_Q00UH7 Cluster: Polyubiquitin 2; n=1; Ostreococcus taur...    84   3e-15
UniRef50_Q236S9 Cluster: Ubiquitin family protein; n=2; Alveolat...    83   4e-15
UniRef50_A6RQL0 Cluster: Ubiquitin; n=2; Sclerotiniaceae|Rep: Ub...    83   4e-15
UniRef50_Q9FWU7 Cluster: Putative polyubiquitin; n=3; Oryza sati...    83   6e-15
UniRef50_Q5X991 Cluster: BUBL1 protein; n=2; Paramecium tetraure...    82   1e-14
UniRef50_A2Q424 Cluster: Ubiquitin; TRAF-like; n=2; Medicago tru...    82   1e-14
UniRef50_O44819 Cluster: Putative uncharacterized protein; n=1; ...    81   2e-14
UniRef50_A2EJ38 Cluster: Ubiquitin family protein; n=4; Trichomo...    79   7e-14
UniRef50_Q99351 Cluster: D.melanogaster polytene; n=5; Drosophil...    77   4e-13
UniRef50_A7F3U9 Cluster: Putative uncharacterized protein; n=1; ...    77   4e-13
UniRef50_Q2HDX3 Cluster: Putative uncharacterized protein; n=1; ...    76   9e-13
UniRef50_Q03919 Cluster: NEDD8-like protein RUB1 precursor; n=8;...    76   9e-13
UniRef50_A4VDK0 Cluster: Putative uncharacterized protein; n=1; ...    75   1e-12
UniRef50_A2FSJ6 Cluster: Ubiquitin family protein; n=2; Trichomo...    74   3e-12
UniRef50_UPI00006CAF49 Cluster: Ribosomal protein S27a containin...    73   5e-12
UniRef50_Q4U8U0 Cluster: S27 ribosomal protein, putative; n=3; P...    73   6e-12
UniRef50_UPI0000604492 Cluster: PREDICTED: similar to ubiquitin ...    73   8e-12
UniRef50_Q54V65 Cluster: Putative uncharacterized protein; n=1; ...    73   8e-12
UniRef50_A7APS7 Cluster: Ubiquitin family protein; n=1; Babesia ...    72   1e-11
UniRef50_UPI0000E475A1 Cluster: PREDICTED: similar to ubiquitin;...    71   2e-11
UniRef50_Q7T2M6 Cluster: Ubquitin-like protein 1; n=1; Carassius...    71   2e-11
UniRef50_Q91890 Cluster: Ubiquitin-like fusion protein; n=6; Eum...    70   4e-11
UniRef50_Q013L7 Cluster: Glucose-repressible alcohol dehydrogena...    70   4e-11
UniRef50_UPI0000D56A31 Cluster: PREDICTED: similar to CG15771-PA...    68   2e-10
UniRef50_A0C2N0 Cluster: Chromosome undetermined scaffold_145, w...    68   2e-10
UniRef50_Q7T2M5 Cluster: Ubquitin-like protein 2; n=8; Clupeocep...    67   4e-10
UniRef50_Q4UDK2 Cluster: Ubiquitin,putative; n=2; Theileria|Rep:...    67   4e-10
UniRef50_Q22X50 Cluster: Ubiquitin family protein; n=2; Tetrahym...    67   4e-10
UniRef50_Q5MGJ9 Cluster: Ribosomal protein 3; n=1; Lonomia obliq...    65   1e-09
UniRef50_UPI00006CB3CF Cluster: Ubiquitin family protein; n=1; T...    64   2e-09
UniRef50_Q86XD8 Cluster: AN1-type zinc finger and ubiquitin doma...    64   3e-09
UniRef50_UPI0001554F34 Cluster: PREDICTED: similar to AN1, ubiqu...    64   4e-09
UniRef50_Q95TI4 Cluster: SD01679p; n=10; Endopterygota|Rep: SD01...    64   4e-09
UniRef50_Q5C0U3 Cluster: SJCHGC08803 protein; n=1; Schistosoma j...    64   4e-09
UniRef50_Q0C9H7 Cluster: Putative uncharacterized protein; n=1; ...    64   4e-09
UniRef50_Q4RSW8 Cluster: Chromosome 12 SCAF14999, whole genome s...    63   5e-09
UniRef50_P11441 Cluster: Ubiquitin-like protein 4A; n=32; Eutele...    63   5e-09
UniRef50_Q9FH07 Cluster: Arabidopsis thaliana genomic DNA, chrom...    63   6e-09
UniRef50_Q54MD2 Cluster: Putative uncharacterized protein; n=3; ...    63   6e-09
UniRef50_A2Z8U3 Cluster: Putative uncharacterized protein; n=1; ...    62   9e-09
UniRef50_Q06Z45 Cluster: Interferon stimulated gene 15; n=1; Gad...    62   1e-08
UniRef50_Q4UIY1 Cluster: Ubiquitin-related chaperonin, putative;...    62   1e-08
UniRef50_A2FER2 Cluster: Ubiquitin family protein; n=3; Trichomo...    62   1e-08
UniRef50_Q4SKY0 Cluster: Chromosome 17 SCAF14563, whole genome s...    61   3e-08
UniRef50_Q4CNV2 Cluster: Ubiquitin, putative; n=2; Trypanosoma|R...    60   3e-08
UniRef50_UPI0000D56CAF Cluster: PREDICTED: similar to AN1, ubiqu...    60   5e-08
UniRef50_A2G7G9 Cluster: Ubiquitin family protein; n=1; Trichomo...    60   5e-08
UniRef50_Q4MZU6 Cluster: Putative uncharacterized protein; n=1; ...    60   6e-08
UniRef50_Q9SU29 Cluster: Polyubiquitin-like protein; n=2; core e...    59   8e-08
UniRef50_UPI00015B5086 Cluster: PREDICTED: similar to ENSANGP000...    59   1e-07
UniRef50_A2ECR8 Cluster: Ubiquitin family protein; n=1; Trichomo...    59   1e-07
UniRef50_O13255 Cluster: 2',5'-oligo adenylate synthetase A; n=1...    58   1e-07
UniRef50_Q7QYQ3 Cluster: GLP_393_14301_14531; n=1; Giardia lambl...    58   2e-07
UniRef50_P91057 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q4P3T5 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q7XDE7 Cluster: Ubiquitin family protein, expressed; n=...    57   3e-07
UniRef50_Q5KK31 Cluster: Ribosomal chaperone, putative; n=1; Fil...    57   3e-07
UniRef50_Q07371 Cluster: Ubiquitin-like protein 1; n=1; Caenorha...    57   3e-07
UniRef50_A0C4L4 Cluster: Chromosome undetermined scaffold_15, wh...    57   4e-07
UniRef50_Q9YHD3 Cluster: Scythe; n=6; Xenopus|Rep: Scythe - Xeno...    56   6e-07
UniRef50_Q33AC4 Cluster: Protein kinase domain containing protei...    56   1e-06
UniRef50_Q0DJQ4 Cluster: Os05g0242100 protein; n=3; Oryza sativa...    56   1e-06
UniRef50_Q17E87 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_A0E5Z2 Cluster: Chromosome undetermined scaffold_8, who...    56   1e-06
UniRef50_A7R2A7 Cluster: Chromosome undetermined scaffold_411, w...    55   1e-06
UniRef50_A7RYS4 Cluster: Predicted protein; n=1; Nematostella ve...    55   1e-06
UniRef50_A0T470 Cluster: ORF27; n=5; Nucleopolyhedrovirus|Rep: O...    55   2e-06
UniRef50_Q84UT7 Cluster: Calreticulin interacted protein; n=7; O...    55   2e-06
UniRef50_A6S7C5 Cluster: Predicted protein; n=2; Sclerotiniaceae...    55   2e-06
UniRef50_UPI0000E46F9B Cluster: PREDICTED: similar to Chain A, S...    54   2e-06
UniRef50_A7ASK4 Cluster: Ubiquitin domain containing protein fam...    54   3e-06
UniRef50_A2G7G2 Cluster: Ubiquitin family protein; n=1; Trichomo...    54   3e-06
UniRef50_A7FA67 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q15646 Cluster: 59 kDa 2'-5'-oligoadenylate synthetase-...    54   3e-06
UniRef50_Q9VEP9 Cluster: CG16941-PA; n=7; Endopterygota|Rep: CG1...    54   4e-06
UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, who...    54   4e-06
UniRef50_A0DWV1 Cluster: Chromosome undetermined scaffold_67, wh...    54   4e-06
UniRef50_A0BZP2 Cluster: Chromosome undetermined scaffold_14, wh...    54   4e-06
UniRef50_Q55DZ2 Cluster: Putative uncharacterized protein; n=1; ...    53   5e-06
UniRef50_Q553G0 Cluster: Putative uncharacterized protein; n=2; ...    53   5e-06
UniRef50_UPI0000498E95 Cluster: 40S ribosomal protein S27a; n=1;...    53   7e-06
UniRef50_Q7SZF4 Cluster: HLA-B-associated transcript 3; n=5; Dan...    53   7e-06
UniRef50_Q4T7D6 Cluster: Chromosome undetermined SCAF8128, whole...    53   7e-06
UniRef50_Q23CW9 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_A4RK10 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_Q84L30 Cluster: Putative DNA repair protein RAD23-4; n=...    53   7e-06
UniRef50_A2XN69 Cluster: Putative uncharacterized protein; n=2; ...    52   9e-06
UniRef50_UPI0000E495BD Cluster: PREDICTED: hypothetical protein;...    52   1e-05
UniRef50_UPI000051618B Cluster: PREDICTED: similar to CG7215-PA,...    52   1e-05
UniRef50_A0E6I1 Cluster: Chromosome undetermined scaffold_8, who...    52   1e-05
UniRef50_A0CBZ8 Cluster: Chromosome undetermined scaffold_166, w...    52   1e-05
UniRef50_Q9VEC8 Cluster: CG7215-PA, isoform A; n=2; Sophophora|R...    52   2e-05
UniRef50_Q4Q2Y8 Cluster: Ubiquitin-like protein; n=3; Leishmania...    52   2e-05
UniRef50_Q2QU13 Cluster: Ubiquitin family protein, expressed; n=...    51   2e-05
UniRef50_A2F733 Cluster: Ubiquitin family protein; n=1; Trichomo...    51   2e-05
UniRef50_Q96T88 Cluster: E3 ubiquitin-protein ligase UHRF1; n=44...    51   2e-05
UniRef50_UPI000023DB70 Cluster: hypothetical protein FG00163.1; ...    51   3e-05
UniRef50_A7P609 Cluster: Chromosome chr4 scaffold_6, whole genom...    51   3e-05
UniRef50_Q56J89 Cluster: RAD23B-like protein; n=1; Adineta ricci...    51   3e-05
UniRef50_A2ESV4 Cluster: Ubiquitin family protein; n=1; Trichomo...    51   3e-05
UniRef50_Q55K49 Cluster: Putative uncharacterized protein; n=2; ...    51   3e-05
UniRef50_P54727 Cluster: UV excision repair protein RAD23 homolo...    51   3e-05
UniRef50_UPI0001554645 Cluster: PREDICTED: similar to Parkinson ...    50   4e-05
UniRef50_UPI0000D554E4 Cluster: PREDICTED: similar to CG16941-PA...    50   4e-05
UniRef50_Q9ZT95 Cluster: Putative ubiquitin-like protein; n=2; A...    50   4e-05
UniRef50_A7QS28 Cluster: Chromosome undetermined scaffold_155, w...    50   4e-05
UniRef50_A2G7U9 Cluster: Ubiquitin family protein; n=1; Trichomo...    50   4e-05
UniRef50_A2FA32 Cluster: Ubiquitin family protein; n=11; Trichom...    50   4e-05
UniRef50_A0DJC7 Cluster: Chromosome undetermined scaffold_53, wh...    50   4e-05
UniRef50_UPI0000E495BE Cluster: PREDICTED: similar to polyubiqui...    50   5e-05
UniRef50_Q5JNE7 Cluster: Putative uncharacterized protein P0435H...    50   5e-05
UniRef50_Q4UC28 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_A5K4E9 Cluster: Ubiquitin domain containing protein; n=...    50   5e-05
UniRef50_Q9NIF3 Cluster: Ubiquitin-like fusion protein SonA; n=2...    50   6e-05
UniRef50_Q19KS6 Cluster: Ubiquitin-like protein 4B; n=1; Monodel...    50   6e-05
UniRef50_O15205 Cluster: Ubiquitin D; n=18; Eutheria|Rep: Ubiqui...    50   6e-05
UniRef50_UPI0000D55C1D Cluster: PREDICTED: similar to HLA-B-asso...    49   9e-05
UniRef50_Q2HT46 Cluster: HECT; Ubiquitin; n=2; Medicago truncatu...    49   9e-05
UniRef50_A2Q1T1 Cluster: Ubiquitin; n=1; Medicago truncatula|Rep...    49   9e-05
UniRef50_A2DY94 Cluster: Ubiquitin family protein; n=1; Trichomo...    49   9e-05
UniRef50_Q5J4W3 Cluster: Parkin; n=3; Tetraodontidae|Rep: Parkin...    49   1e-04
UniRef50_Q53MR5 Cluster: Ubiquitin family, putative; n=2; Oryza ...    49   1e-04
UniRef50_A7QUN3 Cluster: Chromosome chr10 scaffold_179, whole ge...    49   1e-04
UniRef50_A3BRN9 Cluster: Putative uncharacterized protein; n=3; ...    49   1e-04
UniRef50_Q54TK0 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q54L35 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q232I7 Cluster: Ubiquitin family protein; n=1; Tetrahym...    48   1e-04
UniRef50_A7STF8 Cluster: Predicted protein; n=1; Nematostella ve...    48   1e-04
UniRef50_A7AVL0 Cluster: Ubiquitin family domain containing prot...    48   1e-04
UniRef50_Q6C7B6 Cluster: Similar to sp|P48510 Saccharomyces cere...    48   1e-04
UniRef50_Q5KN72 Cluster: Uv excision repair protein rhp23, putat...    48   1e-04
UniRef50_Q5KMP1 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q2UTN9 Cluster: Nucleotide excision repair factor NEF2;...    48   1e-04
UniRef50_Q7QWK0 Cluster: GLP_538_1417_1800; n=1; Giardia lamblia...    48   2e-04
UniRef50_Q4YYI6 Cluster: Ubiquitin-like protein, putative; n=3; ...    48   2e-04
UniRef50_Q17KT4 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_A2F4J1 Cluster: Ubiquitin family protein; n=1; Trichomo...    48   2e-04
UniRef50_UPI00015A6B69 Cluster: hypothetical protein LOC445284; ...    48   3e-04
UniRef50_Q6AXI3 Cluster: Zgc:92001; n=10; Coelomata|Rep: Zgc:920...    48   3e-04
UniRef50_Q554E9 Cluster: Putative uncharacterized protein; n=2; ...    48   3e-04
UniRef50_Q96PU4 Cluster: E3 ubiquitin-protein ligase UHRF2; n=26...    48   3e-04
UniRef50_Q84L31 Cluster: Putative DNA repair protein RAD23-3; n=...    48   3e-04
UniRef50_UPI0001554DB9 Cluster: PREDICTED: similar to inhibitor ...    47   3e-04
UniRef50_UPI0000D9A46C Cluster: PREDICTED: RAD23 homolog B (S. c...    47   3e-04
UniRef50_Q8LF25 Cluster: DNA-damage inducible protein DDI1-like;...    47   3e-04
UniRef50_A5AB45 Cluster: Remark: Dsk2p is a nuclear-enriched pro...    47   3e-04
UniRef50_Q0P460 Cluster: Zgc:153389; n=3; Danio rerio|Rep: Zgc:1...    47   5e-04
UniRef50_Q7XD49 Cluster: Putative uncharacterized protein; n=4; ...    47   5e-04
UniRef50_O03991 Cluster: RAD23 protein, isoform II; n=1; Daucus ...    47   5e-04
UniRef50_A7PXI1 Cluster: Chromosome chr12 scaffold_36, whole gen...    47   5e-04
UniRef50_O44803 Cluster: Putative uncharacterized protein; n=1; ...    47   5e-04
UniRef50_Q4PG40 Cluster: Putative uncharacterized protein; n=1; ...    47   5e-04
UniRef50_Q8N7F7 Cluster: Ubiquitin-like protein 4B; n=9; Eutheri...    47   5e-04
UniRef50_O60260 Cluster: Parkin; n=71; Eumetazoa|Rep: Parkin - H...    47   5e-04
UniRef50_P48510 Cluster: Ubiquitin domain-containing protein DSK...    47   5e-04
UniRef50_UPI000058738C Cluster: PREDICTED: hypothetical protein;...    46   6e-04
UniRef50_Q3ECA5 Cluster: Uncharacterized protein At1g79650.3; n=...    46   6e-04
UniRef50_Q015S3 Cluster: Ubiquitin-conjugating enzyme 9 homolog;...    46   6e-04
UniRef50_Q8I2T2 Cluster: Ubiquitin-like protein, putative; n=2; ...    46   6e-04
UniRef50_O44820 Cluster: Putative uncharacterized protein; n=2; ...    46   6e-04
UniRef50_A0RUP3 Cluster: Ribosomal protein S27AE; n=1; Cenarchae...    46   6e-04
UniRef50_UPI0001509B75 Cluster: Ubiquitin family protein; n=1; T...    46   8e-04
UniRef50_UPI0000DB7798 Cluster: PREDICTED: similar to ubiquitin-...    46   8e-04
UniRef50_UPI000065FB66 Cluster: E3 ubiquitin-protein ligase UHRF...    46   8e-04
UniRef50_Q4RRW6 Cluster: Chromosome 7 SCAF15001, whole genome sh...    46   8e-04
UniRef50_A7RNI9 Cluster: Predicted protein; n=1; Nematostella ve...    46   8e-04
UniRef50_Q8WUN7 Cluster: Ubiquitin domain-containing protein 2; ...    46   8e-04
UniRef50_Q5CR28 Cluster: DSK2 like protein with a ubiquitin doma...    46   0.001
UniRef50_Q54QA5 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q4H2N4 Cluster: Ci-UHRF2 protein; n=3; Deuterostomia|Re...    46   0.001
UniRef50_A5K6T6 Cluster: Ubiquitin-like protein, putative; n=1; ...    46   0.001
UniRef50_Q8LRK9 Cluster: Transcription initiation factor TFIID s...    46   0.001
UniRef50_UPI000023F381 Cluster: hypothetical protein FG08156.1; ...    45   0.001
UniRef50_Q7PRQ2 Cluster: ENSANGP00000017457; n=1; Anopheles gamb...    45   0.001
UniRef50_Q5CUV4 Cluster: UB domain containing protein; n=3; Euka...    45   0.001
UniRef50_Q5BXC3 Cluster: SJCHGC06167 protein; n=2; Schistosoma j...    45   0.001
UniRef50_Q54LV1 Cluster: RepC-binding protein A; n=2; Dictyostel...    45   0.001
UniRef50_Q4Q6V9 Cluster: UV excision repair RAD23-like protein; ...    45   0.001
UniRef50_A7RES3 Cluster: Predicted protein; n=3; Nematostella ve...    45   0.001
UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, w...    45   0.001
UniRef50_A2AB51 Cluster: HLA-B associated transcript 3; n=36; Eu...    45   0.001
UniRef50_Q6MVN0 Cluster: Related to ubiquitin-like protein DSK2;...    45   0.001
UniRef50_A4RL24 Cluster: Putative uncharacterized protein; n=1; ...    45   0.001
UniRef50_P46379 Cluster: Large proline-rich protein BAT3; n=108;...    45   0.001
UniRef50_UPI0000D557CB Cluster: PREDICTED: similar to ubiquitin-...    45   0.002
UniRef50_A2EN73 Cluster: Ubiquitin family protein; n=1; Trichomo...    45   0.002
UniRef50_P54725 Cluster: UV excision repair protein RAD23 homolo...    45   0.002
UniRef50_Q9DVY9 Cluster: PxORF43 peptide; n=2; Granulovirus|Rep:...    44   0.002
UniRef50_Q9FY81 Cluster: Ubiquitin-like protein; n=1; Arabidopsi...    44   0.002
UniRef50_Q7XBP5 Cluster: Putative uncharacterized protein; n=1; ...    44   0.002
UniRef50_UPI00015B5080 Cluster: PREDICTED: similar to NP95; n=1;...    44   0.003
UniRef50_Q9XZE0 Cluster: DHR23; n=5; Sophophora|Rep: DHR23 - Dro...    44   0.003
UniRef50_Q9VWD9 Cluster: CG14224-PA; n=4; Endopterygota|Rep: CG1...    44   0.003
UniRef50_Q1JTK9 Cluster: DNA repair protein rad23 homolog b, put...    44   0.004
UniRef50_Q8SUA1 Cluster: Putative uncharacterized protein ECU10_...    44   0.004
UniRef50_Q80LS9 Cluster: Putative uncharacterized protein; n=1; ...    43   0.006
UniRef50_Q7XCL2 Cluster: Ubiquitin family protein, expressed; n=...    43   0.006
UniRef50_A6N155 Cluster: Polyubiquitin containing 7 ubiquitin mo...    43   0.006
UniRef50_A7SRL4 Cluster: Predicted protein; n=1; Nematostella ve...    43   0.006
UniRef50_P05161 Cluster: Interferon-induced 17 kDa protein precu...    43   0.006
UniRef50_Q6M029 Cluster: 30S ribosomal protein S27ae; n=6; Eurya...    43   0.006
UniRef50_Q9M0X2 Cluster: Putative uncharacterized protein AT4g05...    43   0.007
UniRef50_Q10S80 Cluster: Ubiquitin family protein, expressed; n=...    43   0.007
UniRef50_Q17JC6 Cluster: Uv excision repair protein rad23; n=1; ...    43   0.007
UniRef50_Q6BXC6 Cluster: Debaryomyces hansenii chromosome B of s...    43   0.007
UniRef50_Q15459 Cluster: Splicing factor 3 subunit 1; n=43; Coel...    43   0.007
UniRef50_UPI0000F2EC07 Cluster: PREDICTED: similar to interferon...    42   0.010
UniRef50_Q00Y37 Cluster: Chromosome 12 contig 1, DNA sequence; n...    42   0.010
UniRef50_A3BJX7 Cluster: Putative uncharacterized protein; n=1; ...    42   0.010
UniRef50_A2E296 Cluster: Ubiquitin family protein; n=1; Trichomo...    42   0.010
UniRef50_A0E2Q5 Cluster: Chromosome undetermined scaffold_75, wh...    42   0.010
UniRef50_Q4PEX0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.010
UniRef50_Q0U9Z4 Cluster: Predicted protein; n=1; Phaeosphaeria n...    42   0.013
UniRef50_Q67W65 Cluster: Transcription initiation factor TFIID s...    42   0.013
UniRef50_UPI0000F2CBB8 Cluster: PREDICTED: similar to 2-5 oligoa...    42   0.017
UniRef50_A5B3W2 Cluster: Putative uncharacterized protein; n=1; ...    42   0.017
UniRef50_Q201W5 Cluster: Putative RAD23-like B; n=2; Neoptera|Re...    42   0.017
UniRef50_P91052 Cluster: Putative uncharacterized protein; n=2; ...    42   0.017
UniRef50_A0BIE9 Cluster: Chromosome undetermined scaffold_11, wh...    42   0.017
UniRef50_Q6CAG8 Cluster: Yarrowia lipolytica chromosome D of str...    42   0.017
UniRef50_UPI0000DB7150 Cluster: PREDICTED: similar to HLA-B-asso...    41   0.023
UniRef50_Q9VCD5 Cluster: CG10694-PA; n=1; Drosophila melanogaste...    41   0.023
UniRef50_Q386A3 Cluster: Ubiquitin-like protein, putative; n=1; ...    41   0.023
UniRef50_Q92353 Cluster: Ubiquitin carboxyl-terminal hydrolase 6...    41   0.023
UniRef50_Q2QU15 Cluster: Expressed protein; n=3; Oryza sativa|Re...    41   0.030
UniRef50_A2EDJ2 Cluster: Ribosomal protein S27a, putative; n=5; ...    41   0.030
UniRef50_A7DS39 Cluster: Ribosomal protein S27a; n=1; Candidatus...    41   0.030
UniRef50_UPI0000E491EC Cluster: PREDICTED: similar to splicing f...    40   0.039
UniRef50_UPI00004985B5 Cluster: hypothetical protein 103.t00036;...    40   0.039
UniRef50_Q9FNF8 Cluster: Ubiquitin; n=17; Magnoliophyta|Rep: Ubi...    40   0.052
UniRef50_Q10NT3 Cluster: Expressed protein; n=3; Oryza sativa|Re...    40   0.052
UniRef50_Q8IAZ4 Cluster: Putative uncharacterized protein PF08_0...    40   0.052
UniRef50_A0ECQ1 Cluster: Chromosome undetermined scaffold_9, who...    40   0.052
UniRef50_A1CUI4 Cluster: Ubiquitin-like protein DskB, putative; ...    40   0.052
UniRef50_UPI00006CB419 Cluster: Ubiquitin family protein; n=1; T...    40   0.069
UniRef50_A3F511 Cluster: Ubiquitin 3; n=1; Taenia asiatica|Rep: ...    40   0.069
UniRef50_Q9LF19 Cluster: Putative uncharacterized protein T21H19...    39   0.091
UniRef50_Q86Q31 Cluster: Scythe-like protein; n=1; Hydra vulgari...    39   0.091
UniRef50_Q4Q222 Cluster: Ubiquitin-like protein, putative; n=4; ...    39   0.091
UniRef50_Q173F1 Cluster: Ubiquilin 1,2; n=5; Neoptera|Rep: Ubiqu...    39   0.091
UniRef50_Q5KCT4 Cluster: Putative uncharacterized protein; n=1; ...    39   0.091
UniRef50_O74803 Cluster: UV excision repair protein rhp23; n=1; ...    39   0.091
UniRef50_P32628 Cluster: UV excision repair protein RAD23; n=4; ...    39   0.091
UniRef50_Q0J0T6 Cluster: Os09g0484300 protein; n=4; BEP clade|Re...    39   0.12 
UniRef50_Q54ZZ6 Cluster: Putative uncharacterized protein; n=2; ...    39   0.12 
UniRef50_Q54JB0 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q8SV38 Cluster: Putative uncharacterized protein ECU07_...    39   0.12 
UniRef50_Q0W6G3 Cluster: 30S ribosomal protein S27AE; n=2; Eurya...    39   0.12 
UniRef50_UPI0000EBE1A5 Cluster: PREDICTED: similar to LOC512938 ...    38   0.16 
UniRef50_Q0KIL5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.16 
UniRef50_Q4E0H2 Cluster: DNA-damage inducible protein DDI1-like ...    38   0.16 
UniRef50_A7AUH2 Cluster: Putative uncharacterized protein; n=1; ...    38   0.16 
UniRef50_A2DZ98 Cluster: Ubiquitin family protein; n=1; Trichomo...    38   0.16 
UniRef50_Q6C8W3 Cluster: Similar to sp|O74803 Schizosaccharomyce...    38   0.16 
UniRef50_Q10169 Cluster: Deubiquitination-protection protein dph...    38   0.16 
UniRef50_A7SV03 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.21 
UniRef50_A7S5W6 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.21 
UniRef50_UPI0000499807 Cluster: UV excision repair protein RAD23...    38   0.28 
UniRef50_UPI00003633B7 Cluster: Ubiquilin-4 (Ataxin-1 ubiquitin-...    38   0.28 
UniRef50_Q9ZT93 Cluster: Putative ubiquitin-like protein; n=3; A...    38   0.28 
UniRef50_Q54GV5 Cluster: Putative uncharacterized protein; n=1; ...    38   0.28 
UniRef50_Q298K5 Cluster: GA10501-PA; n=1; Drosophila pseudoobscu...    38   0.28 
UniRef50_UPI0000D573E0 Cluster: PREDICTED: similar to CG32676-PA...    37   0.37 
UniRef50_Q22KB6 Cluster: Ubiquitin family protein; n=1; Tetrahym...    37   0.37 
UniRef50_P91055 Cluster: Putative uncharacterized protein; n=1; ...    37   0.37 
UniRef50_Q8TVD7 Cluster: 30S ribosomal protein S27ae; n=21; Eury...    37   0.37 
UniRef50_Q9M0X0 Cluster: Putative uncharacterized protein AT4g05...    37   0.49 
UniRef50_Q08E65 Cluster: Similar to AN1, ubiquitin-like, homolog...    37   0.49 
UniRef50_Q8SXD4 Cluster: GH03394p; n=1; Drosophila melanogaster|...    37   0.49 
UniRef50_Q5BX61 Cluster: SJCHGC01182 protein; n=1; Schistosoma j...    37   0.49 
UniRef50_A6S9G3 Cluster: Putative uncharacterized protein; n=2; ...    37   0.49 
UniRef50_UPI000049A4E9 Cluster: hypothetical protein 14.t00031; ...    36   0.64 
UniRef50_Q8VWY0 Cluster: Ubiquitin-like protein; n=1; Cucumis sa...    36   0.64 
UniRef50_Q5VNW8 Cluster: Putative uncharacterized protein P0039G...    36   0.64 
UniRef50_Q9H347 Cluster: Ubiquilin-3; n=10; Theria|Rep: Ubiquili...    36   0.64 
UniRef50_P61240 Cluster: 30S ribosomal protein S27ae; n=2; Archa...    36   0.64 
UniRef50_UPI0000E48687 Cluster: PREDICTED: similar to DNA-damage...    36   0.85 
UniRef50_Q7PIK1 Cluster: ENSANGP00000024456; n=1; Anopheles gamb...    36   0.85 
UniRef50_Q54CH9 Cluster: Putative uncharacterized protein; n=1; ...    36   0.85 
UniRef50_P91050 Cluster: Putative uncharacterized protein; n=1; ...    36   0.85 
UniRef50_A6NDN8 Cluster: Uncharacterized protein ENSP00000310146...    36   0.85 
UniRef50_UPI0000498B1D Cluster: ubiquitin-like protein; n=1; Ent...    36   1.1  
UniRef50_Q4T158 Cluster: Chromosome 21 SCAF10714, whole genome s...    36   1.1  
UniRef50_Q94CF9 Cluster: RSSG8; n=4; Oryza sativa|Rep: RSSG8 - O...    36   1.1  
UniRef50_Q9VS83 Cluster: CG7546-PB, isoform B; n=3; Drosophila m...    36   1.1  
UniRef50_Q9VS82 Cluster: CG7546-PA, isoform A; n=2; Sophophora|R...    36   1.1  
UniRef50_Q38BA3 Cluster: Ubiquitin-like protein DSK2, putative; ...    36   1.1  
UniRef50_Q1ZXM9 Cluster: Ubiquitin domain-containing protein; n=...    36   1.1  
UniRef50_A2EG21 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_A2E190 Cluster: Ubiquitin family protein; n=9; Trichomo...    36   1.1  
UniRef50_A0BFI2 Cluster: Chromosome undetermined scaffold_104, w...    36   1.1  
UniRef50_A3GFE2 Cluster: Deubiquitinating enzyme; n=6; Saccharom...    36   1.1  
UniRef50_UPI00006D1171 Cluster: PREDICTED: transcription elongat...    35   1.5  
UniRef50_Q9M0W4 Cluster: Putative uncharacterized protein AT4g05...    35   1.5  
UniRef50_A4S3S2 Cluster: Predicted protein; n=2; Ostreococcus|Re...    35   1.5  
UniRef50_Q61E13 Cluster: Putative uncharacterized protein CBG122...    35   1.5  
UniRef50_A2ETT4 Cluster: UBA/TS-N domain containing protein; n=1...    35   1.5  
UniRef50_A6ND44 Cluster: Uncharacterized protein UBQLN4; n=2; Ho...    35   1.5  
UniRef50_Q2FS44 Cluster: Ribosomal protein S27a; n=2; Methanomic...    35   1.5  
UniRef50_Q9NRR5 Cluster: Ubiquilin-4; n=19; Theria|Rep: Ubiquili...    35   1.5  
UniRef50_UPI000155D402 Cluster: PREDICTED: similar to 2,5-oligoa...    35   2.0  
UniRef50_UPI0000EB4B7C Cluster: UPI0000EB4B7C related cluster; n...    35   2.0  
UniRef50_Q5VMK8 Cluster: Putative uncharacterized protein P0529C...    35   2.0  
UniRef50_A4RR64 Cluster: Predicted protein; n=2; Ostreococcus|Re...    35   2.0  
UniRef50_Q174A3 Cluster: Ubiquitin conjugating enzyme 7 interact...    35   2.0  
UniRef50_Q10577 Cluster: Caenorhabditis elegans pre-RNA processi...    35   2.0  
UniRef50_Q8SRH8 Cluster: UBIQUITIN/ L40 RIBOSOMAL PROTEIN FUSION...    35   2.0  
UniRef50_Q753F6 Cluster: AFR358Wp; n=1; Eremothecium gossypii|Re...    35   2.0  
UniRef50_UPI00006CC9EB Cluster: Ubiquitin family protein; n=1; T...    34   2.6  
UniRef50_UPI0001554E1F Cluster: PREDICTED: hypothetical protein;...    34   3.4  
UniRef50_A0CD17 Cluster: Chromosome undetermined scaffold_169, w...    34   3.4  
UniRef50_O65382 Cluster: F12F1.16 protein; n=1; Arabidopsis thal...    33   4.5  
UniRef50_Q9VNB2 Cluster: CG1172-PA; n=4; Endopterygota|Rep: CG11...    33   4.5  
UniRef50_Q23451 Cluster: Putative uncharacterized protein rad-23...    33   4.5  
UniRef50_A2E462 Cluster: Clan CA, family C19, ubiquitin hydrolas...    33   4.5  
UniRef50_A0EDR3 Cluster: Chromosome undetermined scaffold_90, wh...    33   4.5  
UniRef50_Q6Q546 Cluster: Ubiquitin-like modifier HUB1; n=31; Euk...    33   4.5  
UniRef50_UPI00004986BD Cluster: RAD23 protein; n=1; Entamoeba hi...    33   6.0  
UniRef50_UPI0000D62F57 Cluster: UPI0000D62F57 related cluster; n...    33   6.0  
UniRef50_Q9LY93 Cluster: Putative uncharacterized protein F18O22...    33   6.0  
UniRef50_UPI0000DB72DC Cluster: PREDICTED: similar to CG32676-PA...    33   7.9  
UniRef50_A7QF39 Cluster: Chromosome chr16 scaffold_86, whole gen...    33   7.9  
UniRef50_A7SAP1 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.9  
UniRef50_A2FVV6 Cluster: Ubiquitin family protein; n=3; Trichomo...    33   7.9  
UniRef50_Q6CI70 Cluster: Yarrowia lipolytica chromosome A of str...    33   7.9  
UniRef50_A6RHI5 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  

>UniRef50_Q7RJC6 Cluster: Ubiquitin; n=1; Plasmodium yoelii
           yoelii|Rep: Ubiquitin - Plasmodium yoelii yoelii
          Length = 162

 Score =  142 bits (343), Expect = 9e-33
 Identities = 68/71 (95%), Positives = 70/71 (98%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           KMQIFVKTLTGKTITL+VEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDY
Sbjct: 35  KMQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 94

Query: 450 NIQKESTLHLV 418
           NIQKESTLHLV
Sbjct: 95  NIQKESTLHLV 105


>UniRef50_Q9WR81 Cluster: Polyprotein; n=31; root|Rep: Polyprotein -
           Bovine viral diarrhea virus 2 (BVDV-2)
          Length = 432

 Score =  141 bits (341), Expect = 2e-32
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 224 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 283

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 284 IQKESTLHLV 293



 Score =  141 bits (341), Expect = 2e-32
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 300 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 359

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 360 IQKESTLHLV 369


>UniRef50_UPI000155314F Cluster: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1; n=3;
           Euarchontoglires|Rep: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1 - Mus
           musculus
          Length = 203

 Score =  138 bits (333), Expect = 1e-31
 Identities = 66/70 (94%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +QIFVKTLTGKTITLEVEPSDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 78  VQIFVKTLTGKTITLEVEPSDTIKNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 137

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 138 IQKESTLHLV 147


>UniRef50_UPI00006CFD8F Cluster: Ubiquitin family protein; n=1;
            Tetrahymena thermophila SB210|Rep: Ubiquitin family
            protein - Tetrahymena thermophila SB210
          Length = 1252

 Score =  136 bits (330), Expect = 3e-31
 Identities = 66/70 (94%), Positives = 68/70 (97%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITL+VE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1100 MQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 1159

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1160 IQKESTLHLV 1169



 Score =  136 bits (330), Expect = 3e-31
 Identities = 66/70 (94%), Positives = 68/70 (97%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITL+VE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1176 MQIFVKTLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 1235

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1236 IQKESTLHLV 1245



 Score =  125 bits (301), Expect = 1e-27
 Identities = 60/64 (93%), Positives = 62/64 (96%)
 Frame = -1

Query: 609  TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKEST 430
            TLTGKTITL+VE SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQKEST
Sbjct: 1030 TLTGKTITLDVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST 1089

Query: 429  LHLV 418
            LHLV
Sbjct: 1090 LHLV 1093


>UniRef50_Q9WR79 Cluster: Polyprotein; n=3; Bovine viral diarrhea
           virus 2|Rep: Polyprotein - Bovine viral diarrhea virus 2
           (BVDV-2)
          Length = 261

 Score =  136 bits (328), Expect = 6e-31
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I+VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQ
Sbjct: 131 IYVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 190

Query: 441 KESTLHLV 418
           KESTLHLV
Sbjct: 191 KESTLHLV 198


>UniRef50_A2YRX2 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 324

 Score =  136 bits (328), Expect = 6e-31
 Identities = 65/72 (90%), Positives = 70/72 (97%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           VKMQIFVKTLTGK+ITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLE+GRTL+D
Sbjct: 233 VKMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLAD 292

Query: 453 YNIQKESTLHLV 418
           YNIQKESTLHLV
Sbjct: 293 YNIQKESTLHLV 304



 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 50/74 (67%), Positives = 56/74 (75%), Gaps = 4/74 (5%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL---XFAGKQLED-GRTL 460
           MQI VKTLTG TITLEV PSDTI++VKAKIQDK GI  +QQ L       KQL+D G TL
Sbjct: 1   MQIIVKTLTGITITLEVRPSDTIDDVKAKIQDKVGIRSDQQHLVDVSAGSKQLDDGGSTL 60

Query: 459 SDYNIQKESTLHLV 418
           +DY+I  ESTLHLV
Sbjct: 61  ADYDIHDESTLHLV 74


>UniRef50_Q0WRN6 Cluster: Polyubiquitin 4 UBQ4; n=6; Eukaryota|Rep:
           Polyubiquitin 4 UBQ4 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 351

 Score =  135 bits (327), Expect = 8e-31
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 1   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  135 bits (327), Expect = 8e-31
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 77  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  135 bits (327), Expect = 8e-31
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 198 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 257

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 258 IQKESTLHLV 267



 Score =  135 bits (327), Expect = 8e-31
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTL+DYN
Sbjct: 274 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 333

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 334 IQKESTLHLV 343



 Score = 60.1 bits (139), Expect(2) = 4e-09
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQ 535
           MQIFVKTLTGKTITLEVE SDTI+NVKAKIQ
Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ 183



 Score = 23.4 bits (48), Expect(2) = 4e-09
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = -1

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 182 IQKESTLHLV 191


>UniRef50_A0CI21 Cluster: Chromosome undetermined scaffold_187,
           whole genome shotgun sequence; n=2; Eukaryota|Rep:
           Chromosome undetermined scaffold_187, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 271

 Score =  135 bits (327), Expect = 8e-31
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITL+VEPSDTI+ VKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLDVEPSDTIDAVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  106 bits (254), Expect = 5e-22
 Identities = 46/70 (65%), Positives = 61/70 (87%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIF+KTLTG+ I L+VE +D++E++K +IQDKEGIPPNQQRL F+G QLED +TL +YN
Sbjct: 77  MQIFIKTLTGRLINLDVESTDSVESLKKQIQDKEGIPPNQQRLIFSGHQLEDEKTLLEYN 136

Query: 447 IQKESTLHLV 418
           ++ EST+HLV
Sbjct: 137 VENESTIHLV 146


>UniRef50_A0PDJ3 Cluster: Polyprotein; n=65; root|Rep: Polyprotein -
           Bovine viral diarrhea virus (BVDV) (Mucosal disease
           virus)
          Length = 630

 Score =  134 bits (323), Expect = 2e-30
 Identities = 64/67 (95%), Positives = 65/67 (97%)
 Frame = -1

Query: 618 FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQK 439
           FVKTLTGKTITLE EPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQK
Sbjct: 325 FVKTLTGKTITLEAEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 384

Query: 438 ESTLHLV 418
           ESTLHLV
Sbjct: 385 ESTLHLV 391



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = -1

Query: 300 ENGKIHRLRRECTGEQCGAGVFMA 229
           ENGKI RLRREC  ++CGAGVFMA
Sbjct: 298 ENGKISRLRRECPSDECGAGVFMA 321


>UniRef50_Q868B2 Cluster: Polyubiquitin; n=3; Eukaryota|Rep:
           Polyubiquitin - Euglypha rotunda
          Length = 177

 Score =  130 bits (315), Expect = 2e-29
 Identities = 62/70 (88%), Positives = 66/70 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITL+VE SDTIENVK KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 72  MQIFVKTLTGKTITLDVEASDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 131

Query: 447 IQKESTLHLV 418
           + KE+TLHLV
Sbjct: 132 VTKEATLHLV 141



 Score =  117 bits (281), Expect = 3e-25
 Identities = 55/63 (87%), Positives = 59/63 (93%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           LTGKTITL+VE SDTIENVK KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN+ KE+TL
Sbjct: 1   LTGKTITLDVEASDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVTKEATL 60

Query: 426 HLV 418
           HLV
Sbjct: 61  HLV 63



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/27 (92%), Positives = 26/27 (96%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVK 547
           MQIFVKTLTGKTITL+VE SDTIENVK
Sbjct: 150 MQIFVKTLTGKTITLDVEASDTIENVK 176


>UniRef50_Q9E2W4 Cluster: Polyprotein; n=1; Bovine viral diarrhea
           virus type 2|Rep: Polyprotein - Bovine viral diarrhea
           virus type 2
          Length = 636

 Score =  129 bits (311), Expect = 7e-29
 Identities = 63/69 (91%), Positives = 65/69 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL  AGKQLEDGRTLS Y 
Sbjct: 355 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLILAGKQLEDGRTLSAYK 414

Query: 447 IQKESTLHL 421
           IQKESTL+L
Sbjct: 415 IQKESTLYL 423



 Score =  124 bits (300), Expect = 1e-27
 Identities = 60/69 (86%), Positives = 62/69 (89%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP Q+RL F   + ED RTLSDYN
Sbjct: 431 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPGQKRLIFPANKREDARTLSDYN 490

Query: 447 IQKESTLHL 421
           IQKESTLHL
Sbjct: 491 IQKESTLHL 499



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = -1

Query: 525 GIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           GIPP+QQRL FAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 313 GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 348


>UniRef50_Q7XBP6 Cluster: Ubiquitin/ribosomal protein P1 fusion;
           n=3; Chlorarachniophyceae|Rep: Ubiquitin/ribosomal
           protein P1 fusion - Bigelowiella natans (Pedinomonas
           minutissima) (Chlorarachnion sp.(strain CCMP 621))
          Length = 221

 Score =  128 bits (309), Expect = 1e-28
 Identities = 61/72 (84%), Positives = 66/72 (91%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           + MQIFVKTLTGKTITL+V+ SDTI  VK KIQDKEGIPP+QQRL FAGKQLEDGRTL+D
Sbjct: 1   MSMQIFVKTLTGKTITLDVDSSDTINTVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 60

Query: 453 YNIQKESTLHLV 418
           YNIQKESTLHLV
Sbjct: 61  YNIQKESTLHLV 72


>UniRef50_A6SBB4 Cluster: 60S ribosomal protein L40; n=1;
           Botryotinia fuckeliana B05.10|Rep: 60S ribosomal protein
           L40 - Botryotinia fuckeliana B05.10
          Length = 607

 Score =  125 bits (301), Expect = 1e-27
 Identities = 60/64 (93%), Positives = 62/64 (96%)
 Frame = -1

Query: 609 TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKEST 430
           TLTGKTITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQKEST
Sbjct: 486 TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST 545

Query: 429 LHLV 418
           LHLV
Sbjct: 546 LHLV 549


>UniRef50_Q91BI7 Cluster: Ubiquitin GP37 fusion protein; n=2;
           Spodoptera litura NPV|Rep: Ubiquitin GP37 fusion protein
           - Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 351

 Score =  122 bits (295), Expect = 6e-27
 Identities = 56/70 (80%), Positives = 64/70 (91%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTIT++VEPSD++E VK +I DKEG+PP+QQRL FAGKQLED  T+SDYN
Sbjct: 20  MQIFVKTLTGKTITVDVEPSDSVETVKQRIADKEGVPPDQQRLIFAGKQLEDSMTMSDYN 79

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 80  IQKESTLHLV 89


>UniRef50_A1TWA7 Cluster: Ubiquitin precursor; n=1; Acidovorax
           avenae subsp. citrulli AAC00-1|Rep: Ubiquitin precursor
           - Acidovorax avenae subsp. citrulli (strain AAC00-1)
          Length = 287

 Score =  122 bits (294), Expect = 8e-27
 Identities = 56/70 (80%), Positives = 66/70 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FVK L+G+T+TL+VEPSD+IENVKAKIQD++ IPP +QRL FAGKQLEDGRTLSDYN
Sbjct: 40  MQVFVKMLSGETLTLDVEPSDSIENVKAKIQDQKDIPPERQRLIFAGKQLEDGRTLSDYN 99

Query: 447 IQKESTLHLV 418
           IQK+STLHLV
Sbjct: 100 IQKDSTLHLV 109


>UniRef50_Q9FWV0 Cluster: Putative ubiquitin/ribosomal protein S27a
           fusion protein; n=2; Eukaryota|Rep: Putative
           ubiquitin/ribosomal protein S27a fusion protein - Oryza
           sativa subsp. japonica (Rice)
          Length = 147

 Score =  122 bits (293), Expect = 1e-26
 Identities = 70/144 (48%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           V  QIFVK LTGKT  L +EPSDT+E+VK K+ DKEG+PP+QQ L F G QL+DG TL  
Sbjct: 4   VMTQIFVKGLTGKTTALRMEPSDTVESVKVKLVDKEGLPPDQQPLIFQGHQLDDGHTLIY 63

Query: 453 YNIQKESTLHL---VXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKI 286
           Y IQ+ESTLHL   +            K Y+TP          +LAVLR Y+VD+  GK+
Sbjct: 64  YGIQEESTLHLLGRICGGGGGNKKRKKKAYATPKKGKHEHRKEELAVLRHYRVDDVMGKV 123

Query: 285 HRLRRECTGEQC-GAGVFMAVMED 217
            RLR  C   +C   G  MA   D
Sbjct: 124 ERLRLMCPNPECKDVGALMAKHHD 147


>UniRef50_Q6WMU7 Cluster: Ubiquitin-like protein Ublp94.4; n=1;
           Acanthamoeba castellanii|Rep: Ubiquitin-like protein
           Ublp94.4 - Acanthamoeba castellanii (Amoeba)
          Length = 853

 Score =  119 bits (286), Expect = 7e-26
 Identities = 56/70 (80%), Positives = 64/70 (91%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIF+KTLTGK+ITLEV  SD+IE VK K+QDKEGIPP+QQRL FAGKQLE+ RTL++YN
Sbjct: 341 MQIFIKTLTGKSITLEVSSSDSIEAVKHKLQDKEGIPPDQQRLIFAGKQLEESRTLAEYN 400

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 401 IQKESTLHLV 410


>UniRef50_P16709 Cluster: Ubiquitin-like protein precursor; n=19;
           root|Rep: Ubiquitin-like protein precursor - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 77

 Score =  113 bits (272), Expect = 3e-24
 Identities = 50/70 (71%), Positives = 62/70 (88%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIF+KTLTGKTIT E EP++T+ ++K KI DKEG+P +QQRL FAGKQLED +T++DYN
Sbjct: 1   MQIFIKTLTGKTITAETEPAETVADLKQKIADKEGVPVDQQRLIFAGKQLEDSKTMADYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLH+V
Sbjct: 61  IQKESTLHMV 70


>UniRef50_Q9YMT1 Cluster: Viral ubiquitin; n=1; Lymantria dispar
           MNPV|Rep: Viral ubiquitin - Lymantria dispar multicapsid
           nuclear polyhedrosis virus (LdMNPV)
          Length = 150

 Score =  111 bits (267), Expect = 1e-23
 Identities = 51/70 (72%), Positives = 63/70 (90%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTIT++VE +D+++ +K KI DKEGIP +QQRL +AGKQL+D RTL+DYN
Sbjct: 1   MQIFVKTLTGKTITVDVEATDSVQTLKEKILDKEGIPADQQRLIYAGKQLDDERTLNDYN 60

Query: 447 IQKESTLHLV 418
           IQKE+TLHLV
Sbjct: 61  IQKEATLHLV 70


>UniRef50_Q9SYE9 Cluster: F15I1.1 protein; n=1; Arabidopsis
           thaliana|Rep: F15I1.1 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 158

 Score =  109 bits (261), Expect = 8e-23
 Identities = 51/70 (72%), Positives = 59/70 (84%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M IF+KTLTG+ I LEVE  DTIEN+KAKIQDK+GIP +QQRL F GKQLEDG TL+DYN
Sbjct: 86  MFIFIKTLTGRRIVLEVENCDTIENIKAKIQDKQGIPVDQQRLIFKGKQLEDGLTLADYN 145

Query: 447 IQKESTLHLV 418
           IQ +S LHL+
Sbjct: 146 IQNDSILHLI 155


>UniRef50_Q5D8K9 Cluster: SJCHGC02785 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02785 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 153

 Score =  103 bits (246), Expect = 5e-21
 Identities = 57/147 (38%), Positives = 78/147 (53%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ V++  G +I +   P+++++++K KI    GI  + Q L   G  L D   L + +
Sbjct: 1   MRLLVRSHLGGSIVVSAGPNESVKSLKDKISVATGIHASTQSLYHHGLPLLDSSLLEELD 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
                 + +             KNY+TP          KLA L+FYKVD NGKI RLRRE
Sbjct: 61  FTDLDNVDVNCELLGGGKKRKKKNYTTPRKIKHKKKKVKLATLKFYKVDSNGKITRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHST 187
           C  E+CGAGVFMA   DR YCGKC  T
Sbjct: 121 CPSEKCGAGVFMASHFDREYCGKCALT 147


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  100 bits (240), Expect = 3e-20
 Identities = 46/61 (75%), Positives = 54/61 (88%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           LTGK ITL+V+PS+TI+NVK KIQ+KEG+PP+Q RL FAGKQLEDGRTL+  NIQ ESTL
Sbjct: 1   LTGKNITLDVDPSETIDNVKEKIQEKEGVPPDQLRLIFAGKQLEDGRTLAHCNIQNESTL 60

Query: 426 H 424
           H
Sbjct: 61  H 61


>UniRef50_UPI0000DA4142 Cluster: PREDICTED: similar to ribosomal
           protein S27a; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to ribosomal protein S27a - Rattus norvegicus
          Length = 122

 Score =   99 bits (238), Expect = 5e-20
 Identities = 67/142 (47%), Positives = 80/142 (56%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++  KTLTGKTI L VEPSDTIENVKAKIQD+EGIPP+QQRL FAG       TL+D  
Sbjct: 3   LRLSTKTLTGKTIMLNVEPSDTIENVKAKIQDEEGIPPHQQRLVFAGTL----STLTDSG 58

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
            +K                   K+Y+            KLAVL+ +KVDENGKI R   E
Sbjct: 59  AKKRK-----------------KSYTAHKKSKHRRKKVKLAVLKHHKVDENGKISRRCWE 101

Query: 267 CTGEQCGAGVFMAVMEDRHYCG 202
              ++CGAG       D HYCG
Sbjct: 102 RPSDECGAG---GGHFDMHYCG 120


>UniRef50_A2YRX0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 253

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 47/55 (85%), Positives = 52/55 (94%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG 469
           +KMQIFVKT TGK+ITLEVE SDTI+NVKAKIQDKEGIPP+QQRL FAGKQLE+G
Sbjct: 197 MKMQIFVKTRTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEG 251


>UniRef50_UPI00005A2EE8 Cluster: PREDICTED: similar to ubiquitin C;
           n=1; Canis lupus familiaris|Rep: PREDICTED: similar to
           ubiquitin C - Canis familiaris
          Length = 166

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 49/71 (69%), Positives = 55/71 (77%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++QIFVKTLTGKT+TLEVEP DT EN KAKIQDKEGI   QQ L FAG+Q ED   +SD 
Sbjct: 19  ELQIFVKTLTGKTMTLEVEPRDTTENAKAKIQDKEGILLTQQHLIFAGQQSEDSPIVSDN 78

Query: 450 NIQKESTLHLV 418
           N QK+S LH V
Sbjct: 79  NSQKKSILHSV 89


>UniRef50_Q22T79 Cluster: Ubiquitin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ubiquitin family protein -
           Tetrahymena thermophila SB210
          Length = 564

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 46/68 (67%), Positives = 56/68 (82%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           +FVKTL+G+TI L+ + SDTI+N+K KI D EGIPP+QQRL F GK LE+G TLSDYNIQ
Sbjct: 286 LFVKTLSGQTIKLDYDSSDTIDNIKNKIYDIEGIPPDQQRLIFPGKILENGYTLSDYNIQ 345

Query: 441 KESTLHLV 418
             ST+HLV
Sbjct: 346 NGSTIHLV 353


>UniRef50_UPI000155E27A Cluster: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1; n=1;
           Equus caballus|Rep: PREDICTED: similar to ubiquitin A-52
           residue ribosomal protein fusion product 1 - Equus
           caballus
          Length = 141

 Score = 97.5 bits (232), Expect = 2e-19
 Identities = 46/61 (75%), Positives = 51/61 (83%)
 Frame = -1

Query: 600 GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           GKT+TLE EPSDT ENVK KIQDKEGI P+QQ L F G  LEDGRT SDYNIQK+STL+L
Sbjct: 2   GKTVTLEAEPSDTTENVKTKIQDKEGILPSQQCLAFVGTHLEDGRTRSDYNIQKKSTLNL 61

Query: 420 V 418
           +
Sbjct: 62  L 62


>UniRef50_Q0V3T0 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 375

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 46/71 (64%), Positives = 54/71 (76%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           K  IFVKTLTGKTITL     DT+E +K +I+DKEGIP NQ RL FAGKQLEDGRT++ Y
Sbjct: 218 KHVIFVKTLTGKTITLRAHREDTVEVIKCRIEDKEGIPWNQMRLIFAGKQLEDGRTIAHY 277

Query: 450 NIQKESTLHLV 418
            I  E T+H+V
Sbjct: 278 KILYEGTVHVV 288


>UniRef50_UPI0000ECA612 Cluster: UPI0000ECA612 related cluster; n=5;
           Gallus gallus|Rep: UPI0000ECA612 UniRef100 entry -
           Gallus gallus
          Length = 287

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 45/83 (54%), Positives = 63/83 (75%)
 Frame = +1

Query: 403 TTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDL 582
           T++ QHQ++GG LLD+VVR G  IFQLL+SK QPLLI R++ F+L+   HIL+G+   +L
Sbjct: 146 TSQAQHQMQGGLLLDVVVRQGAPIFQLLTSKDQPLLIRRNAFFILDLGLHILNGVTGFNL 205

Query: 583 KGDGLAREGLYENLHLHSPLRCH 651
           +GDGLA +GL+++LH  SP   H
Sbjct: 206 EGDGLASQGLHKDLHA-SPQAQH 227



 Score = 92.7 bits (220), Expect = 7e-18
 Identities = 41/76 (53%), Positives = 58/76 (76%)
 Frame = +1

Query: 400 ATTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLD 579
           A+ + QHQ++GG  LD+VVR G  +FQLL+SK QPLLIGR++ FVL+   HI + +  L+
Sbjct: 69  ASPQTQHQMQGGLFLDVVVRQGAPVFQLLASKDQPLLIGRNAFFVLDLGLHIFNCVTGLN 128

Query: 580 LKGDGLAREGLYENLH 627
           L+GDGLA +G +E+LH
Sbjct: 129 LEGDGLASQGFHEDLH 144



 Score = 89.4 bits (212), Expect = 7e-17
 Identities = 43/76 (56%), Positives = 58/76 (76%)
 Frame = +1

Query: 424 VEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDLKGDGLAR 603
           ++GG LLD+VVR G  +FQLL+SK QPLLI R++ FVL+   HIL+G+  L+L+GDGLA 
Sbjct: 1   MQGGLLLDVVVRQGAPVFQLLASKNQPLLIRRNAFFVLDLGLHILNGVTGLNLEGDGLAS 60

Query: 604 EGLYENLHLHSPLRCH 651
           +GL+E+LH  SP   H
Sbjct: 61  QGLHEDLHA-SPQTQH 75



 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 39/67 (58%), Positives = 53/67 (79%)
 Frame = +1

Query: 400 ATTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLD 579
           A+ + QHQ++GG LLD+VVR G  +FQLL+SK QPLLIGR++  VL+   HIL+G+  L+
Sbjct: 221 ASPQAQHQMQGGLLLDVVVRQGAPVFQLLASKDQPLLIGRNAFLVLDLGLHILNGVTGLN 280

Query: 580 LKGDGLA 600
           L+GDGLA
Sbjct: 281 LEGDGLA 287


>UniRef50_Q9SYF2 Cluster: F15I1.4 protein; n=4; Arabidopsis
           thaliana|Rep: F15I1.4 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 144

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 43/69 (62%), Positives = 54/69 (78%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M IF+KTLTG+T T EV+ SDTI  +KAK ++KEGIP  QQRL F G+ LED + +SDYN
Sbjct: 69  MMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQRLIFQGRVLEDSKAISDYN 128

Query: 447 IQKESTLHL 421
           I+ ESTLH+
Sbjct: 129 IKHESTLHI 137


>UniRef50_Q9SHE7 Cluster: NEDD8-like protein RUB1 precursor; n=19;
           Eukaryota|Rep: NEDD8-like protein RUB1 precursor -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 80

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 41/68 (60%), Positives = 54/68 (79%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I VKTLTGK I +++EP+DTI+ +K ++++KEGIPP QQRL +AGKQL D +T  DYNI+
Sbjct: 3   IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIE 62

Query: 441 KESTLHLV 418
             S LHLV
Sbjct: 63  GGSVLHLV 70


>UniRef50_Q6A1P6 Cluster: Putative uncharacterized protein; n=1;
           Euplotes vannus|Rep: Putative uncharacterized protein -
           Euplotes vannus
          Length = 177

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 61/162 (37%), Positives = 90/162 (55%), Gaps = 2/162 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTG T+T+ V+  DTI  +KAKI ++EGI      L     QLED  T ++  
Sbjct: 1   MQIFVKTLTGATLTMFVDECDTIATMKAKISEQEGIAAESIVLINGLSQLEDQMTFAECE 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           +  E+T+ +             K Y+ P          K+ VL +++VD+NGKI +L++E
Sbjct: 61  LNNEATVTMTLKMLGGKKKKKKKVYTKPKKIPHKHENIKMRVLSYFEVDKNGKIEKLKQE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVFK--DDDK*ISPL 148
            + EQ  AG ++A  +DR +CGK    M +K   D K I+P+
Sbjct: 121 -SPEQ--AGCYLADHKDRMHCGKT-GYMFYKMTADGKRIAPV 158


>UniRef50_Q4Q216 Cluster: Ubiquitin/ribosomal protein S27a,
           putative; n=13; Eukaryota|Rep: Ubiquitin/ribosomal
           protein S27a, putative - Leishmania major
          Length = 152

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 55/152 (36%), Positives = 79/152 (51%), Gaps = 5/152 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKT  G+++ + V   DT+  +KA+    +G       L FAG  L +   L+ Y 
Sbjct: 1   MQIFVKTAAGRSVAVRVSAEDTVGFLKAQANVTQG------NLFFAGMCLAEEEPLAAYG 54

Query: 447 IQKESTLHLVXXXXXXXXXXXXKN-YSTPXXXXXXXXXXKLAVLRFYKVDENG----KIH 283
           + KEST+ +V            K  ++ P          K+  L+++KV EN     K+ 
Sbjct: 55  LSKESTVDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFKVTENDDGSYKVE 114

Query: 282 RLRRECTGEQCGAGVFMAVMEDRHYCGKCHST 187
           R R++C   QCGAGV+MA  +DR YCGKCH T
Sbjct: 115 RTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLT 146


>UniRef50_Q6ZCA5 Cluster: Monoubiquitin/carboxy-extension protein
           fusion-like; n=2; Oryza sativa|Rep:
           Monoubiquitin/carboxy-extension protein fusion-like -
           Oryza sativa subsp. japonica (Rice)
          Length = 212

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 43/69 (62%), Positives = 53/69 (76%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFV+T+T   + +EV P DT+  VKAKIQ K GIP  QQRL FAG+ LEDGRTL++Y 
Sbjct: 1   MQIFVRTVTAGPLAVEVNPWDTVGKVKAKIQAKGGIPAAQQRLMFAGRHLEDGRTLAEYG 60

Query: 447 IQKESTLHL 421
           I+KE+ LHL
Sbjct: 61  IKKEANLHL 69


>UniRef50_A0C9Z8 Cluster: Chromosome undetermined scaffold_160,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_160,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 226

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 43/48 (89%), Positives = 46/48 (95%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAG 487
           KMQIFVKTLTGKTITL+VEPSDTI+ VKAKIQDKEGIPP+QQRL FAG
Sbjct: 179 KMQIFVKTLTGKTITLDVEPSDTIDAVKAKIQDKEGIPPDQQRLIFAG 226


>UniRef50_P62979 Cluster: 40S ribosomal protein S27a; n=188;
           root|Rep: 40S ribosomal protein S27a - Homo sapiens
           (Human)
          Length = 80

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 44/73 (60%), Positives = 51/73 (69%), Gaps = 1/73 (1%)
 Frame = -1

Query: 378 NYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGK 199
           +Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   DRHYCGK
Sbjct: 8   SYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGK 67

Query: 198 CHSTMVF-KDDDK 163
           C  T  F K +DK
Sbjct: 68  CCLTYCFNKPEDK 80


>UniRef50_Q9VJ33 Cluster: NEDD8 precursor; n=546; root|Rep: NEDD8
           precursor - Drosophila melanogaster (Fruit fly)
          Length = 84

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 38/70 (54%), Positives = 54/70 (77%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D ++ +K ++++KEGIPP QQRL F+GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYK 60

Query: 447 IQKESTLHLV 418
           +Q  S LHLV
Sbjct: 61  VQGGSVLHLV 70


>UniRef50_Q5CQW0 Cluster: Ribosomal protein S27a, ubiquitin plus
           zincribbon, UB13p; n=2; Cryptosporidium|Rep: Ribosomal
           protein S27a, ubiquitin plus zincribbon, UB13p -
           Cryptosporidium parvum Iowa II
          Length = 159

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 55/148 (37%), Positives = 80/148 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           KMQIF +   G T +LEV+P+ +++ ++  I +  GI  + Q + +    L++  TL   
Sbjct: 3   KMQIFFRYGLGNTRSLEVDPTMSVKELRHIISEFSGISIDSQCISYGFGILDEFETLEQA 62

Query: 450 NIQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRR 271
            I   STL+ V            KN++ P          KLAVL++YKVD + K+ +LRR
Sbjct: 63  GISDYSTLY-VSEAMLGGAKKKKKNFTKPKKIKHKKKKVKLAVLKYYKVDGD-KVVKLRR 120

Query: 270 ECTGEQCGAGVFMAVMEDRHYCGKCHST 187
           EC  E CGAGVFMA   +R  CG+C  T
Sbjct: 121 ECPAETCGAGVFMAQHFNRTSCGRCGLT 148


>UniRef50_Q15843 Cluster: NEDD8 precursor; n=1233; root|Rep: NEDD8
           precursor - Homo sapiens (Human)
          Length = 81

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 38/70 (54%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D +E +K ++++KEGIPP QQRL ++GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK 60

Query: 447 IQKESTLHLV 418
           I   S LHLV
Sbjct: 61  ILGGSVLHLV 70


>UniRef50_Q8IM64 Cluster: Ribosomal S27a, putative; n=6;
           Plasmodium|Rep: Ribosomal S27a, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 149

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 53/151 (35%), Positives = 76/151 (50%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I +     +++ LE    + I+NVK +I + +GIP   Q+L   G+ LED   L    
Sbjct: 1   MKILINIPYDESLCLESSNINNIKNVKEQIFELKGIPYELQKLYKNGRHLEDEELLEIDK 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
                TL+L             K Y  P          KLAVL+FYKV ++GK+ RL+R+
Sbjct: 61  SDYAYTLNLNFGLLGGAKKKKKKVYKKPKKEKHKKKKVKLAVLKFYKVGDDGKVFRLKRQ 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVFK 175
           C  + C  G  MA   DR YCG+CH T++ K
Sbjct: 121 C--DNCAPGTLMASHFDRDYCGRCHLTIMKK 149


>UniRef50_Q54V68 Cluster: Putative uncharacterized protein; n=3;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 314

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 42/68 (61%), Positives = 52/68 (76%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I+VKTL+GKTI    + S  IE +K+ I   +GI  +QQRL +AGKQLEDGR+L +YNIQ
Sbjct: 68  IYVKTLSGKTIDFPFQSSMLIETLKSMIFKNQGILEDQQRLLYAGKQLEDGRSLFEYNIQ 127

Query: 441 KESTLHLV 418
           KESTLHLV
Sbjct: 128 KESTLHLV 135


>UniRef50_Q00UH7 Cluster: Polyubiquitin 2; n=1; Ostreococcus
           tauri|Rep: Polyubiquitin 2 - Ostreococcus tauri
          Length = 124

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 35/67 (52%), Positives = 49/67 (73%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R    I VKTLTGK I +++EP+D++E +K ++++KEGIPP QQRL F GKQ+ D +   
Sbjct: 25  RTSQMIKVKTLTGKEIEIDIEPTDSVERIKERVEEKEGIPPVQQRLIFGGKQMNDEKIAK 84

Query: 456 DYNIQKE 436
           DYNI+ E
Sbjct: 85  DYNIEVE 91


>UniRef50_Q236S9 Cluster: Ubiquitin family protein; n=2;
           Alveolata|Rep: Ubiquitin family protein - Tetrahymena
           thermophila SB210
          Length = 2194

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 37/69 (53%), Positives = 50/69 (72%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q++ K LTG  + L+ E  DTI N+K +IQD+ G PPNQQR  FAGK LED RT+ DYN+
Sbjct: 717 QLYAKALTGHIVILDAESDDTILNLKTQIQDQIGFPPNQQRFLFAGKILEDERTVGDYNM 776

Query: 444 QKESTLHLV 418
           +  ST++L+
Sbjct: 777 KTGSTINLI 785



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQ+ ++   G+ +   V+PS  I ++K  I  K  I    Q L FAG ++ + +TLSDY+
Sbjct: 935  MQVSIEFQNGEKLKFNVQPSHKILDIKEMIFKKTNINVKDQSLKFAGNEMINQKTLSDYS 994

Query: 447  I---QKESTLHL 421
            I    +E TLHL
Sbjct: 995  IIDSTEEFTLHL 1006



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 4/65 (6%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRT----LS 457
           +I  K   G+T  +EV+  DT+ NV+  IQ   GI   +Q L +  + L   +T    L 
Sbjct: 357 EIKFKLQNGETYFIEVKKKDTLNNVQIAIQKTTGIQQEEQILVYKDQILNHDQTFLKQLI 416

Query: 456 DYNIQ 442
           DY+IQ
Sbjct: 417 DYSIQ 421


>UniRef50_A6RQL0 Cluster: Ubiquitin; n=2; Sclerotiniaceae|Rep:
           Ubiquitin - Botryotinia fuckeliana B05.10
          Length = 77

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 38/70 (54%), Positives = 52/70 (74%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I V+TLTGK I L+VE  + IE VK K+++KEGIPP QQRL + GKQ+ D + + DY+
Sbjct: 1   MLIKVRTLTGKEIELDVEADNKIERVKEKVEEKEGIPPVQQRLIYGGKQMADDKLVQDYD 60

Query: 447 IQKESTLHLV 418
           ++  +TLHLV
Sbjct: 61  LEPGATLHLV 70


>UniRef50_Q9FWU7 Cluster: Putative polyubiquitin; n=3; Oryza
           sativa|Rep: Putative polyubiquitin - Oryza sativa subsp.
           japonica (Rice)
          Length = 307

 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 39/70 (55%), Positives = 53/70 (75%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +MQI V  L G T TL VEPSDT+E+VK ++Q+K+G+PP QQRL F G+QL+DG T++  
Sbjct: 69  EMQILVSGLRGNTWTLWVEPSDTVESVKLQLQEKDGLPPCQQRLIFEGRQLDDGDTVASC 128

Query: 450 NIQKESTLHL 421
            I+K S L+L
Sbjct: 129 GIRKHSYLNL 138



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 37/73 (50%), Positives = 53/73 (72%), Gaps = 3/73 (4%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTIT-LEVEPSDTIENVKAKI--QDKEGIPPNQQRLXFAGKQLEDGRTL 460
           +MQIFV+ L GK  T L+V+PSDT+ +VK K+  + K+   P +QRL F+G +L D RTL
Sbjct: 174 EMQIFVRVLGGKKATALKVQPSDTVGSVKVKLYYRKKKKTMPCKQRLVFSGMELADDRTL 233

Query: 459 SDYNIQKESTLHL 421
           + Y I++ESTL+L
Sbjct: 234 ASYGIEEESTLYL 246



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 37/69 (53%), Positives = 48/69 (69%), Gaps = 3/69 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLE--DG-RTLS 457
           MQI V  +TG T+TLEVEPSDT+E+VKAKI+   GI      L + GKQ++  DG RTL+
Sbjct: 1   MQIPVDLITGATLTLEVEPSDTVESVKAKIKAMSGI-TEDFGLAYDGKQMDEADGHRTLA 59

Query: 456 DYNIQKEST 430
           DY I+  +T
Sbjct: 60  DYGIRDPAT 68


>UniRef50_Q5X991 Cluster: BUBL1 protein; n=2; Paramecium
           tetraurelia|Rep: BUBL1 protein - Paramecium tetraurelia
          Length = 862

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 41/71 (57%), Positives = 53/71 (74%), Gaps = 1/71 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSD-TIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           K  I +KTLTGKT+TLE+   D +IE +K  IQ++EGIPP+QQRL F G  L+DG+ L +
Sbjct: 134 KWIIIIKTLTGKTLTLEINNKDMSIEQLKMLIQNREGIPPDQQRLIFEGILLQDGKMLWE 193

Query: 453 YNIQKESTLHL 421
           YNI  ESTL+L
Sbjct: 194 YNIGPESTLYL 204



 Score = 39.5 bits (88), Expect = 0.069
 Identities = 20/65 (30%), Positives = 37/65 (56%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           +IF++ + G     E+ P   ++N+K  I+ K+GIP   Q+L + G  ++D  +L DY +
Sbjct: 354 KIFIQ-INGFNEEFEILPYFLVQNLKVIIEKKKGIPMIDQQLYYQGILMKDHFSLEDYKL 412

Query: 444 QKEST 430
            +  T
Sbjct: 413 LQNGT 417


>UniRef50_A2Q424 Cluster: Ubiquitin; TRAF-like; n=2; Medicago
           truncatula|Rep: Ubiquitin; TRAF-like - Medicago
           truncatula (Barrel medic)
          Length = 343

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 41/67 (61%), Positives = 49/67 (73%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+IFV  LTG+TITLEV   DTI +VK KI D+       QRL FAGKQL+D RT++DYN
Sbjct: 268 MRIFVNLLTGETITLEVNSLDTICSVKEKILDETEYSMQSQRLIFAGKQLDDSRTVADYN 327

Query: 447 IQKESTL 427
           IQ EST+
Sbjct: 328 IQNESTI 334


>UniRef50_O44819 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 292

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 36/71 (50%), Positives = 51/71 (71%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           K+ + VKTL GKTI + ++ +DT+E +K K+Q+K G+PP+QQRL F   QLE+ R L  Y
Sbjct: 160 KLTVSVKTLFGKTIPISIKNTDTVETLKFKVQNKHGVPPDQQRLIFGRAQLENDRALFAY 219

Query: 450 NIQKESTLHLV 418
           NI+ E  +HLV
Sbjct: 220 NIRDEDIIHLV 230



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 23/62 (37%), Positives = 34/62 (54%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           +TG  IT  VE SD I+++  K+ + +  P     +       +D RT+SDYNI+  STL
Sbjct: 98  VTGDPIT--VEASDAIKDLNFKVAEAQRKPHQPSNIVLC----KDQRTISDYNIKNGSTL 151

Query: 426 HL 421
            L
Sbjct: 152 RL 153



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI 520
           M + VKT TGKTIT+E       +NVK +++DK+G+
Sbjct: 59  MLLSVKTSTGKTITVEAP-----KNVKTEVRDKQGV 89


>UniRef50_A2EJ38 Cluster: Ubiquitin family protein; n=4; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 457

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 40/70 (57%), Positives = 53/70 (75%), Gaps = 1/70 (1%)
 Frame = -1

Query: 624 QIFVKTLTGKTITL-EVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           QIFVKTLTGK IT+ +V     + ++  KIQDKEGIP +QQRL +AG QL++ +++  Y 
Sbjct: 180 QIFVKTLTGKHITVPDVGEDLRVLDIMYKIQDKEGIPMDQQRLVYAGAQLDEDKSIGYYK 239

Query: 447 IQKESTLHLV 418
           IQK+STLHLV
Sbjct: 240 IQKDSTLHLV 249


>UniRef50_Q99351 Cluster: D.melanogaster polytene; n=5; Drosophila
           melanogaster|Rep: D.melanogaster polytene - Drosophila
           melanogaster (Fruit fly)
          Length = 152

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 36/75 (48%), Positives = 53/75 (70%)
 Frame = +1

Query: 403 TTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDL 582
           TT+ ++QV+GG LLD+V+  G S+   L+ + Q LLI  DSL +LN   HIL+G+  L L
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASVXXXLAGEDQTLLIWGDSLLILNLGLHILNGVRWLYL 76

Query: 583 KGDGLAREGLYENLH 627
           +GDGL+ + L+E+LH
Sbjct: 77  EGDGLSGQSLHEDLH 91



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/58 (39%), Positives = 28/58 (48%)
 Frame = +3

Query: 408 EASTPGGGWIPSGYCSPXGYVHLPAAFQQXSTSVDWEGFPLCLEF*LSHSRWYLTARP 581
           E   P  GW PSG C+  G VH  AA ++ S + D   FP   E    HS+W   A P
Sbjct: 95  ETXEPSEGWTPSGCCNRTGCVHPQAACRRRSDAADLGEFPPYPESWPLHSQWCPMALP 152


>UniRef50_A7F3U9 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 418

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 39/72 (54%), Positives = 49/72 (68%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           + +Q+F KTLTGKTI   V   +TIE +K  +   EGIP NQQRL F GKQLED  TL D
Sbjct: 181 LNLQVFFKTLTGKTIYTSVGSRETIELLKDSVFIIEGIPANQQRLIFGGKQLEDQDTLWD 240

Query: 453 YNIQKESTLHLV 418
            NI + +T+H+V
Sbjct: 241 CNIAEGATIHMV 252


>UniRef50_Q2HDX3 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 104

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 35/66 (53%), Positives = 46/66 (69%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           V+TLTGK I L+VE SD +  +K  +++KEGIPP QQRL   GKQ+ D +T  DY +   
Sbjct: 32  VRTLTGKEIELDVEGSDQVSKIKDLVEEKEGIPPAQQRLIHGGKQMVDDKTADDYALVGG 91

Query: 435 STLHLV 418
           +TLHLV
Sbjct: 92  ATLHLV 97


>UniRef50_Q03919 Cluster: NEDD8-like protein RUB1 precursor; n=8;
           Eukaryota|Rep: NEDD8-like protein RUB1 precursor -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 77

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 34/70 (48%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + VKTLTGK I++E++ SD + ++K  +++KEGIPP+QQRL F GKQ++D  T++D +
Sbjct: 1   MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAH 60

Query: 447 IQKESTLHLV 418
           + +   LHLV
Sbjct: 61  LVEGMQLHLV 70


>UniRef50_A4VDK0 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 591

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 35/69 (50%), Positives = 53/69 (76%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           QI++K+LTG+  T++ E SDTIEN++ KIQDK+GI  +QQRL +  KQL+D +TL++  +
Sbjct: 312 QIYIKSLTGEIFTIDCECSDTIENLQLKIQDKKGIHRDQQRLIYDNKQLDDKKTLNECGL 371

Query: 444 QKESTLHLV 418
            +E TL L+
Sbjct: 372 FQEDTLLLL 380


>UniRef50_A2FSJ6 Cluster: Ubiquitin family protein; n=2; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 76

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 28/70 (40%), Positives = 50/70 (71%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ +K + G  +  E++  D +E++KAKIQ +EG+P NQQ L ++G +L +G T+ DY+
Sbjct: 1   MQVLIKKIIGNPVAYEIDNYDRVEDIKAKIQAQEGVPLNQQDLIYSGMRLINGSTIQDYS 60

Query: 447 IQKESTLHLV 418
           +++  T+HL+
Sbjct: 61  LKRNDTIHLI 70


>UniRef50_UPI00006CAF49 Cluster: Ribosomal protein S27a containing
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ribosomal protein S27a containing protein - Tetrahymena
           thermophila SB210
          Length = 189

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 46/148 (31%), Positives = 71/148 (47%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VKTL G+T    +E   ++ ++K++I    G   +   L   G    +   ++D  
Sbjct: 1   MQVQVKTLEGETKIYTLEQGTSVLDLKSQISQDMGFEIDMMTLVNNGFIAPNTELVTD-- 58

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
              + T +L             K+Y+T           KL  L FYK++ NGK+   ++ 
Sbjct: 59  ---DVTYYLSLKLLGGKKKKKKKSYTTKKKTKHRHVHTKLGALAFYKLENNGKVSLQQKG 115

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTM 184
           C   +CG G+FMA   DRHYCGKCH T+
Sbjct: 116 CP--KCGPGIFMAKHYDRHYCGKCHLTL 141


>UniRef50_Q4U8U0 Cluster: S27 ribosomal protein, putative; n=3;
           Piroplasmida|Rep: S27 ribosomal protein, putative -
           Theileria annulata
          Length = 162

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 48/148 (32%), Positives = 70/148 (47%), Gaps = 2/148 (1%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+ V    G+T     +   TI  +K+ +  +  +      +     +L+D   LSD  +
Sbjct: 10  QVLVNLFNGRTAVFGSDKYKTIGQIKSYLLSQYTLDNINHSIWHGLNELDDELELSDLLV 69

Query: 444 QKESTLHLVXXXXXXXXXXXXKN--YSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRR 271
             EST+ L             K   Y+TP          KLAVL++YKVD + K+ RL +
Sbjct: 70  D-ESTISLDHHLELLGGGKKRKKKQYTTPKKVKHKKKKVKLAVLKYYKVDGD-KVVRLLK 127

Query: 270 ECTGEQCGAGVFMAVMEDRHYCGKCHST 187
           +C GE CG GVFMA   +R YCG+C  T
Sbjct: 128 DCPGENCGRGVFMAAHNNRTYCGRCQLT 155


>UniRef50_UPI0000604492 Cluster: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1; n=1;
           Mus musculus|Rep: PREDICTED: similar to ubiquitin A-52
           residue ribosomal protein fusion product 1 - Mus
           musculus
          Length = 177

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 41/71 (57%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG-RTLSDY 451
           +Q F+ TLTGK I L +EPS+TIENVK KIQD+ GIP     L    +Q   G  TLSDY
Sbjct: 38  LQNFMTTLTGKPIILVIEPSNTIENVKVKIQDEGGIP-----LDHPHQQTSGGCHTLSDY 92

Query: 450 NIQKESTLHLV 418
            IQ+ESTLHL+
Sbjct: 93  GIQEESTLHLM 103


>UniRef50_Q54V65 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 226

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 36/67 (53%), Positives = 48/67 (71%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I+VKTL  KTI+L  + S ++  +K+ I  KEGI  NQQ L FAGK +ED +++SDY I 
Sbjct: 18  IYVKTLGVKTISLPFKSSMSVTTLKSLIYTKEGIEVNQQALVFAGKPMEDCKSISDYYIH 77

Query: 441 KESTLHL 421
           KEST+HL
Sbjct: 78  KESTIHL 84


>UniRef50_A7APS7 Cluster: Ubiquitin family protein; n=1; Babesia
           bovis|Rep: Ubiquitin family protein - Babesia bovis
          Length = 163

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + V+T+ G+ I +EV+P+DT+   K K+  K+ +P +QQR+ + GK L+D +TL++YN
Sbjct: 88  MTVQVQTMLGQKIEVEVDPNDTVLEFKKKLSKKQKLPVDQQRIIYQGKMLQDHKTLAEYN 147

Query: 447 IQKESTLHLV 418
           IQ  + +H+V
Sbjct: 148 IQNNAVIHMV 157


>UniRef50_UPI0000E475A1 Cluster: PREDICTED: similar to ubiquitin;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to ubiquitin - Strongylocentrotus purpuratus
          Length = 494

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 34/67 (50%), Positives = 46/67 (68%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQI+V+ L GK+ +  V  SDT  N+K ++  K GIPPN QRL F  KQL+D  TL +Y 
Sbjct: 197 MQIWVRDLQGKSQSFHVHLSDTTNNLKRQVYKKIGIPPNIQRLVFGCKQLQDSWTLKEYG 256

Query: 447 IQKESTL 427
           I+K+ST+
Sbjct: 257 IRKQSTI 263



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 32/69 (46%), Positives = 47/69 (68%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +QI+V+ L GK+ ++ V  SDT + +K ++  K GIPPN QRL + GKQ+E   TL +YN
Sbjct: 121 VQIWVRDLEGKSQSIHVRLSDTADALKRQVDKKTGIPPNVQRLIYQGKQMEGSTTLEEYN 180

Query: 447 IQKESTLHL 421
           I + ST+ L
Sbjct: 181 IGQHSTIEL 189



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 26/69 (37%), Positives = 44/69 (63%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +QI+V+ L  K+ +  V  SDT + +K +++ K  IPPN Q L + GK LE  + L +Y 
Sbjct: 421 LQIWVRDLRSKSHSFHVRMSDTADALKRQVEKKICIPPNVQVLIYNGKLLEGSKALEEYG 480

Query: 447 IQKESTLHL 421
           ++++ST+ L
Sbjct: 481 MRRDSTIEL 489


>UniRef50_Q7T2M6 Cluster: Ubquitin-like protein 1; n=1; Carassius
           auratus|Rep: Ubquitin-like protein 1 - Carassius auratus
           (Goldfish)
          Length = 155

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 31/68 (45%), Positives = 48/68 (70%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+FVK   G+T T +VE ++T++ ++ KI  K+G+P +QQRL + G+QLE G  L DY+I
Sbjct: 81  QVFVKNEKGQTKTYDVEVNETVDQLQTKIFRKDGVPKDQQRLIYNGRQLEAGMKLQDYDI 140

Query: 444 QKESTLHL 421
              ST+H+
Sbjct: 141 TSGSTIHM 148


>UniRef50_Q91890 Cluster: Ubiquitin-like fusion protein; n=6;
           Eumetazoa|Rep: Ubiquitin-like fusion protein - Xenopus
           laevis (African clawed frog)
          Length = 701

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 34/70 (48%), Positives = 47/70 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VK+KIQ  EGIP  QQ L +   +LED  +LSDYN
Sbjct: 28  MELFIETLTGTCFELRVSPYETVTSVKSKIQRLEGIPVAQQHLIWNNMELEDECSLSDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL +V
Sbjct: 88  ISEGCTLKMV 97


>UniRef50_Q013L7 Cluster: Glucose-repressible alcohol dehydrogenase
           transcriptional effector CCR4 and related proteins; n=2;
           Ostreococcus|Rep: Glucose-repressible alcohol
           dehydrogenase transcriptional effector CCR4 and related
           proteins - Ostreococcus tauri
          Length = 866

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query: 403 TTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDL 582
           T++ QHQVE   LLD+V+R   ++ +LL  + Q LLI RD+L +L+   H++DG+  L L
Sbjct: 687 TSQAQHQVERRLLLDVVIRQRAAVLELLPRENQTLLIRRDALLILDLRLHVVDGVRGLHL 746

Query: 583 KGDGLAREGLYENL-HL 630
           +GDGL    + EN+ HL
Sbjct: 747 QGDGLTSHCVRENIRHL 763


>UniRef50_UPI0000D56A31 Cluster: PREDICTED: similar to CG15771-PA,
           isoform A; n=2; Endopterygota|Rep: PREDICTED: similar to
           CG15771-PA, isoform A - Tribolium castaneum
          Length = 309

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/60 (50%), Positives = 42/60 (70%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           V TLTG+   ++VEP+D I  +K K++++EGIPP QQRL   GKQL+D RT+  Y  + E
Sbjct: 72  VVTLTGEEKQIDVEPTDKIITIKEKLEEREGIPPEQQRLIHQGKQLKDDRTIESYKFRGE 131


>UniRef50_A0C2N0 Cluster: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 77

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 28/70 (40%), Positives = 47/70 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIF+KTL GK ++  +E  +TI+ +K ++Q+KEGI   Q +L F G+ L++   ++D  
Sbjct: 1   MQIFIKTLAGKKVSYNIEADNTIQQLKMQLQEKEGISSEQFKLIFKGRHLQEDNKIADAQ 60

Query: 447 IQKESTLHLV 418
           +Q   T+H+V
Sbjct: 61  MQAGDTVHMV 70


>UniRef50_Q7T2M5 Cluster: Ubquitin-like protein 2; n=8;
           Clupeocephala|Rep: Ubquitin-like protein 2 - Carassius
           auratus (Goldfish)
          Length = 161

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 29/68 (42%), Positives = 47/68 (69%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+FVK   G+  T +V+ ++T++ ++ KI  KE +P +QQRL ++GKQLE G+ L DYNI
Sbjct: 87  QVFVKNEKGQVKTYDVDVNETVDQLQTKIFQKERVPNDQQRLIYSGKQLEAGKKLQDYNI 146

Query: 444 QKESTLHL 421
              S +++
Sbjct: 147 TSGSIIYM 154



 Score = 41.5 bits (93), Expect = 0.017
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFA-GKQL---EDGRTL 460
           M++ +K L G   +LEV  + T+  +K  I     +PPN+Q+L    G ++   +D R+L
Sbjct: 1   MELKIKLLNGDVRSLEVRDNATVGELKQLISHHFNVPPNKQKLSGENGHRISLEDDSRSL 60

Query: 459 SDYNIQKESTLHLV 418
           S Y +  +S + L+
Sbjct: 61  SSYGLHSDSVVMLL 74


>UniRef50_Q4UDK2 Cluster: Ubiquitin,putative; n=2; Theileria|Rep:
           Ubiquitin,putative - Theileria annulata
          Length = 170

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/70 (42%), Positives = 50/70 (71%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+T+ GK I L+V  ++T+ ++K K++ ++ IP +QQRL F GK LE+G+T++DY 
Sbjct: 95  LNISVQTMQGKRIQLQVSQNETVLDLKNKLEKEQTIPVDQQRLIFDGKLLENGKTIADYG 154

Query: 447 IQKESTLHLV 418
           I+  + L LV
Sbjct: 155 IKDNAVLQLV 164


>UniRef50_Q22X50 Cluster: Ubiquitin family protein; n=2; Tetrahymena
           thermophila SB210|Rep: Ubiquitin family protein -
           Tetrahymena thermophila SB210
          Length = 745

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/71 (42%), Positives = 50/71 (70%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ I +KTLTG+T+ L+ + +  +E +K +I ++  I P QQRL +AG+QLED + L  Y
Sbjct: 366 EISINIKTLTGQTLALKCKLNQKVEQLKNQISEQLEISPTQQRLIYAGQQLEDDQQLYFY 425

Query: 450 NIQKESTLHLV 418
           N+Q++  +HLV
Sbjct: 426 NLQRDCVVHLV 436



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I +KTLTGK I L+ +  D++E +K  IQD EGIP +QQRL F GK++E+  +L  Y 
Sbjct: 464 LNIQIKTLTGKQIQLKCKLYDSVEILKYHIQDSEGIPIDQQRLIFQGKEIENDYSLDMYE 523

Query: 447 IQKESTLHLV 418
           I     ++LV
Sbjct: 524 IDDGDIINLV 533



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/71 (33%), Positives = 42/71 (59%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +M + +K+L+G    L  + ++TI+ +K K+     +     +L F G+QLED  TL++Y
Sbjct: 279 EMILTIKSLSGAQYDLGADGNNTIDQIKQKLSSLSEVECEFMKLIFCGRQLEDNFTLNNY 338

Query: 450 NIQKESTLHLV 418
            I+  S +HLV
Sbjct: 339 EIKDGSIIHLV 349


>UniRef50_Q5MGJ9 Cluster: Ribosomal protein 3; n=1; Lonomia
           obliqua|Rep: Ribosomal protein 3 - Lonomia obliqua
           (Moth)
          Length = 42

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/40 (70%), Positives = 34/40 (85%)
 Frame = -1

Query: 234 MAVMEDRHYCGKCHSTMVFKDDDK*ISPL*PVRNARDCCV 115
           MAVMEDRHYCGKCHSTMVFKDDD  +SPL  ++++R  C+
Sbjct: 1   MAVMEDRHYCGKCHSTMVFKDDDNRLSPL-SLKDSRPLCM 39


>UniRef50_UPI00006CB3CF Cluster: Ubiquitin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Ubiquitin family
           protein - Tetrahymena thermophila SB210
          Length = 480

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I    L+   I +E E +D ++ VK  +Q K  +P  +QR+ FAGKQLED R L+ Y 
Sbjct: 23  LKIIQLLLSNPDIFMECECTDNVQRVKELVQIKLNMPIERQRIIFAGKQLEDHRILAGYG 82

Query: 447 IQKESTLHLV 418
           IQKESTL++V
Sbjct: 83  IQKESTLYVV 92


>UniRef50_Q86XD8 Cluster: AN1-type zinc finger and ubiquitin
           domain-containing protein 1; n=30; Eumetazoa|Rep:
           AN1-type zinc finger and ubiquitin domain-containing
           protein 1 - Homo sapiens (Human)
          Length = 727

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VKAKI+  EGIP  +Q L +   +LE+   L+DYN
Sbjct: 28  MELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  ISEGCTLKLV 97


>UniRef50_UPI0001554F34 Cluster: PREDICTED: similar to AN1,
           ubiquitin-like, homolog; n=2; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to AN1, ubiquitin-like,
           homolog - Ornithorhynchus anatinus
          Length = 728

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 32/70 (45%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +F++TLTG    L+V P +T+ +VKAKIQ  EGIP  QQ L +   +LED   L+DYN
Sbjct: 54  MDLFIETLTGTCFELQVSPFETVISVKAKIQRLEGIPICQQHLIWNNVELEDDYCLNDYN 113

Query: 447 IQKESTLHLV 418
           +   S    V
Sbjct: 114 VSLASCFRQV 123


>UniRef50_Q95TI4 Cluster: SD01679p; n=10; Endopterygota|Rep:
           SD01679p - Drosophila melanogaster (Fruit fly)
          Length = 482

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+   +
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH +
Sbjct: 90  LGQQSVLHAI 99


>UniRef50_Q5C0U3 Cluster: SJCHGC08803 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08803 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 193

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 31/70 (44%), Positives = 45/70 (64%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M IF++TLTG +  + V P++T+ +VK +IQ   GIP  QQ L +   +L+D   L DY+
Sbjct: 3   MGIFIETLTGSSFKVRVSPTETVVSVKFEIQRAGGIPITQQHLIWQNNELDDHCCLKDYS 62

Query: 447 IQKESTLHLV 418
           I + STL LV
Sbjct: 63  ISEGSTLRLV 72


>UniRef50_Q0C9H7 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus terreus NIH2624|Rep: Putative
           uncharacterized protein - Aspergillus terreus (strain
           NIH 2624)
          Length = 115

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 25/56 (44%), Positives = 40/56 (71%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           L+    + +  +K ++++KEGIPP QQRL F GKQ+ D +T ++YN++  +TLHLV
Sbjct: 53  LQTTTENIVSRIKERVEEKEGIPPVQQRLIFGGKQMADDKTAAEYNLEGGATLHLV 108


>UniRef50_Q4RSW8 Cluster: Chromosome 12 SCAF14999, whole genome
           shotgun sequence; n=3; Percomorpha|Rep: Chromosome 12
           SCAF14999, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 158

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/69 (39%), Positives = 43/69 (62%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+ +KT  GK    +V+P + +   K K+Q KE +  +QQRL   G+++ DG  LSDY +
Sbjct: 84  QVLLKTQDGKLSKYDVKPDEAVTEFKKKVQTKERVQASQQRLLHQGREMMDGYKLSDYGV 143

Query: 444 QKESTLHLV 418
           Q +ST+ L+
Sbjct: 144 QNQSTIELM 152


>UniRef50_P11441 Cluster: Ubiquitin-like protein 4A; n=32;
           Euteleostomi|Rep: Ubiquitin-like protein 4A - Homo
           sapiens (Human)
          Length = 157

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>UniRef50_Q9FH07 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, TAC clone:K5J14; n=2; Arabidopsis
           thaliana|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, TAC clone:K5J14 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 902

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 27/70 (38%), Positives = 45/70 (64%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +KTL  +T T +V  ++T+   K KI  + G+P  QQRL F G+ L+D   LS+Y+
Sbjct: 47  LELNIKTLDSRTYTFQVNKNETVLLFKEKIASETGVPVGQQRLIFRGRVLKDDHPLSEYH 106

Query: 447 IQKESTLHLV 418
           ++   TLHL+
Sbjct: 107 LENGHTLHLI 116


>UniRef50_Q54MD2 Cluster: Putative uncharacterized protein; n=3;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 312

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/67 (41%), Positives = 44/67 (65%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I +K L G++  L+V+ S+ ++N+K KI+ K  +P   Q L + GK+LED   +SDYNI 
Sbjct: 68  IIIKPLNGESFWLQVKESELVKNIKGKIRYKIDLPVRFQTLYYCGKKLEDDHLISDYNIT 127

Query: 441 KESTLHL 421
             ST+H+
Sbjct: 128 YGSTIHM 134


>UniRef50_A2Z8U3 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 204

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 3/64 (4%)
 Frame = -1

Query: 603 TGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQL--EDG-RTLSDYNIQKES 433
           TG  +TLEVEPS+T++ +K KIQDKEGI  +   L  AG++L  EDG   L+DY +Q ES
Sbjct: 41  TGTIVTLEVEPSNTVKILKEKIQDKEGIMQSDFWLHHAGERLAEEDGDHLLADYGVQNES 100

Query: 432 TLHL 421
           T+++
Sbjct: 101 TVYI 104


>UniRef50_Q06Z45 Cluster: Interferon stimulated gene 15; n=1; Gadus
           morhua|Rep: Interferon stimulated gene 15 - Gadus morhua
           (Atlantic cod)
          Length = 158

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG-RTLSDY 451
           +Q+F+ T+ G+  T  V P +T+   K K++ +E +  +QQRL    KQ++DG RTL  Y
Sbjct: 82  IQVFLTTVNGQIHTYTVRPGETVAGFKLKVKQREKVAEDQQRLMHESKQMDDGSRTLESY 141

Query: 450 NIQKESTLHL 421
           N+++ ST++L
Sbjct: 142 NVKEGSTIYL 151


>UniRef50_Q4UIY1 Cluster: Ubiquitin-related chaperonin, putative;
           n=2; Theileria|Rep: Ubiquitin-related chaperonin,
           putative - Theileria annulata
          Length = 319

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 29/70 (41%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I VK   G+T TL+VEP  T+  +K K  DK   P ++QRL F G+ ++D   LS  N
Sbjct: 3   LNITVKVSGGETFTLDVEPEMTVLQLKEKCSDKANAPADKQRLIFKGRIIKDEEVLSALN 62

Query: 447 IQKESTLHLV 418
           ++  +T+HLV
Sbjct: 63  VEDGNTIHLV 72


>UniRef50_A2FER2 Cluster: Ubiquitin family protein; n=3; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +I++K+L G   TL+ V  + TIE++K  I  K G+ P  QRL FAGKQ+ED  TL DYN
Sbjct: 215 EIYIKSLPGNIDTLKGVSLNMTIEDLKIFIDYKLGVYPESQRLIFAGKQMEDENTLMDYN 274

Query: 447 IQKESTLHL 421
           +    T++L
Sbjct: 275 VHDGDTINL 283


>UniRef50_Q4SKY0 Cluster: Chromosome 17 SCAF14563, whole genome
           shotgun sequence; n=3; Euteleostomi|Rep: Chromosome 17
           SCAF14563, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 695

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/70 (44%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++F++TLTG    L V P + + +VKAKIQ  EGIP  QQ L +   +L+D   L DY 
Sbjct: 28  IELFIETLTGTCFELRVLPFEAVVSVKAKIQRLEGIPVAQQHLIWNNLELDDEHCLHDYG 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  IAEGCTLKLV 97


>UniRef50_Q4CNV2 Cluster: Ubiquitin, putative; n=2; Trypanosoma|Rep:
           Ubiquitin, putative - Trypanosoma cruzi
          Length = 78

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITL-EVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M + VKT++ K I +  +   +TI  +K K+++ EGIP    RL + GKQLEDG+ + +Y
Sbjct: 1   MLVKVKTVSNKVIEVASLNEENTIAELKEKLEESEGIPGKMIRLVYQGKQLEDGKRIKEY 60

Query: 450 NIQKESTLHLV 418
            I   +TLH+V
Sbjct: 61  PIAAGATLHMV 71


>UniRef50_UPI0000D56CAF Cluster: PREDICTED: similar to AN1,
           ubiquitin-like, homolog; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to AN1, ubiquitin-like, homolog -
           Tribolium castaneum
          Length = 563

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 29/70 (41%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I + TL G +  + V  +DT+  +K +IQ  EGIP +QQ L F  K+L+D R L D  
Sbjct: 15  MEIQIDTLMGTSFDMRVSATDTVREIKQRIQRVEGIPIHQQNLIFQSKELKDSRRLCDAG 74

Query: 447 IQKESTLHLV 418
           I+  S + LV
Sbjct: 75  IKNGSIIKLV 84


>UniRef50_A2G7G9 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 76

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I+V T++G+   LEVEPS TI  +K ++  +EGI   QQRL F G+ L D +T+   +
Sbjct: 1   MLIYVHTVSGRKHQLEVEPSITIAAIKEELLQREGISIEQQRLLFRGQNLTDNQTVETAH 60

Query: 447 IQKESTLHLV 418
           I     LH+V
Sbjct: 61  ISAGEVLHMV 70


>UniRef50_Q4MZU6 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 513

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 27/70 (38%), Positives = 44/70 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I  +T+   T + +++ S+T+ NVK+ I+ + GIP + QRL F G  L+D  TL  YN
Sbjct: 3   VNITFRTMDETTFSYDLDSSNTVRNVKSLIEVRNGIPASHQRLIFRGHLLKDDHTLDFYN 62

Query: 447 IQKESTLHLV 418
           I   +T+H+V
Sbjct: 63  ITSGNTIHIV 72


>UniRef50_Q9SU29 Cluster: Polyubiquitin-like protein; n=2; core
           eudicotyledons|Rep: Polyubiquitin-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 873

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/72 (38%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTG-KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           ++QIFV+ ++G KTI +  E  DT+E +  +I+ K  IP  +QR+ + GKQL+   +L+ 
Sbjct: 94  RLQIFVRMMSGGKTIVIHAEKYDTVEKLHQRIEWKTKIPALEQRVIYKGKQLQRENSLTY 153

Query: 453 YNIQKESTLHLV 418
           Y+I+++++L LV
Sbjct: 154 YSIEQDASLQLV 165


>UniRef50_UPI00015B5086 Cluster: PREDICTED: similar to
           ENSANGP00000011460; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000011460 - Nasonia
           vitripennis
          Length = 464

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TG T+ ++++P   I NVK  +  K GI P+  ++ FAGK+L +   + D +
Sbjct: 30  LSIYVKTNTGNTLAVDLDPKWDIRNVKEIVAPKMGISPDDIKIIFAGKELHNSTIIEDCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH V
Sbjct: 90  LGQQSILHAV 99


>UniRef50_A2ECR8 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 79

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/72 (36%), Positives = 47/72 (65%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           + + I V+TL+G +  ++VE +DTIE +K+++   +GI P+QQR+ + G  L D  T+  
Sbjct: 1   MSITIKVQTLSGISRYIKVEQTDTIEKIKSQLYSMDGIAPDQQRILYKGLALPDTATIES 60

Query: 453 YNIQKESTLHLV 418
             I+ + T+H+V
Sbjct: 61  SGIKNDETVHMV 72


>UniRef50_O13255 Cluster: 2',5'-oligo adenylate synthetase A; n=11;
           Gallus gallus|Rep: 2',5'-oligo adenylate synthetase A -
           Gallus gallus (Chicken)
          Length = 514

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/71 (36%), Positives = 46/71 (64%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +M++ VK  + KT    V P+DT++ +K +I  ++ +P  QQRL +  K+LE+  TL  Y
Sbjct: 428 EMEVLVKD-SNKTTVYTVRPTDTVKQLKQQIYARQHVPVEQQRLTYETKELENHHTLEHY 486

Query: 450 NIQKESTLHLV 418
           ++Q  ST++L+
Sbjct: 487 HVQPRSTIYLL 497


>UniRef50_Q7QYQ3 Cluster: GLP_393_14301_14531; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_393_14301_14531 - Giardia lamblia
           ATCC 50803
          Length = 76

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/70 (37%), Positives = 47/70 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + V+  TG  +TL+V P++TI ++K K+ D+EGI P QQ++ +  +QL++  T+ + N
Sbjct: 1   MLLKVQLTTGYILTLDVAPTETILDIKNKVYDQEGIHPAQQKMLYLAQQLQNTTTVEEAN 60

Query: 447 IQKESTLHLV 418
           ++   T+ LV
Sbjct: 61  LKAGITIQLV 70


>UniRef50_P91057 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 226

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/68 (41%), Positives = 43/68 (63%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           + QIFVK L G +   ++   DT+ ++K  I+ +  IP +   L F+GK+LED  ++ DY
Sbjct: 153 EFQIFVKVL-GVSYAFKIHREDTVFDIKNDIEHRHDIPQHSYWLSFSGKRLEDHCSIGDY 211

Query: 450 NIQKESTL 427
           NIQK ST+
Sbjct: 212 NIQKSSTI 219


>UniRef50_Q4P3T5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 447

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/67 (38%), Positives = 45/67 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I +K+L G    L+ E +DTI  +K+KIQ+++G  P  Q++ F+GK L D +T++D  
Sbjct: 1   MKILIKSLAGGNFHLDAELTDTIGTIKSKIQNEQGHAPELQKIIFSGKILTDDKTVADCK 60

Query: 447 IQKESTL 427
           I+++  L
Sbjct: 61  IKEKDFL 67


>UniRef50_Q7XDE7 Cluster: Ubiquitin family protein, expressed; n=5;
           Oryza sativa|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 328

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/61 (40%), Positives = 43/61 (70%)
 Frame = -1

Query: 600 GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           GKT  L +  S++I ++KA+I+ +EGI  N+Q L +AG+QLED + LS  +++ + T H+
Sbjct: 102 GKTTKLNMRKSNSIADIKAEIEQEEGILMNEQILMYAGQQLEDNQLLSQCDLRNDQTFHV 161

Query: 420 V 418
           +
Sbjct: 162 L 162



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 27/69 (39%), Positives = 45/69 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I+VK +  KT TL V  +DT++ +K+K+   EGI  ++Q + FAG  L++   L+DYN
Sbjct: 20  LKIYVKMM--KTFTLNVNSTDTVDQIKSKLSAIEGIDKSKQEMFFAGMHLKNEDKLADYN 77

Query: 447 IQKESTLHL 421
           I   S++ L
Sbjct: 78  IMTNSSVDL 86



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/69 (33%), Positives = 41/69 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +Q FVK+  GKT+T+ ++ SDT + +K +I +K  I  +   L   G+ L    TL D+ 
Sbjct: 245 VQFFVKSWEGKTLTMVLKTSDTGKQIKDRIAEKLRIKESLYYLCHKGRVLLTEDTLLDHE 304

Query: 447 IQKESTLHL 421
           ++  ST+++
Sbjct: 305 VESNSTVYI 313



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL----XFAGKQLEDGRT 463
           K+ +F+     KTI LE +   T+ +VK  I++ EG+P   Q L       G  L DGR 
Sbjct: 168 KLHVFINVRGEKTIGLETKRWYTVADVKLMIENLEGLPACSQILTRMQSGVGVALTDGRM 227

Query: 462 LSDYNIQKESTLHL 421
           L D +++   TL L
Sbjct: 228 LQDQHVKNNDTLLL 241


>UniRef50_Q5KK31 Cluster: Ribosomal chaperone, putative; n=1;
           Filobasidiella neoformans|Rep: Ribosomal chaperone,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 88

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 24/48 (50%), Positives = 33/48 (68%)
 Frame = -1

Query: 561 IENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           I  VK ++++K GIPP QQRL F GK + D +T+ DY IQ  + +HLV
Sbjct: 29  ISKVKERVEEKAGIPPVQQRLIFGGKAMGDDKTIQDYKIQAGAAIHLV 76


>UniRef50_Q07371 Cluster: Ubiquitin-like protein 1; n=1;
           Caenorhabditis briggsae|Rep: Ubiquitin-like protein 1 -
           Caenorhabditis briggsae
          Length = 70

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 30/67 (44%), Positives = 46/67 (68%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           +FVKTL  +T+ LEV  ++ + ++K KI+  EGIP  +QRL FAG+QLED    SD  + 
Sbjct: 2   VFVKTLN-RTLYLEVAANEDVLSIKQKIEAAEGIPSAEQRLVFAGRQLED----SDCGLD 56

Query: 441 KESTLHL 421
            E+T+++
Sbjct: 57  AEATIYV 63


>UniRef50_A0C4L4 Cluster: Chromosome undetermined scaffold_15, whole
            genome shotgun sequence; n=7; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_15, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1027

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/64 (40%), Positives = 34/64 (53%)
 Frame = -1

Query: 378  NYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGK 199
            N++ P          KLA L+ Y +D  G + R  ++C   QC  GV+MA   DRHYCG 
Sbjct: 917  NFAKPKKKKHRHRKVKLATLKLYTIDNKGVVQRSHKQCP--QCPQGVYMAKHFDRHYCGT 974

Query: 198  CHST 187
            CH T
Sbjct: 975  CHQT 978


>UniRef50_Q9YHD3 Cluster: Scythe; n=6; Xenopus|Rep: Scythe - Xenopus
           laevis (African clawed frog)
          Length = 1135

 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 27/71 (38%), Positives = 44/71 (61%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           KM++ VKTL  +T T  VE   ++++ KA I    GI P +QRL + G+ L++ + L +Y
Sbjct: 6   KMEVTVKTLDSQTRTFTVETEISVKDFKAHISSDVGISPEKQRLIYQGRVLQEDKKLKEY 65

Query: 450 NIQKESTLHLV 418
           N+  +  +HLV
Sbjct: 66  NVDGK-VIHLV 75


>UniRef50_Q33AC4 Cluster: Protein kinase domain containing protein,
           expressed; n=7; Oryza sativa|Rep: Protein kinase domain
           containing protein, expressed - Oryza sativa subsp.
           japonica (Rice)
          Length = 795

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/71 (39%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLT-GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M+I+VK  +  KTI L V+ S+++ +VK +I+ KEGI  + Q L +AG+QL+D + LS +
Sbjct: 523 MRIYVKIPSIAKTIKLIVKNSNSVADVKVEIERKEGILQDNQMLMYAGRQLDDRQILSHF 582

Query: 450 NIQKESTLHLV 418
            +  +  LH++
Sbjct: 583 GLSDDQILHVL 593



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +QIF+K+  G+T+T  V   DT E +  KI+ +  I   +  L + G  L  G +L  Y 
Sbjct: 676 VQIFIKSWEGRTLTTLVSMFDTAEEIWKKIKKRSQIKAEKYFLCYRGHVLPPGVSLDMYK 735

Query: 447 IQKESTLHL 421
           I+  ST+ +
Sbjct: 736 IESNSTISI 744



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 4/74 (5%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGK----QLEDGRT 463
           K++IFV     +T+ L+VE   T+ +VK  I+   G P   Q L +       +L D  T
Sbjct: 599 KLRIFVNISNRRTVRLDVESWYTVADVKVMIEALLGFPACTQLLMWTNPSVDIELMDTET 658

Query: 462 LSDYNIQKESTLHL 421
           L + N++  + L L
Sbjct: 659 LKEQNVKNNTVLLL 672


>UniRef50_Q0DJQ4 Cluster: Os05g0242100 protein; n=3; Oryza
           sativa|Rep: Os05g0242100 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 312

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 28/62 (45%), Positives = 42/62 (67%)
 Frame = +1

Query: 442 LDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDLKGDGLAREGLYEN 621
           L++ V  G S+ +LL+ + + LL+  D+L VLN    I+D I RLDLK +GL+ +GL +N
Sbjct: 56  LNLQVSQGASVLELLAGEDEALLVRGDALLVLNLRLLIVDCIRRLDLKRNGLSGQGLDKN 115

Query: 622 LH 627
           LH
Sbjct: 116 LH 117



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 2/78 (2%)
 Frame = +1

Query: 400 ATTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLD 579
           A+ +P+H+V+ G  L++VVR G +I +LL+SK +    G+  +  L++ F     I   D
Sbjct: 118 ASPQPKHKVKSGLFLNVVVRQGPTILKLLASKDKD-AAGQGGIHSLSWIFAFTLSIVSED 176

Query: 580 --LKGDGLAREGLYENLH 627
              K  GL+ +GL+++LH
Sbjct: 177 STSKVMGLSCQGLHKDLH 194



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/61 (32%), Positives = 39/61 (63%)
 Frame = +1

Query: 400 ATTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLD 579
           ++ + + +VEGG  L++V+  G S+ +LL+ K + LL+  ++L VLN    I++ +  L+
Sbjct: 195 SSPEAKDKVEGGLFLNVVICEGASVLKLLARKDEALLVRWNTLLVLNLGLDIVNRVRGLN 254

Query: 580 L 582
           L
Sbjct: 255 L 255



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 19/45 (42%), Positives = 31/45 (68%)
 Frame = +1

Query: 451 VVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDLK 585
           +   G +I +LL+SK Q LLI  ++L VLN  FH+++ + RL+L+
Sbjct: 15  IADAGAAILELLASKDQSLLIRGNALLVLNLCFHVVNCVRRLNLQ 59


>UniRef50_Q17E87 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1122

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 29/69 (42%), Positives = 39/69 (56%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           +I V+TLTG    + V   DT+  +K+KIQ  EGIP NQQ L +  K+L D   + D  +
Sbjct: 10  EIIVETLTGYEFEVTVSDRDTVGYIKSKIQKYEGIPANQQHLLYNHKELSDTTEMKDIPL 69

Query: 444 QKESTLHLV 418
              S L LV
Sbjct: 70  VNGSRLKLV 78


>UniRef50_A0E5Z2 Cluster: Chromosome undetermined scaffold_8, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_8,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 458

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 23/65 (35%), Positives = 43/65 (66%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           +KTL  +  +  ++P++T++ +K  IQ+K  IP ++QRL + G+ LE+ +TL DY +Q +
Sbjct: 9   IKTLDNQITSFSIDPNNTVQQLKNVIQNKLNIPFDKQRLIYQGRVLENNKTLQDYKLQND 68

Query: 435 STLHL 421
             + L
Sbjct: 69  HVVLL 73


>UniRef50_A7R2A7 Cluster: Chromosome undetermined scaffold_411,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_411, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 903

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +  +  V+ +  +   K KI ++ G+P  QQRL F GK L+D + L++Y+
Sbjct: 24  VELNVKTLDSRIHSFHVDKNLPVSLFKEKIANEIGVPVEQQRLIFRGKVLKDDQLLAEYH 83

Query: 447 IQKESTLHLV 418
           ++   TLHLV
Sbjct: 84  VENGHTLHLV 93


>UniRef50_A7RYS4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1151

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/70 (41%), Positives = 40/70 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VKTL  +T T  V    T+E  K +I D  GIP  +QRL F GK L+D + L ++ 
Sbjct: 1   MQVTVKTLDSETRTFTVSEELTVEEFKKEIADTVGIPAERQRLIFKGKVLQDEKKLKEFE 60

Query: 447 IQKESTLHLV 418
           +     +HLV
Sbjct: 61  VD-GCVVHLV 69


>UniRef50_A0T470 Cluster: ORF27; n=5; Nucleopolyhedrovirus|Rep:
           ORF27 - Helicoverpa armigera NPV
          Length = 255

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/52 (53%), Positives = 34/52 (65%)
 Frame = +2

Query: 473 SSSCFPAXINLC*LGGIPSLS*ILAFTFSMVSDGSTSRVMVLPVRVFTKICI 628
           SSSC PA I  C   G PS + I +FT S +S  STS V+VLPV+V T IC+
Sbjct: 3   SSSCLPAYIRRCWSTGTPSFAAIFSFTVSTLSLDSTSTVIVLPVKVLTNICM 54


>UniRef50_Q84UT7 Cluster: Calreticulin interacted protein; n=7;
           Oryza sativa|Rep: Calreticulin interacted protein -
           Oryza sativa (Rice)
          Length = 966

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/70 (38%), Positives = 44/70 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I +KTL  +   L V+ +  +  +K KI +  G+P +QQRL F G+ L+D   LS+Y+
Sbjct: 24  IEINIKTLDSQVHKLRVKKNVPVLVLKEKIVEATGVPVDQQRLIFRGRVLKDDHLLSEYH 83

Query: 447 IQKESTLHLV 418
           ++   TLHLV
Sbjct: 84  LEDGYTLHLV 93


>UniRef50_A6S7C5 Cluster: Predicted protein; n=2;
           Sclerotiniaceae|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 169

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/69 (39%), Positives = 40/69 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVK L+G TI + V    TI N+   +  +   P +  RL  AG+ L+   TL+  N
Sbjct: 22  MQIFVKVLSGDTIPITVPEDTTISNLAHLLSIRTSSPSSTLRLVHAGRHLQPSSTLTSNN 81

Query: 447 IQKESTLHL 421
           I ++ST+H+
Sbjct: 82  ITRDSTIHV 90


>UniRef50_UPI0000E46F9B Cluster: PREDICTED: similar to Chain A,
           Structure Of The Dna Repair Protein Hhr23a isoform 2;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Chain A, Structure Of The Dna Repair Protein
           Hhr23a isoform 2 - Strongylocentrotus purpuratus
          Length = 405

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 2/67 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M I +KTL  +T  +E+E S T+ N+K +I+  +G   P + Q+L +AGK L D   LS 
Sbjct: 1   MLIVLKTLQQQTFRVEIEDSATVRNLKDEIEKTQGKDFPASGQKLIYAGKILSDDNPLSS 60

Query: 453 YNIQKES 433
           YNI ++S
Sbjct: 61  YNIDEKS 67


>UniRef50_A7ASK4 Cluster: Ubiquitin domain containing protein
           family; n=1; Babesia bovis|Rep: Ubiquitin domain
           containing protein family - Babesia bovis
          Length = 318

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/70 (37%), Positives = 40/70 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + + +K   G+T  +EVE S TI  +K K  D+ G  P  QRL F G+ ++D  TL    
Sbjct: 3   INVTIKISGGETFVVEVELSMTILELKGKCADRAGATPENQRLIFKGRIVKDEDTLESLK 62

Query: 447 IQKESTLHLV 418
           ++  +T+HLV
Sbjct: 63  VEDGNTIHLV 72


>UniRef50_A2G7G2 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 356

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -1

Query: 621 IFVKTLTGKTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           IFVKT+TGK  T E VE  +T+  +K+ +Q++ GI   +QRL F  K+++    + DY I
Sbjct: 17  IFVKTVTGKIYTFENVELINTLNYLKSLVQEQTGIKIEKQRLIFNMKEMKADIPIKDYGI 76

Query: 444 QKESTLHLV 418
           + E+ ++LV
Sbjct: 77  KNENIIYLV 85



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = -1

Query: 624 QIFVKTLTGKTITL-EVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           QI + T  G  +   +++ +  ++  K  IQ++EG P  + RL FAGKQLE    L DY 
Sbjct: 99  QIELVTCRGDYVLFTDIDLNLKVKYFKYLIQEQEGTPVEKIRLIFAGKQLEAEIKLKDYG 158

Query: 447 IQKESTLHLV 418
           ++    + LV
Sbjct: 159 VKYGDKIQLV 168


>UniRef50_A7FA67 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 392

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/68 (47%), Positives = 39/68 (57%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I+VK LTGK +T+ V    TI  +K  I +KEGI  + QR  F GK L D  TL D +  
Sbjct: 151 IYVKYLTGKILTVHVNSEMTIGALKNHIMNKEGIATDHQRFIFGGKVLRDHDTLGDID-- 208

Query: 441 KESTLHLV 418
              TLHLV
Sbjct: 209 -GITLHLV 215


>UniRef50_Q15646 Cluster: 59 kDa 2'-5'-oligoadenylate
           synthetase-like protein; n=17; Eutheria|Rep: 59 kDa
           2'-5'-oligoadenylate synthetase-like protein - Homo
           sapiens (Human)
          Length = 514

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++Q+FVK   G +    + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y
Sbjct: 433 EIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIY 492

Query: 450 NIQKESTLHL 421
            IQ   TL L
Sbjct: 493 GIQDSDTLIL 502


>UniRef50_Q9VEP9 Cluster: CG16941-PA; n=7; Endopterygota|Rep:
           CG16941-PA - Drosophila melanogaster (Fruit fly)
          Length = 784

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 22/62 (35%), Positives = 40/62 (64%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ I + +  S+ I N+K K+QD+ G+PP +Q++ + G   +D  T++ YN+   +T+
Sbjct: 713 LNGQMIAVTMALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTV 772

Query: 426 HL 421
           HL
Sbjct: 773 HL 774


>UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1164

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           K QIF+     K I +++E + T+  +K KI  K  IP N Q L + GK L D   L DY
Sbjct: 304 KDQIFIIHQGPKVIKVDIE-NTTVIQLKQKIYHKLNIPTNVQTLNYGGKLLTDSLLLKDY 362

Query: 450 NIQKESTLHLVXXXXXXXXXXXXKNYS 370
           N+Q  S L+L              NY+
Sbjct: 363 NVQNNSNLNLTFKLNQLVSHADSYNYN 389


>UniRef50_A0DWV1 Cluster: Chromosome undetermined scaffold_67, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_67,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 331

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 23/67 (34%), Positives = 45/67 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I +KTL+G+T  +EV+P++T+ N+K KI+  +     QQ+L   G  L++ +T+++  
Sbjct: 1   MKIIIKTLSGQTFDIEVQPTETVLNIKEKIEQNKQFEIAQQKLLRKGTLLQNEQTVAELG 60

Query: 447 IQKESTL 427
           +Q++  L
Sbjct: 61  LQEKDFL 67


>UniRef50_A0BZP2 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 353

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 24/70 (34%), Positives = 44/70 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I +K  T +   +E++P+ T++ +K K+  K    P+Q ++ F GK L+D   LS+ N
Sbjct: 4   ISIKIKHGTDQIEVIEIDPNVTVKELKEKLTPKFNSEPSQMKIIFQGKILKDNDILSNVN 63

Query: 447 IQKESTLHLV 418
           ++ +ST+HLV
Sbjct: 64  VKTDSTMHLV 73


>UniRef50_Q55DZ2 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 2337

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = -1

Query: 621  IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRT--LSDYN 448
            I +K + G+ I L+V    TI  ++  I D++G+PP+ QRL +  KQ++   T  L +++
Sbjct: 1518 INIKYMAGRIIQLKVSDETTIGELQQMIMDRDGLPPSSQRLFYLNKQIDSNATMKLKEFS 1577

Query: 447  IQKESTLHLV 418
            I  ++TL+LV
Sbjct: 1578 IVNKATLNLV 1587


>UniRef50_Q553G0 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 184

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/62 (41%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAG-KQLEDGRTLSDY 451
           M+I +++L G +  LEV PSDT E++K KI+     P +QQRL  +  K++E+G T+ D 
Sbjct: 1   MKITIRSLLGHSFELEVNPSDTTEDIKRKIEKHTDTPFDQQRLLLSNKKRMEEGSTIEDS 60

Query: 450 NI 445
            I
Sbjct: 61  GI 62


>UniRef50_UPI0000498E95 Cluster: 40S ribosomal protein S27a; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S27a - Entamoeba histolytica HM-1:IMSS
          Length = 139

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = -1

Query: 330 LAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHS 190
           LA L  Y V   GK+ RLR+ C  ++CG   F+A  +DR  CGKCH+
Sbjct: 87  LACLTHYNVTSAGKVERLRKCCANKKCGVACFLAQHKDRLTCGKCHT 133


>UniRef50_Q7SZF4 Cluster: HLA-B-associated transcript 3; n=5; Danio
           rerio|Rep: HLA-B-associated transcript 3 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 1209

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/70 (35%), Positives = 45/70 (64%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  ++ +  VE   T+++ K  I    GIP ++QRL + G+ L+D +TL++YN
Sbjct: 9   IEVTVKTLDSQSRSYTVEAQMTVKDFKEHISPSVGIPVDKQRLIYQGRVLQDEKTLTEYN 68

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 69  VDGK-VIHLV 77


>UniRef50_Q4T7D6 Cluster: Chromosome undetermined SCAF8128, whole
           genome shotgun sequence; n=2; Coelomata|Rep: Chromosome
           undetermined SCAF8128, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 320

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQ---DKEGIPPNQQRLXFAGKQLEDGRTLS 457
           MQI +KTL  +TI +E++P  T++ +K KI+    K+  P + Q+L +AGK L+D   + 
Sbjct: 1   MQITLKTLQQQTIQIEIDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPIK 60

Query: 456 DYNIQKES 433
           +Y I + +
Sbjct: 61  EYKIDERN 68


>UniRef50_Q23CW9 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1456

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/71 (35%), Positives = 42/71 (59%)
 Frame = -1

Query: 630  KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
            K++I +K L      L +  SDTI+ +K +++    IP ++QRL F+G+ L D +TL D 
Sbjct: 987  KIEIKLKLLDNSMHKLNMRASDTIKYLKEEVEQALNIPIDKQRLIFSGRYLRDDQTLKDN 1046

Query: 450  NIQKESTLHLV 418
             I+    +HL+
Sbjct: 1047 QIENGHVIHLI 1057


>UniRef50_A4RK10 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 401

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 24/64 (37%), Positives = 39/64 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++  K L  +   +EVEP+D I  VK KI ++ G  P  Q+L ++GK L+D  T+  Y 
Sbjct: 1   MKVTFKDLKQQKFVIEVEPTDLISAVKQKISEERGWDPKLQKLIYSGKILKDEETVESYK 60

Query: 447 IQKE 436
           I+++
Sbjct: 61  IEEK 64


>UniRef50_Q84L30 Cluster: Putative DNA repair protein RAD23-4; n=13;
           Magnoliophyta|Rep: Putative DNA repair protein RAD23-4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 378

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M+IFVKTL+G    +EV+P+D + +VK  I+  +G   P  +Q L   GK L+D  TL +
Sbjct: 1   MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAEYPAAKQMLIHQGKVLKDETTLEE 60

Query: 453 YNIQKES 433
            N+ + S
Sbjct: 61  NNVVENS 67


>UniRef50_A2XN69 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 300

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 2/71 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDG-RTLSD 454
           M+I V+TL G  + L+V+  + T+  VK  +  +E I    QRL FAG+ L+D  RTL+D
Sbjct: 1   MRIMVRTLRGDRVALDVDGATTTVAQVKGMVMARERIAVAMQRLFFAGRCLDDDHRTLAD 60

Query: 453 YNIQKESTLHL 421
           Y ++ +S + L
Sbjct: 61  YGVRHDSVVFL 71


>UniRef50_UPI0000E495BD Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 316

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/71 (32%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED-GRTLSD 454
           ++Q+FV+ + G+T+T+    + T+++++ +I+ +  I  +QQRL F+ + L D  RTLS 
Sbjct: 237 QIQVFVRQINGRTLTINTRANATVDDLQREIKTRTSIDLSQQRLTFSSQNLTDRTRTLSS 296

Query: 453 YNIQKESTLHL 421
           Y I   S + +
Sbjct: 297 YGIVNHSNIDM 307


>UniRef50_UPI000051618B Cluster: PREDICTED: similar to CG7215-PA,
           isoform A; n=2; Apocrita|Rep: PREDICTED: similar to
           CG7215-PA, isoform A - Apis mellifera
          Length = 150

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY- 451
           M++ VK L GK   +++ PSDT+  +K K+ D  GI    QRL   GK L D   LS Y 
Sbjct: 1   MKVIVKKLQGKECVVDITPSDTVLQLKHKVSDLLGIDVPHQRLLLTGKALADENPLSFYP 60

Query: 450 NIQKESTLHLV 418
            I+  S L+L+
Sbjct: 61  GIKDGSKLNLL 71


>UniRef50_A0E6I1 Cluster: Chromosome undetermined scaffold_8, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_8,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 608

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           +KTL   T+ + ++ S T+  +K  I+    IP ++QRL F G+QL +  TL   NI+ +
Sbjct: 16  IKTLDNHTLDVRIKQSQTVNELKNLIEIVSSIPSSRQRLLFKGRQLSNEDTLISLNIEDQ 75

Query: 435 STLHLV 418
             +HLV
Sbjct: 76  CVVHLV 81


>UniRef50_A0CBZ8 Cluster: Chromosome undetermined scaffold_166,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_166,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 351

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I +KTL+G+   L+VE SDTI +VK KI   +     QQ+L   G  L+D  T+++  
Sbjct: 1   MKIIIKTLSGQNFPLDVEGSDTISDVKEKIFQVKQFEVGQQKLLRKGTLLDDKTTIAELG 60

Query: 447 IQKESTL 427
           IQ+   L
Sbjct: 61  IQENEFL 67


>UniRef50_Q9VEC8 Cluster: CG7215-PA, isoform A; n=2; Sophophora|Rep:
           CG7215-PA, isoform A - Drosophila melanogaster (Fruit
           fly)
          Length = 130

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY- 451
           MQI +K L GK  T+EV P+ TI  VK +I+ +  I    Q+L   G+ L + +T++ Y 
Sbjct: 1   MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYP 60

Query: 450 NIQKESTLHLV 418
           NI++ + L+LV
Sbjct: 61  NIKEGTKLNLV 71


>UniRef50_Q4Q2Y8 Cluster: Ubiquitin-like protein; n=3;
           Leishmania|Rep: Ubiquitin-like protein - Leishmania
           major
          Length = 80

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/67 (37%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = -1

Query: 615 VKTLTGKTITLEV-EPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQK 439
           V + TG+ I++ V  P +T+ ++KAK+++ EGIP     L  +G++LED  TL + NI  
Sbjct: 7   VISTTGQRISISVLGPDNTVGDIKAKLEETEGIPQKMIMLVHSGRKLEDNATLEECNIHA 66

Query: 438 ESTLHLV 418
             T+++V
Sbjct: 67  GITINMV 73


>UniRef50_Q2QU13 Cluster: Ubiquitin family protein, expressed; n=3;
           Oryza sativa|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 302

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ ++T+ G+  T+E+    T+  +K  +  +EGIP   QRL FAG +L+D      Y+
Sbjct: 1   MEVTLETVAGRRFTVEIWFFSTVRRIKEYVLRQEGIPVESQRLFFAGAELDDDGDTERYS 60

Query: 447 IQKESTLHLV 418
           I + ST+ L+
Sbjct: 61  ILQGSTVLLL 70


>UniRef50_A2F733 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 233

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/68 (36%), Positives = 39/68 (57%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           I+VK LTGK+IT+ +    TI  ++  +  +  I  N+ RL   G  L   +T+ DY I+
Sbjct: 162 IYVKDLTGKSITIHLYAHSTIRELQLVVCQRLNISFNECRLILNGIPLSINKTMDDYGIK 221

Query: 441 KESTLHLV 418
           KES +H +
Sbjct: 222 KESAIHYI 229


>UniRef50_Q96T88 Cluster: E3 ubiquitin-protein ligase UHRF1; n=44;
           Eumetazoa|Rep: E3 ubiquitin-protein ligase UHRF1 - Homo
           sapiens (Human)
          Length = 793

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>UniRef50_UPI000023DB70 Cluster: hypothetical protein FG00163.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG00163.1 - Gibberella zeae PH-1
          Length = 400

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = -1

Query: 576 EPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           E   T++++K +I D  G  P+QQ L + GK+LED R  +DY++Q+ S + L
Sbjct: 198 ENDSTVQDIKDRIHDTRGTRPDQQLLIYEGKELEDARKWTDYSLQRASIIFL 249


>UniRef50_A7P609 Cluster: Chromosome chr4 scaffold_6, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_6, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 573

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I +KTL  +T TL V+    +  +K +I    G+   QQRL   G+ L+D + LS Y+
Sbjct: 24  VEIKIKTLDSQTYTLRVDKCMPVPALKEQIASVTGVLSEQQRLICRGRVLKDDQLLSAYH 83

Query: 447 IQKESTLHLV 418
           ++   TLHLV
Sbjct: 84  VEDGHTLHLV 93


>UniRef50_Q56J89 Cluster: RAD23B-like protein; n=1; Adineta
           ricciae|Rep: RAD23B-like protein - Adineta ricciae
          Length = 244

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 3/73 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKI--QD-KEGIPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL+ +   +E E SDT+  +K KI  +D K+    +  +L F+GK LED +TL 
Sbjct: 1   MQLQIKTLSNEKFAIECELSDTVRTIKEKIAAKDLKDKYEADAVKLIFSGKILEDSKTLE 60

Query: 456 DYNIQKESTLHLV 418
            Y+I  +S L +V
Sbjct: 61  FYSITSDSFLVVV 73


>UniRef50_A2ESV4 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 303

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/59 (45%), Positives = 33/59 (55%)
 Frame = -1

Query: 594 TITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           T T+    SDT+  VK  + +K  + PNQ RL FAGK L D  TL  Y I   S L+LV
Sbjct: 16  TYTVNAWSSDTVNTVKELLVEKTSLQPNQMRLVFAGKVLSDEITLQFYEIVDGSKLYLV 74


>UniRef50_Q55K49 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 355

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAK------IQDKEGIPPNQQRLXFAGKQLEDGR 466
           M+I +  L G    L V   +++ +VKAK      IQ K  + P+ QR+ + G+QLED  
Sbjct: 1   MRISIVLLGGSQTELSVHSWNSVRDVKAKYELQAEIQGKHSLQPDFQRMFYQGRQLEDPW 60

Query: 465 TLSDYNIQKESTLHL 421
            LS+ NIQ  STLH+
Sbjct: 61  LLSECNIQHVSTLHV 75



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/65 (35%), Positives = 38/65 (58%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           V+ L  +T   +V   D +E+++AKI  KEG+P    +L +    L+DGR L DY ++K 
Sbjct: 240 VQNLQYQTSYYDVMADDPVEHLRAKIAWKEGVPLEGLQLCYGRNLLKDGRLLKDYKLRKN 299

Query: 435 STLHL 421
           S + +
Sbjct: 300 SIVRM 304


>UniRef50_P54727 Cluster: UV excision repair protein RAD23 homolog
           B; n=43; Euteleostomi|Rep: UV excision repair protein
           RAD23 homolog B - Homo sapiens (Human)
          Length = 409

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>UniRef50_UPI0001554645 Cluster: PREDICTED: similar to Parkinson
           disease (autosomal recessive, juvenile) 2, parkin,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           similar to Parkinson disease (autosomal recessive,
           juvenile) 2, parkin, partial - Ornithorhynchus anatinus
          Length = 254

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/70 (31%), Positives = 45/70 (64%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  TL + +
Sbjct: 1   MQVFVRFNSCHGFPVEVDSDTSIFELKELVAKQQGVPADQLRVIFAGKELRNDLTLQNCD 60

Query: 447 IQKESTLHLV 418
           ++++S +H+V
Sbjct: 61  LEQQSIVHVV 70


>UniRef50_UPI0000D554E4 Cluster: PREDICTED: similar to CG16941-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG16941-PA - Tribolium castaneum
          Length = 759

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/62 (35%), Positives = 40/62 (64%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           LTG+ + L V  S+++ ++K+KIQ++  +PP +Q+L + G   +D  TL+ YNI   + +
Sbjct: 688 LTGQMMALNVPLSESVSSIKSKIQEETNMPPAKQKLFYDGMFFKDSNTLAYYNIITGAVI 747

Query: 426 HL 421
            L
Sbjct: 748 QL 749


>UniRef50_Q9ZT95 Cluster: Putative ubiquitin-like protein; n=2;
           Arabidopsis thaliana|Rep: Putative ubiquitin-like
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 270

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/69 (36%), Positives = 40/69 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +++ T TG + ++ ++  +T+  +K KI+  +GIP ++Q L   GK LED     DY 
Sbjct: 1   MNVYIDTETGSSFSITIDFGETVLEIKEKIEKSQGIPVSKQILYLDGKALEDDLHKIDYM 60

Query: 447 IQKESTLHL 421
           I  ES L L
Sbjct: 61  ILFESRLLL 69


>UniRef50_A7QS28 Cluster: Chromosome undetermined scaffold_155,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_155, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 744

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/71 (35%), Positives = 42/71 (59%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +++I +KTL  +T T+ V     + ++K +I    G+  +QQRL   GK L+D + L  Y
Sbjct: 16  EIEIKIKTLDSQTYTMRVNKQVPVPDLKQQIATVTGVLSDQQRLICRGKVLKDDQRLCAY 75

Query: 450 NIQKESTLHLV 418
           +++   TLHLV
Sbjct: 76  HVEDGHTLHLV 86


>UniRef50_A2G7U9 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 341

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ +KT TG   ++ +  SDT+E +K  +  + GIP NQQ L F    L++  T+S   
Sbjct: 190 IKLHIKTRTGNLYSISINLSDTVEKLKRNLVQRTGIPINQQLLYFKSDILKNDSTISSLK 249

Query: 447 IQKESTLHL 421
           ++  S ++L
Sbjct: 250 LENRSRVYL 258


>UniRef50_A2FA32 Cluster: Ubiquitin family protein; n=11;
           Trichomonas vaginalis G3|Rep: Ubiquitin family protein -
           Trichomonas vaginalis G3
          Length = 539

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 2/69 (2%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEP-SDTIENVKAKIQDKEGIPPNQQRLXFAGKQ-LEDGRTLSDYN 448
           I+++ +T KT+ L  +  + T+ ++K  I D EGI P  Q L + G++ LED   L DY+
Sbjct: 280 IYIRLITVKTLVLYADIWNSTVFDLKLLICDSEGIFPRDQDLYYGGERHLEDNFKLIDYD 339

Query: 447 IQKESTLHL 421
           IQ++ST++L
Sbjct: 340 IQRDSTIYL 348



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = -1

Query: 564 TIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKES 433
           T+E +K K   K G P   Q + + G  ++D RTL+ Y IQ+ S
Sbjct: 218 TVEKLKEKFYSKTGWPIKYQTMTYNGIIMDDNRTLNYYKIQRGS 261



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           + I+V +  G     E +  + TI++ K K+Q + GIP N+Q L      L +  TL  Y
Sbjct: 121 INIYVNSFIGVYCPFENINLNTTIKDFKLKLQKESGIPANKQLLYLGNFLLPNSGTLEKY 180


>UniRef50_A0DJC7 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 442

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPS-DTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           +Q+FV+T  G+ ++L V  + D +E +   IQ KEGIPP +Q+L    K L+    ++  
Sbjct: 76  IQVFVQTPNGRILSLGVNNNVDYLEQITDYIQQKEGIPPKRQKLYLGPKILD---KINSK 132

Query: 450 NIQKESTLHL 421
            I+K STLHL
Sbjct: 133 TIKKNSTLHL 142



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 16/55 (29%), Positives = 30/55 (54%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           +++  ++ + ++K K+  +   P + Q L F  + L+D   L DY IQK S + L
Sbjct: 161 IDINLNECVRDIKFKLLQEYEYPFHSQLLIFKNRLLKDDFKLHDYKIQKHSVILL 215


>UniRef50_UPI0000E495BE Cluster: PREDICTED: similar to
           polyubiquitin; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to polyubiquitin - Strongylocentrotus
           purpuratus
          Length = 329

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED 472
           QI V     KT  + V P+D ++++K K+Q+K  I P+QQRL F GK L+D
Sbjct: 269 QIQVVDFANKTHIVRVRPTDKVKDLKVKVQEKLKIAPSQQRLQFQGKMLDD 319



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/62 (37%), Positives = 34/62 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V    GKT    V P+DT++++K KIQ+K  I P+QQRL F         T+ + +
Sbjct: 63  IHIQVVDYEGKTKIATVRPTDTVKDLKVKIQEKLKIAPSQQRLQFQSLSRAQSYTMDNEH 122

Query: 447 IQ 442
            Q
Sbjct: 123 DQ 124


>UniRef50_Q5JNE7 Cluster: Putative uncharacterized protein
           P0435H01.36; n=3; Oryza sativa|Rep: Putative
           uncharacterized protein P0435H01.36 - Oryza sativa
           subsp. japonica (Rice)
          Length = 314

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 2/71 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGR-TLSD 454
           M+I V+TL G  + L+V+  + T+  VK  +  +E I    QRL FAG+ L+D   TL+D
Sbjct: 1   MRIMVRTLRGDWVALDVDGATTTVAQVKGMVMARERIAVAMQRLFFAGRCLDDDHSTLAD 60

Query: 453 YNIQKESTLHL 421
           Y ++ +S + L
Sbjct: 61  YGVRHDSVVFL 71


>UniRef50_Q4UC28 Cluster: Putative uncharacterized protein; n=1;
           Theileria annulata|Rep: Putative uncharacterized protein
           - Theileria annulata
          Length = 518

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 23/70 (32%), Positives = 40/70 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I  +++   T T  ++ S ++  +KA I+   G P N  RL + G+ L+D  TL  YN
Sbjct: 3   VNITFRSMDETTFTCSMDTSTSVRRIKAFIELYNGSPANSLRLIYRGQLLKDDYTLDSYN 62

Query: 447 IQKESTLHLV 418
           I  ++T+H+V
Sbjct: 63  ITTDNTIHVV 72


>UniRef50_A5K4E9 Cluster: Ubiquitin domain containing protein; n=6;
           Plasmodium|Rep: Ubiquitin domain containing protein -
           Plasmodium vivax
          Length = 394

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/70 (35%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + +  K   GK  T+ VEP  T+  +K K  +   IP   QR+ F GK L+D   L+ Y 
Sbjct: 3   INVSFKVTGGKEFTISVEPEITVLELKQKCAEHVDIPVECQRIIFKGKILKDKEPLTTYG 62

Query: 447 IQKESTLHLV 418
           +    T+HLV
Sbjct: 63  VSDGITMHLV 72


>UniRef50_Q9NIF3 Cluster: Ubiquitin-like fusion protein SonA; n=2;
           Dictyostelium discoideum|Rep: Ubiquitin-like fusion
           protein SonA - Dictyostelium discoideum (Slime mold)
          Length = 523

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I +K+ T     ++VE   T+ + K  I  K  IP +QQR+ ++G+ L+D +TL +  
Sbjct: 2   VKINIKSSTDNKFDVDVELGITVADFKKVIATKCSIPADQQRIIYSGRILKDHQTLDEIK 61

Query: 447 IQKESTLHLV 418
           IQ   T+HLV
Sbjct: 62  IQDGHTVHLV 71


>UniRef50_Q19KS6 Cluster: Ubiquitin-like protein 4B; n=1;
           Monodelphis domestica|Rep: Ubiquitin-like protein 4B -
           Monodelphis domestica (Short-tailed gray opossum)
          Length = 181

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 25/70 (35%), Positives = 40/70 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + VK L G+   L+V  ++ +  +K  +  +  +P  QQRL F G+ L D + LSDY 
Sbjct: 1   MWLTVKLLLGRRCLLQVSENEKVFMLKRLVSKQLHVPEKQQRLLFRGQVLADNKRLSDYC 60

Query: 447 IQKESTLHLV 418
           I   STL+++
Sbjct: 61  IGPNSTLNVI 70


>UniRef50_O15205 Cluster: Ubiquitin D; n=18; Eutheria|Rep: Ubiquitin
           D - Homo sapiens (Human)
          Length = 165

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>UniRef50_UPI0000D55C1D Cluster: PREDICTED: similar to
           HLA-B-associated transcript 3 isoform 1; n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to HLA-B-associated
           transcript 3 isoform 1 - Tribolium castaneum
          Length = 1149

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 25/66 (37%), Positives = 36/66 (54%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           VKTL  +  T  V+   T+E  K KI D   IP   QR+ + G+ L+D   L DY++  +
Sbjct: 6   VKTLDSQNHTFTVDDDITVEQFKTKIADTVNIPAETQRIIYCGRVLQDEAKLGDYDVNGK 65

Query: 435 STLHLV 418
             +HLV
Sbjct: 66  -VVHLV 70


>UniRef50_Q2HT46 Cluster: HECT; Ubiquitin; n=2; Medicago
           truncatula|Rep: HECT; Ubiquitin - Medicago truncatula
           (Barrel medic)
          Length = 826

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTG-KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           ++Q FV+ +    TI +     DT+E++  +I  K  IP   QRL + GKQL+  ++LS 
Sbjct: 44  ELQFFVRMMWKCNTIVIHASREDTVESILQQISSKTKIPIEYQRLIYNGKQLQQQQSLSQ 103

Query: 453 YNIQKESTLHLV 418
             I+ ++ L LV
Sbjct: 104 CGIENDANLQLV 115


>UniRef50_A2Q1T1 Cluster: Ubiquitin; n=1; Medicago truncatula|Rep:
           Ubiquitin - Medicago truncatula (Barrel medic)
          Length = 674

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD---KEGIPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    + V PSD+I  VK  I+D   K+  P  QQ L   GK L+D  TL+
Sbjct: 548 MKLTVKTLKGSHFEIRVHPSDSIMAVKTTIEDIQGKDNYPCRQQLLIHNGKVLKDETTLA 607

Query: 456 DYNIQKESTL 427
           D  + ++  L
Sbjct: 608 DNEVSEDGFL 617


>UniRef50_A2DY94 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 330

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 20/62 (32%), Positives = 39/62 (62%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ ++T++G T    VEP+ TI  +K  + +K  + P   +L ++ K L+D +T+++ N
Sbjct: 1   MEVSLRTISGVTYKQAVEPTTTIAELKVLVSEKANVAPEGIKLIYSAKFLDDSKTIAESN 60

Query: 447 IQ 442
           IQ
Sbjct: 61  IQ 62


>UniRef50_Q5J4W3 Cluster: Parkin; n=3; Tetraodontidae|Rep: Parkin -
           Fugu rubripes (Japanese pufferfish) (Takifugu rubripes)
          Length = 482

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 19/70 (27%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+   G  + +E++   T+  +K  +  ++G+ P+  R+ FAG++L+   TL   +
Sbjct: 1   MIVFVRYNLGPEVVVELQEEATVAELKEVVGQQQGVQPDLLRVLFAGRELKSTSTLQGCD 60

Query: 447 IQKESTLHLV 418
           + ++ST+H++
Sbjct: 61  LPEQSTVHII 70


>UniRef50_Q53MR5 Cluster: Ubiquitin family, putative; n=2; Oryza
           sativa (japonica cultivar-group)|Rep: Ubiquitin family,
           putative - Oryza sativa subsp. japonica (Rice)
          Length = 353

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/60 (40%), Positives = 38/60 (63%)
 Frame = -1

Query: 597 KTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           KTI L V+ SD + +VK +I+ KEGI  + Q L +AG+ L D + LS+  +  +  LH++
Sbjct: 163 KTIELSVKKSDIVADVKLQIELKEGIHLDNQILMYAGRHLGDSQILSECGLSDDHILHVL 222



 Score = 32.7 bits (71), Expect = 7.9
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP 514
           IF+KT  G+T+T+ V    T E++  KIQ K  I P
Sbjct: 307 IFIKTWEGRTLTMVVSSFHTEEDIWEKIQKKSMINP 342


>UniRef50_A7QUN3 Cluster: Chromosome chr10 scaffold_179, whole
           genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome chr10 scaffold_179, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 284

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTGKT-ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           K+QI ++  T K  +++E++ + T+  +K KI + EGIP N+  L + G++L+D R+L D
Sbjct: 115 KIQILLRIPTSKIHLSIEMDLAHTVGRLKEKIHEMEGIPVNRMVLYWRGRELQDSRSLRD 174

Query: 453 YNIQKESTL 427
             +   S +
Sbjct: 175 CELSDRSEI 183



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTL 460
           M +  +   G+  +LE+   DT+  +K K+Q   GIP ++Q L F G  L+D R +
Sbjct: 1   MDVIFEPQGGEPFSLELGFFDTVLEIKEKVQKYHGIPASRQTLFFNGHLLQDNRDI 56


>UniRef50_A3BRN9 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 710

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I +KTL  +T  L V     +  +K KI    GI   QQRL   G+ L+D   LS Y+
Sbjct: 113 IEIKIKTLDSQTYNLRVNKRVPVPLLKEKIATVTGILSEQQRLICRGRVLKDDELLSAYH 172

Query: 447 IQKESTLHLV 418
           ++   TLHLV
Sbjct: 173 VEDGHTLHLV 182


>UniRef50_Q54TK0 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 96

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/53 (39%), Positives = 33/53 (62%)
 Frame = -1

Query: 609 TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ G+   LEV+P+D I+ +K+KI +  G P  Q     AG  ++DG T+SDY
Sbjct: 6   SIHGQEYDLEVQPTDKIQEIKSKINELNGTPVEQIHPYIAGHAMKDGTTISDY 58


>UniRef50_Q54L35 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 80

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 25/62 (40%), Positives = 36/62 (58%)
 Frame = -1

Query: 603 TGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLH 424
           TGK   L  + +D IE +K  I+  EGI P +Q+L F GK L+D  TL    I+  ST+ 
Sbjct: 10  TGKRTELNFDETDKIELIKNSIRIMEGINPQEQKLIFDGKVLKDTSTLKSCGIKDGSTIS 69

Query: 423 LV 418
           ++
Sbjct: 70  VL 71


>UniRef50_Q232I7 Cluster: Ubiquitin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ubiquitin family protein -
           Tetrahymena thermophila SB210
          Length = 553

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/86 (27%), Positives = 44/86 (51%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           QIF+    GK++ L+   S ++  +K  I +K G+PP +Q+L +  K+L +   + +Y I
Sbjct: 366 QIFIILTNGKSLPLQFNISSSVLQIKILIFEKTGVPPLEQKLFYYTKELHNYTAMKEYQI 425

Query: 444 QKESTLHLVXXXXXXXXXXXXKNYST 367
            ++ ++ L             KN ST
Sbjct: 426 PRDCSIKLYIRSFYQQLQSISKNQST 451


>UniRef50_A7STF8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 263

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           I V TLTG+ I +  + P  TI  VK  I+ K G P +QQRL F G+ L D  T     I
Sbjct: 2   IAVLTLTGERILILFKSPKHTIIEVKYLIEAKGGYPKDQQRLVFNGQVLSDEDTFEKVGI 61

Query: 444 QKESTLHLV 418
              +TLHL+
Sbjct: 62  FAGATLHLI 70


>UniRef50_A7AVL0 Cluster: Ubiquitin family domain containing
           protein; n=1; Babesia bovis|Rep: Ubiquitin family domain
           containing protein - Babesia bovis
          Length = 507

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 23/70 (32%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I  + +TG+ I L+V     I  VK  I     I P   +L F G+ L D RT+  Y+
Sbjct: 5   LDITFRLITGQDIKLQVRDDGKISEVKGLIAGHCDISPRDMKLIFKGQLLVDDRTIGSYD 64

Query: 447 IQKESTLHLV 418
           +   ST+H++
Sbjct: 65  VANGSTIHII 74


>UniRef50_Q6C7B6 Cluster: Similar to sp|P48510 Saccharomyces
           cerevisiae YMR276w DSK2 ubiquitin- like protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P48510
           Saccharomyces cerevisiae YMR276w DSK2 ubiquitin- like
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 343

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/69 (31%), Positives = 42/69 (60%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           +I +K+ + K + + V     +  VK ++  +  IP  +QRL ++G+ L+DG T+  YNI
Sbjct: 5   EIIIKS-SDKKVPVSVNNDTLVSKVKEQMAKELDIPAERQRLIYSGRVLKDGETVGSYNI 63

Query: 444 QKESTLHLV 418
           ++  ++HLV
Sbjct: 64  KEGHSVHLV 72


>UniRef50_Q5KN72 Cluster: Uv excision repair protein rhp23,
           putative; n=2; Filobasidiella neoformans|Rep: Uv
           excision repair protein rhp23, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 406

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 40/67 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I  KT+  K  T++ + SDT+ ++K KIQ+ +  P   Q+L ++GK L D  ++    
Sbjct: 2   VKITFKTVQNKLFTVDAQDSDTVADLKKKIQETQTFPVENQKLIYSGKILNDASSVESLK 61

Query: 447 IQKESTL 427
           I+++  L
Sbjct: 62  IKEKDFL 68


>UniRef50_Q5KMP1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 396

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 34/58 (58%)
 Frame = -1

Query: 591 ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           +T+ V P   +  +K  I  K  +  ++QRL ++GK L+D  T+S Y IQ   T+H+V
Sbjct: 25  LTISVSPDKNVAELKQLIASKCDVEKDRQRLIYSGKVLKDEETISSYKIQNGHTIHMV 82


>UniRef50_Q2UTN9 Cluster: Nucleotide excision repair factor NEF2;
           n=13; Pezizomycotina|Rep: Nucleotide excision repair
           factor NEF2 - Aspergillus oryzae
          Length = 403

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/62 (33%), Positives = 38/62 (61%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           + VK L  +   ++ EPS+T+  VK KI  ++G    Q +L ++GK L+D + +  YNI+
Sbjct: 28  VAVKDLKQQKFVIDAEPSETVGQVKEKISKEKGWEVPQLKLIYSGKILQDDKAIESYNIE 87

Query: 441 KE 436
           ++
Sbjct: 88  EK 89


>UniRef50_Q7QWK0 Cluster: GLP_538_1417_1800; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_538_1417_1800 - Giardia lamblia ATCC
           50803
          Length = 127

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDK-EGIPPNQQRLXFAGKQLEDGRTLSDY 451
           MQ+ V++L  +T+ L   P+D++ +++ ++     G   + QR  FAG+ L++ +TL DY
Sbjct: 1   MQLIVRSLD-RTVALTASPADSLTSIRQRLLAVYSGHVVDSQRFVFAGRTLDEAKTLGDY 59

Query: 450 NIQKESTLHLV 418
           +I + S L LV
Sbjct: 60  SIGESSVLDLV 70


>UniRef50_Q4YYI6 Cluster: Ubiquitin-like protein, putative; n=3;
           Plasmodium (Vinckeia)|Rep: Ubiquitin-like protein,
           putative - Plasmodium berghei
          Length = 1370

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/70 (31%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I VK++  +     V+ + T E +K  I +K+ +  N  RL + G+ L + +T+++YN
Sbjct: 6   IKIKVKSIDNQECEFCVKKNTTTEELKGMISEKKNVDINDIRLIYQGQCLSNTKTIAEYN 65

Query: 447 IQKESTLHLV 418
           IQ +  +HLV
Sbjct: 66  IQNDHIIHLV 75


>UniRef50_Q17KT4 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 214

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 26/53 (49%), Positives = 35/53 (66%)
 Frame = +1

Query: 469 SIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDLKGDGLAREGLYENLH 627
           +IF+LL+ + + LLI RD    L F   IL+ I R D+K  GLAR+GL E+LH
Sbjct: 136 AIFRLLADEDETLLIWRDCPPGLGFGLDILERIGRFDIKVAGLARQGLNEHLH 188


>UniRef50_A2F4J1 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 325

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/69 (36%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I +K  TG++  +    SDTI ++K +I  K G+ P QQRL F GK L D  ++  Y 
Sbjct: 9   VMIRIKRTTGRSFIVSASRSDTILSIKERITTKTGLFPRQQRLVFQGKVLVDELSVGFYT 68

Query: 447 IQKESTLHL 421
                T++L
Sbjct: 69  SLNCPTMYL 77


>UniRef50_UPI00015A6B69 Cluster: hypothetical protein LOC445284;
           n=1; Danio rerio|Rep: hypothetical protein LOC445284 -
           Danio rerio
          Length = 385

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQI +KTL  +TI ++++   T++ +K KI+ ++G    P   Q+L +AGK L+D   + 
Sbjct: 1   MQITLKTLQQQTIQIDIDDEQTVKALKEKIEAEKGRDSFPVAGQKLIYAGKILQDDTPIK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>UniRef50_Q6AXI3 Cluster: Zgc:92001; n=10; Coelomata|Rep: Zgc:92001
           - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 362

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQI +KTL  +TI ++++   T++ +K KI+ ++G    P   Q+L +AGK L+D   + 
Sbjct: 1   MQITLKTLQQQTIQIDIDDEQTVKALKEKIEAEKGRDSFPVAGQKLIYAGKILQDDTPIK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>UniRef50_Q554E9 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/69 (36%), Positives = 41/69 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKT T  T +L+V P+D +E +  K+ ++  +   Q  L FAG+ ++   T+  + 
Sbjct: 1   MIILVKTST-VTFSLDVNPADKVEVLIKKVCERTSMSEYQFNLVFAGEPMDVQATIGSHG 59

Query: 447 IQKESTLHL 421
           I+KE T+HL
Sbjct: 60  IKKEGTIHL 68


>UniRef50_Q96PU4 Cluster: E3 ubiquitin-protein ligase UHRF2; n=26;
           Euteleostomi|Rep: E3 ubiquitin-protein ligase UHRF2 -
           Homo sapiens (Human)
          Length = 802

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>UniRef50_Q84L31 Cluster: Putative DNA repair protein RAD23-3; n=12;
           Magnoliophyta|Rep: Putative DNA repair protein RAD23-3 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 419

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M+IFVKTL G    +EV+P D++ +VK  I+  +G    P  +Q L   GK L+D  T+ 
Sbjct: 1   MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE 60

Query: 456 DYNIQKES 433
           +  + + S
Sbjct: 61  ENKVAENS 68


>UniRef50_UPI0001554DB9 Cluster: PREDICTED: similar to inhibitor of
           kappa light polypeptide gene enhancer in B-cells, kinase
           complex-associated protein; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to inhibitor of kappa
           light polypeptide gene enhancer in B-cells, kinase
           complex-associated protein - Ornithorhynchus anatinus
          Length = 234

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 1/55 (1%)
 Frame = -1

Query: 600 GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY-NIQK 439
           G+T  L+V  +D++  V+  IQ+K G+PP  Q +   GK+LE G+T+++Y  +QK
Sbjct: 168 GQTYPLQVRRTDSVAAVQKMIQEKTGVPPQFQVVICNGKRLEAGKTMAEYGTLQK 222


>UniRef50_UPI0000D9A46C Cluster: PREDICTED: RAD23 homolog B (S.
           cerevisiae); n=1; Macaca mulatta|Rep: PREDICTED: RAD23
           homolog B (S. cerevisiae) - Macaca mulatta
          Length = 137

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD---KEGIPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  ++  ++++P +T++ +K KI+    KE  P   Q+L +AG+ L D   L 
Sbjct: 1   MQVTLKTLQPQSFKIDIDPEETVKALKEKIESEKAKEASPVAGQKLIYAGEILNDDAALK 60

Query: 456 DYNIQKE 436
           +Y I ++
Sbjct: 61  EYKIDEK 67


>UniRef50_Q8LF25 Cluster: DNA-damage inducible protein DDI1-like;
           n=7; Magnoliophyta|Rep: DNA-damage inducible protein
           DDI1-like - Arabidopsis thaliana (Mouse-ear cress)
          Length = 414

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/70 (31%), Positives = 42/70 (60%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+I V T   + ITL+V+  +T+ENVKA ++ +  +P  QQ+L + G ++ +   LS   
Sbjct: 1   MRITVMTAGEQIITLDVDSQETVENVKALLEVESNVPIQQQQLLYNGNEMGNSDKLSALG 60

Query: 447 IQKESTLHLV 418
           ++ +  L ++
Sbjct: 61  VKDDDLLMMM 70


>UniRef50_A5AB45 Cluster: Remark: Dsk2p is a nuclear-enriched
           protein; n=2; Ascomycota|Rep: Remark: Dsk2p is a
           nuclear-enriched protein - Aspergillus niger
          Length = 361

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKE--GIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           VK+      TL +  S ++ ++K K+   E    P  +QRL ++G+ L+D  TL+ YNI+
Sbjct: 17  VKSSNDAKYTLTLPSSTSVSDLKEKLASSEYADTPAERQRLIYSGRVLKDNETLATYNIK 76

Query: 441 KESTLHLV 418
              T+HLV
Sbjct: 77  DGHTIHLV 84


>UniRef50_Q0P460 Cluster: Zgc:153389; n=3; Danio rerio|Rep:
           Zgc:153389 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 156

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/70 (35%), Positives = 41/70 (58%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  ++ T  V    T++  K  I     I  ++QRL + GK L+D RTL++YN
Sbjct: 7   IEVTVKTLDSQSRTFTVRGEWTVKQFKEHIAASVEISVDKQRLIYQGKVLQDERTLTEYN 66

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 67  VDGK-VIHLV 75


>UniRef50_Q7XD49 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 280

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = -1

Query: 576 EPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLED--GRTLSDYNIQKEST 430
           EPSDT+E+VKAKI+D  GI  +   L + GKQ+++   RTL+DY I   +T
Sbjct: 26  EPSDTVESVKAKIKDMSGITEDFW-LRYDGKQMDEVGSRTLADYGIHDPAT 75



 Score = 36.3 bits (80), Expect = 0.64
 Identities = 16/28 (57%), Positives = 23/28 (82%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVK 547
           +M+IFV+ L G T TL V+PSDT+++VK
Sbjct: 76  EMEIFVRGLMGNTRTLWVKPSDTVKSVK 103


>UniRef50_O03991 Cluster: RAD23 protein, isoform II; n=1; Daucus
           carota|Rep: RAD23 protein, isoform II - Daucus carota
           (Carrot)
          Length = 379

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD---KEGIPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    +  +P+DT+  +K  I+D   K+  P  QQ L   GK L+D  TL+
Sbjct: 1   MKLTVKTLKGSHFEIRAQPNDTVMAIKKNIEDLQGKDNYPCGQQLLIHNGKVLKDESTLA 60

Query: 456 DYNIQKESTL 427
           +  I ++  L
Sbjct: 61  ESKISEDGFL 70


>UniRef50_A7PXI1 Cluster: Chromosome chr12 scaffold_36, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr12 scaffold_36, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 252

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQL-EDGRTLSD 454
           K+QI +K  + + I++EV+ ++T+ ++K KI   EG P  +  L F+G ++ ED R LS+
Sbjct: 84  KIQIIIK-FSARQISIEVDRTETVGSLKEKIHIIEGTPIKRMILYFSGTEMEEDFRNLSE 142

Query: 453 YNIQKESTL 427
           Y I++ S +
Sbjct: 143 YGIREFSEI 151



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 19/66 (28%), Positives = 35/66 (53%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ + T T +  ++++   + +  +K KI+   G+P   Q L  +G +L DG  + DY 
Sbjct: 1   MRVIITTRTCE-FSIDIGLQEPVLEIKHKIEQLHGVPVALQTLSVSGWELMDGLDMEDYP 59

Query: 447 IQKEST 430
           I  E T
Sbjct: 60  IVTEGT 65


>UniRef50_O44803 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 110

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/70 (40%), Positives = 36/70 (51%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           K Q FV+ L GKT TL V  SDT+E  K ++           R+ + GK L D  T  +Y
Sbjct: 42  KFQYFVR-LNGKTRTLNVNASDTVEQGKMQLCHN----ARSTRMSYGGKPLSDQITFGEY 96

Query: 450 NIQKESTLHL 421
           NI   ST+ L
Sbjct: 97  NISNNSTMDL 106


>UniRef50_Q4PG40 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 422

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQ-DKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++I +K  +   + +E+    T+  +K  I+  K  +P + QRL +AGK L+D   LS Y
Sbjct: 11  LKINIKGPSDLKLAIEITSDQTVRQLKEAIEKQKPDVPADAQRLIYAGKVLKDEEALSVY 70

Query: 450 NIQKESTLHLV 418
            ++  +T+H+V
Sbjct: 71  KVKDGNTIHMV 81


>UniRef50_Q8N7F7 Cluster: Ubiquitin-like protein 4B; n=9;
           Eutheria|Rep: Ubiquitin-like protein 4B - Homo sapiens
           (Human)
          Length = 174

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + VK L G+  +L+V   +++  +K  +  +  +P  QQ L F G+ LED + LSDY 
Sbjct: 1   MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYC 60

Query: 447 IQKESTLHLV 418
           I   ++++++
Sbjct: 61  IGPNASINVI 70


>UniRef50_O60260 Cluster: Parkin; n=71; Eumetazoa|Rep: Parkin - Homo
           sapiens (Human)
          Length = 465

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>UniRef50_P48510 Cluster: Ubiquitin domain-containing protein DSK2;
           n=11; Saccharomycetales|Rep: Ubiquitin domain-containing
           protein DSK2 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 373

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           + V P  T+   K  I    GIP   QRL ++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 16  VNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71


>UniRef50_UPI000058738C Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 152

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLT--GKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M + VK L   GK   +EV   ++I +VK  +  +  +P + QRL F GK L DG++L  
Sbjct: 1   MLLIVKILQAPGKECRIEVTDVESIVSVKRMVAREFDVPVHLQRLVFRGKTLADGQSLDF 60

Query: 453 YNIQKESTLHLV 418
           Y I   + +HLV
Sbjct: 61  YKIGPGTKIHLV 72


>UniRef50_Q3ECA5 Cluster: Uncharacterized protein At1g79650.3; n=2;
           Arabidopsis thaliana|Rep: Uncharacterized protein
           At1g79650.3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 351

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           M++ VKTL G    + V PSDTI  VK  I+D +G    P  QQ L   GK L+D  +L 
Sbjct: 1   MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV 60

Query: 456 DYNIQKESTL 427
           +  + +E  L
Sbjct: 61  ENKVTEEGFL 70


>UniRef50_Q015S3 Cluster: Ubiquitin-conjugating enzyme 9 homolog;
           n=1; Ostreococcus tauri|Rep: Ubiquitin-conjugating
           enzyme 9 homolog - Ostreococcus tauri
          Length = 353

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 20/45 (44%), Positives = 31/45 (68%)
 Frame = +1

Query: 469 SIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDLKGDGLAR 603
           ++ +LL+ + Q LLI RD L +L+   H++DG+  L L+GDGL R
Sbjct: 144 AVLELLTREDQTLLIRRDPLLILDLRLHVVDGVRGLHLQGDGLTR 188


>UniRef50_Q8I2T2 Cluster: Ubiquitin-like protein, putative; n=2;
           Plasmodium|Rep: Ubiquitin-like protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 1542

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/73 (32%), Positives = 41/73 (56%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  ++I +K++  +   L V+    IE +K+ I +K  +  N  RL + G+ L + + L 
Sbjct: 5   RNTIKIKIKSINNEEYELNVKDDMNIEELKSIIAEKRNVNINDIRLIYQGQCLLNEKKLY 64

Query: 456 DYNIQKESTLHLV 418
           DYNIQ +  +HLV
Sbjct: 65  DYNIQNDHIIHLV 77


>UniRef50_O44820 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 197

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLE---DGRTLS 457
           ++I+V+   G+T TL+   SDT+ +VKAKI +K  I PN Q+L      L+   D  TL 
Sbjct: 103 IRIYVEN-AGRTCTLDTSASDTMASVKAKIWEKLRILPNTQKLLLENWDLDLFSDHSTLF 161

Query: 456 DYNIQKESTLHL 421
           D + +  STL L
Sbjct: 162 DNSFENGSTLRL 173


>UniRef50_A0RUP3 Cluster: Ribosomal protein S27AE; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein S27AE - Cenarchaeum
           symbiosum
          Length = 55

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = -1

Query: 324 VLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST 187
           V RFYK+ E+GK  +LR  C+  +CG G FMA  +DR  CGKC  T
Sbjct: 9   VHRFYKI-EDGKTVKLRHICS--RCGKGFFMAQHKDRRSCGKCGLT 51


>UniRef50_UPI0001509B75 Cluster: Ubiquitin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Ubiquitin family
           protein - Tetrahymena thermophila SB210
          Length = 1021

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 22/68 (32%), Positives = 43/68 (63%), Gaps = 2/68 (2%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY--NIQ 442
           +KTL+     L V  +  I++++ K+Q+  G+P ++QR+   G+QL D +T+ DY  + +
Sbjct: 23  IKTLSETVYELRVPANMLIKDLRIKVQEVSGVPADRQRMICMGQQLIDTKTVGDYAKDPE 82

Query: 441 KESTLHLV 418
           + + +HLV
Sbjct: 83  QPNWIHLV 90


>UniRef50_UPI0000DB7798 Cluster: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1; n=1; Apis mellifera|Rep: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1 - Apis mellifera
          Length = 568

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKT-ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M + V+T+ GK    L +     +E+ K +I+ +  I  + QRL F GKQLE+G  L DY
Sbjct: 1   MYVKVRTMDGKQEAILTISKLTEVEDFKHEIEKELHIKADLQRLFFRGKQLENGYKLYDY 60

Query: 450 NIQKESTLHLV 418
           N+     + L+
Sbjct: 61  NVNLNDVIQLM 71


>UniRef50_UPI000065FB66 Cluster: E3 ubiquitin-protein ligase UHRF1
           (EC 6.3.2.-) (Ubiquitin-like PHD and RING finger
           domain-containing protein 1) (Ubiquitin-like-containing
           PHD and RING finger domains protein 1) (Inverted CCAAT
           box-binding protein of 90 kDa) (Transcription factor
           ICBP90); n=1; Takifugu rubripes|Rep: E3
           ubiquitin-protein ligase UHRF1 (EC 6.3.2.-)
           (Ubiquitin-like PHD and RING finger domain-containing
           protein 1) (Ubiquitin-like-containing PHD and RING
           finger domains protein 1) (Inverted CCAAT box-binding
           protein of 90 kDa) (Transcription factor ICBP90) -
           Takifugu rubripes
          Length = 842

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ GK T  ++ +     ++ ++ KI +   + P +QRL + GKQ+EDG T+ D
Sbjct: 1   MWIQVRTMDGKETHRVDSLSKLTKVDELRQKIMELFKVEPERQRLFYRGKQMEDGHTIFD 60

Query: 453 YNIQKESTLHLV 418
           YN+     + L+
Sbjct: 61  YNVGLNDIVQLL 72


>UniRef50_Q4RRW6 Cluster: Chromosome 7 SCAF15001, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 7
           SCAF15001, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 280

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 20/69 (28%), Positives = 39/69 (56%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+ ++  TG+ + L V  +DT+  +K ++Q  EG+  + QR  F+G+ L D   L   NI
Sbjct: 208 QLRLRLSTGRDLRLAVRSTDTVGMMKRRLQSHEGVAASTQRWFFSGRPLTDRLRLDQLNI 267

Query: 444 QKESTLHLV 418
            ++  + ++
Sbjct: 268 SRDYVVQVI 276


>UniRef50_A7RNI9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 145

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 28/86 (32%), Positives = 41/86 (47%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VK L GK   LEV  ++ I  VK  +  +  +   +QRL + GK L D  +L +Y 
Sbjct: 1   MKVIVKILNGKEAELEVSETEPILAVKTLVAQELDVQVERQRLVYKGKTLADDCSLDEYL 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYS 370
           I   S L+L             KNY+
Sbjct: 61  IGDGSKLYLSIKKLSSQPGSSQKNYA 86


>UniRef50_Q8WUN7 Cluster: Ubiquitin domain-containing protein 2;
           n=43; Eukaryota|Rep: Ubiquitin domain-containing protein
           2 - Homo sapiens (Human)
          Length = 234

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+ ++  TGK + L V  +DT+ ++K ++   EG+ P  QR  F+G+ L D     +  I
Sbjct: 153 QLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKI 212

Query: 444 QKESTLHLV 418
            K+  + ++
Sbjct: 213 PKDYVVQVI 221


>UniRef50_Q5CR28 Cluster: DSK2 like protein with a ubiquitin domain,
           2 STI1 motifs and a UBA domain at its C-terminus; n=2;
           Cryptosporidium|Rep: DSK2 like protein with a ubiquitin
           domain, 2 STI1 motifs and a UBA domain at its C-terminus
           - Cryptosporidium parvum Iowa II
          Length = 402

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/71 (29%), Positives = 38/71 (53%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ I  K   G    + V  +  ++++K KI +   IP +QQRL + G+ L+D  +L   
Sbjct: 53  EISIVFKVSGGTQFNISVPRNTIVKDLKDKISEPSNIPSSQQRLIYKGRILKDSDSLDGM 112

Query: 450 NIQKESTLHLV 418
            ++   T+HLV
Sbjct: 113 KVESGHTMHLV 123


>UniRef50_Q54QA5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 836

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/70 (38%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M I +K L G   ++E V    T+  +K  I+ K  I    QR+ + GK L D +TL  Y
Sbjct: 1   MNINIKKLDGTIYSIEGVTLETTVPELKKLIEAKSSISIPLQRVIYKGKVLRDDKTLQFY 60

Query: 450 NIQKESTLHL 421
           NI+   TLHL
Sbjct: 61  NIEDGVTLHL 70


>UniRef50_Q4H2N4 Cluster: Ci-UHRF2 protein; n=3; Deuterostomia|Rep:
           Ci-UHRF2 protein - Ciona intestinalis (Transparent sea
           squirt)
          Length = 743

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLE--VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ GK       +     IE+++  I +K  + P+ QRL F GKQLEDG +L D
Sbjct: 1   MWIRVRTMDGKRSEQVDGLSKLTKIEDLRELIMEKFSVEPSLQRLFFRGKQLEDGYSLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++   + + L+
Sbjct: 61  YDVGLNALVQLL 72


>UniRef50_A5K6T6 Cluster: Ubiquitin-like protein, putative; n=1;
           Plasmodium vivax|Rep: Ubiquitin-like protein, putative -
           Plasmodium vivax
          Length = 1441

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/70 (28%), Positives = 41/70 (58%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           ++I +K++  +   L V+   + E +K  I +++ +     RL + G+ L + ++++DYN
Sbjct: 7   IKIKIKSIDNEEFELAVKGETSAEEIKNTIAERKSVDKQDIRLIYQGQCLANEKSVADYN 66

Query: 447 IQKESTLHLV 418
           IQ E  +HLV
Sbjct: 67  IQNEHIIHLV 76


>UniRef50_Q8LRK9 Cluster: Transcription initiation factor TFIID
           subunit 1-A; n=4; core eudicotyledons|Rep: Transcription
           initiation factor TFIID subunit 1-A - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 1919

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQ-RLXFAGKQLEDGRTL 460
           R  M+I VK+L GK   L V   +++ +++AK   K      +  ++ + GK+L+D ++L
Sbjct: 658 RGSMKIIVKSLGGKGSKLHVGIEESVSSLRAKASRKLDFKETEAVKMFYKGKELDDEKSL 717

Query: 459 SDYNIQKESTLHLV 418
           +  N+Q  S +HL+
Sbjct: 718 AAQNVQPNSLVHLI 731


>UniRef50_UPI000023F381 Cluster: hypothetical protein FG08156.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG08156.1 - Gibberella zeae PH-1
          Length = 424

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/62 (30%), Positives = 38/62 (61%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ + V++L    I+L+   +DT+   KA+ + KE +P +  R  +  +QLED  TL++Y
Sbjct: 196 EITLMVQSLNRGYISLKASQADTVAEFKARFEAKEKVPADLLRFTYGRRQLEDHETLAEY 255

Query: 450 NI 445
           ++
Sbjct: 256 HL 257


>UniRef50_Q7PRQ2 Cluster: ENSANGP00000017457; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017457 - Anopheles gambiae
           str. PEST
          Length = 300

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVE-PSDTIENVKAKIQDKEGI--PPNQQRLXFAGKQLEDGRTLS 457
           M+I +KTL  +T  +EV+   DT+  +K K+  + G+  P ++QRL + GK +ED   LS
Sbjct: 1   MKITLKTLKQQTFFVEVDVEQDTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLS 60

Query: 456 DYNI 445
            Y +
Sbjct: 61  QYKL 64


>UniRef50_Q5CUV4 Cluster: UB domain containing protein; n=3;
           Eukaryota|Rep: UB domain containing protein -
           Cryptosporidium parvum Iowa II
          Length = 1023

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/71 (32%), Positives = 38/71 (53%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           + +I V+ L G+ +T+E   + TI  +K  I+ + GI    QRL F G+ + D  T+  Y
Sbjct: 88  RFKIVVRPLNGRDLTVEASQTSTIRQLKVLIEVQSGIEAINQRLIFRGRCMLDDDTVGTY 147

Query: 450 NIQKESTLHLV 418
             +    +HLV
Sbjct: 148 IKEDGVIIHLV 158


>UniRef50_Q5BXC3 Cluster: SJCHGC06167 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC06167 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 231

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M++  KTL  +T  L+++  D + +VK KI+ + G     + Q+L  +GK +ED ++L D
Sbjct: 1   MKVTFKTLKQQTFVLDLQEDDLVGDVKKKIEAERGSEFDASTQKLIHSGKVMEDSKSLKD 60

Query: 453 YNI 445
           Y +
Sbjct: 61  YKV 63


>UniRef50_Q54LV1 Cluster: RepC-binding protein A; n=2; Dictyostelium
           discoideum|Rep: RepC-binding protein A - Dictyostelium
           discoideum AX4
          Length = 342

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ +K +  +    EV    T+  +K  I +K    P+ Q L ++GK LED RTL  YN
Sbjct: 1   MKVTIKNINKEIYVFEVNGDLTVAELKNLISEKHNQTPSWQTLIYSGKILEDKRTLESYN 60

Query: 447 I 445
           I
Sbjct: 61  I 61


>UniRef50_Q4Q6V9 Cluster: UV excision repair RAD23-like protein;
           n=3; Leishmania|Rep: UV excision repair RAD23-like
           protein - Leishmania major
          Length = 425

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/69 (36%), Positives = 40/69 (57%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ +KT+TGK   ++VE + TI +VK  ++D+    P   RL F G  LED   L+D  
Sbjct: 1   MKVILKTITGKQHEVDVEATSTILDVKRLLEDE--YEPASLRLCFNGAVLEDSMMLADAG 58

Query: 447 IQKESTLHL 421
           ++   +L L
Sbjct: 59  VKDNDSLVL 67


>UniRef50_A7RES3 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 762

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/62 (35%), Positives = 36/62 (58%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ ITL +  +D +  +KAKI +  G+P  +Q+L   G  ++D  +L+ YN    ST+
Sbjct: 691 LEGQLITLALPLTDQVSVIKAKIHETIGMPAGKQKLQLGGIFIKDSNSLAYYNFGPASTV 750

Query: 426 HL 421
            L
Sbjct: 751 QL 752


>UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_117,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1189

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/87 (31%), Positives = 42/87 (48%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           + QIF++    K+I + +  +  +E +K KI  K  IP   Q+L + GK L++  TL DY
Sbjct: 318 EQQIFIQYSGSKSIKVNILTTTVLE-LKQKIYHKLNIPTTFQQLHYVGKVLDNTGTLQDY 376

Query: 450 NIQKESTLHLVXXXXXXXXXXXXKNYS 370
            IQ  S + L              NY+
Sbjct: 377 GIQNLSNIILTFKALDSYPFQQSYNYN 403


>UniRef50_A2AB51 Cluster: HLA-B associated transcript 3; n=36;
           Eutheria|Rep: HLA-B associated transcript 3 - Homo
           sapiens (Human)
          Length = 244

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>UniRef50_Q6MVN0 Cluster: Related to ubiquitin-like protein DSK2;
           n=6; Pezizomycotina|Rep: Related to ubiquitin-like
           protein DSK2 - Neurospora crassa
          Length = 431

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKI--QDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           VK    K  T+ +  S T+  +K  +  ++ E I P QQRL ++GK ++D   LS Y I+
Sbjct: 17  VKCSGDKNHTVTIAESATVLQLKTLLAGEEYENISPEQQRLIYSGKVMKDDEVLSFYKIK 76

Query: 441 KESTLHLV 418
             +T+H+V
Sbjct: 77  HMNTVHMV 84


>UniRef50_A4RL24 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 418

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 2/85 (2%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKI--QDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           VKT   +  T+ +  S T+ ++K K+  +D E IP   QRL ++G+ +++   LS Y I+
Sbjct: 22  VKTSGDRNHTITMAESATVLDLKQKLAGEDLENIPVEHQRLIYSGRVMKNTDLLSVYKIK 81

Query: 441 KESTLHLVXXXXXXXXXXXXKNYST 367
             +T+HLV               ST
Sbjct: 82  DGNTVHLVKSAASNRASAAAGTSST 106


>UniRef50_P46379 Cluster: Large proline-rich protein BAT3; n=108;
           Theria|Rep: Large proline-rich protein BAT3 - Homo
           sapiens (Human)
          Length = 1132

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>UniRef50_UPI0000D557CB Cluster: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1; n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1 - Tribolium castaneum
          Length = 715

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/72 (30%), Positives = 42/72 (58%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           V+++    T     + L V  + +I+ ++A IQ+K     N+Q+L + GKQL +G T++D
Sbjct: 3   VRIRELSSTSKDNDLILVVSKTTSIKKLQAMIQNKLKTEINRQKLYYRGKQLIEGHTIAD 62

Query: 453 YNIQKESTLHLV 418
           Y+I+    + L+
Sbjct: 63  YDIKLNDVIQLL 74


>UniRef50_A2EN73 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 198

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/68 (35%), Positives = 39/68 (57%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           QIFV++   +     V  +  ++ +K  I D +GI  +QQRL F G Q+E+ + L DY+I
Sbjct: 125 QIFVQSRDKRYEFKHVNTNIPVKQLKKMIFDIDGIAIDQQRLLFRGIQIENDKLLKDYDI 184

Query: 444 QKESTLHL 421
           +    +HL
Sbjct: 185 RDLCVIHL 192


>UniRef50_P54725 Cluster: UV excision repair protein RAD23 homolog
           A; n=21; Eutheria|Rep: UV excision repair protein RAD23
           homolog A - Homo sapiens (Human)
          Length = 363

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 5   ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 64

Query: 450 NIQKES 433
            I +++
Sbjct: 65  RIDEKN 70


>UniRef50_Q9DVY9 Cluster: PxORF43 peptide; n=2; Granulovirus|Rep:
           PxORF43 peptide - Plutella xylostella granulovirus
          Length = 414

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/41 (60%), Positives = 27/41 (65%)
 Frame = +2

Query: 506 C*LGGIPSLS*ILAFTFSMVSDGSTSRVMVLPVRVFTKICI 628
           C   G  SLS I  F  ++ S  STS VMVLPVRVFTKICI
Sbjct: 4   CWSTGTLSLSAIFCFRSAIESVDSTSTVMVLPVRVFTKICI 44


>UniRef50_Q9FY81 Cluster: Ubiquitin-like protein; n=1; Arabidopsis
           thaliana|Rep: Ubiquitin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 79

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGK---QLEDGRTLS 457
           MQ+F+    GK   +EVE + TI ++K KI D  G+    Q L   GK   ++  G T+ 
Sbjct: 1   MQVFIIDEDGKKYCVEVEKTTTIADMKTKIYDATGMENAYQYLEHRGKIVLEVHGGTTMD 60

Query: 456 DYNIQKESTLHL 421
           DY I+     H+
Sbjct: 61  DYKIKACDIFHM 72


>UniRef50_Q7XBP5 Cluster: Putative uncharacterized protein; n=1;
           Bigelowiella natans|Rep: Putative uncharacterized
           protein - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 200

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQ-RLXFAGKQ--LEDGRTLS 457
           +++FVKTL GKT  +EV+P DTI++ K KI +  G+       + F G Q      +TL 
Sbjct: 7   LRVFVKTLEGKTSPIEVDPKDTIQSFKQKIVETMGLDLTPDCIILFKGNQPLKSQSQTLM 66

Query: 456 DYNIQKESTLHLV 418
              ++++S   ++
Sbjct: 67  ALKVEEDSEFRML 79


>UniRef50_UPI00015B5080 Cluster: PREDICTED: similar to NP95; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to NP95 -
           Nasonia vitripennis
          Length = 740

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTIT-LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M + V T+ GK  T L V     I  +KA I+++ GI   +Q L F GK LED  TL DY
Sbjct: 1   MYVQVVTIDGKKKTVLNVSKLTKIAALKADIEEEFGIKKAKQGLFFRGKHLEDDCTLYDY 60

Query: 450 NIQKESTLHLV 418
           +I   + + ++
Sbjct: 61  SININNVIQVL 71


>UniRef50_Q9XZE0 Cluster: DHR23; n=5; Sophophora|Rep: DHR23 -
           Drosophila melanogaster (Fruit fly)
          Length = 414

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M I +K L  +T T+E  P  T+  +K KI ++ G      +Q+L +AG  L D RT+  
Sbjct: 1   MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGS 60

Query: 453 YNIQKE 436
           YN+ ++
Sbjct: 61  YNVDEK 66


>UniRef50_Q9VWD9 Cluster: CG14224-PA; n=4; Endopterygota|Rep:
           CG14224-PA - Drosophila melanogaster (Fruit fly)
          Length = 547

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 26/71 (36%), Positives = 39/71 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ + VKT   K  T+EV+    I++ K  +  K    P Q  L FAGK ++D  TL  +
Sbjct: 8   RINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMH 66

Query: 450 NIQKESTLHLV 418
           NI+   T+HLV
Sbjct: 67  NIKDNLTVHLV 77


>UniRef50_Q1JTK9 Cluster: DNA repair protein rad23 homolog b,
           putative; n=1; Toxoplasma gondii RH|Rep: DNA repair
           protein rad23 homolog b, putative - Toxoplasma gondii RH
          Length = 380

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDK-EGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M++ ++TL+ +   LEV   +T+ NVK K++ +   +P  +Q+L  AGK L D + + D 
Sbjct: 1   MKLRIRTLSNEEAELEVGAEETVLNVKEKVEQRWPHMPAARQKLVHAGKILADAQKIKDC 60

Query: 450 NIQKES 433
           +  KE+
Sbjct: 61  SALKEN 66


>UniRef50_Q8SUA1 Cluster: Putative uncharacterized protein
           ECU10_1730; n=1; Encephalitozoon cuniculi|Rep: Putative
           uncharacterized protein ECU10_1730 - Encephalitozoon
           cuniculi
          Length = 275

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 3/66 (4%)
 Frame = -1

Query: 609 TLTGKTITLEVEP--SDTIENVKAKIQDKEGIPPNQQRLXFAGKQL-EDGRTLSDYNIQK 439
           T+  +T ++E     +D++E++K KIQD  GIP + Q L F  + L ED + L D  I+ 
Sbjct: 6   TIRYRTDSIEANAMMTDSLESLKLKIQDITGIPVDSQVLLFNDRILSEDNKELKDLGIEN 65

Query: 438 ESTLHL 421
           +  LHL
Sbjct: 66  DCVLHL 71


>UniRef50_Q80LS9 Cluster: Putative uncharacterized protein; n=1;
           Adoxophyes honmai NPV|Rep: Putative uncharacterized
           protein - Adoxophyes honmai nucleopolyhedrovirus
          Length = 63

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = +2

Query: 560 MVSDGSTSRVMVLPVRVFTKICIF 631
           MVS  STS+VMVLPVRVFTKICIF
Sbjct: 1   MVSLFSTSKVMVLPVRVFTKICIF 24


>UniRef50_Q7XCL2 Cluster: Ubiquitin family protein, expressed; n=6;
           Oryza sativa|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 575

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 18/68 (26%), Positives = 35/68 (51%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           + ++   G   T+  +   T+   K  +     +P  QQRL + G+ L+D +TL  Y ++
Sbjct: 32  LHIRCANGSKFTVRADLDATVGAFKEVVAGSCDVPAAQQRLIYKGRILKDEQTLESYGVE 91

Query: 441 KESTLHLV 418
            + T+H+V
Sbjct: 92  TDHTIHMV 99


>UniRef50_A6N155 Cluster: Polyubiquitin containing 7 ubiquitin
           monomers; n=3; Eukaryota|Rep: Polyubiquitin containing 7
           ubiquitin monomers - Oryza sativa subsp. indica (Rice)
          Length = 99

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/45 (48%), Positives = 27/45 (60%)
 Frame = -2

Query: 536 KTKRESLPINRG*XLLESSWKMDVPXRTTISRRNPPSTWC*GFVV 402
           +T+R     +    LL SSW+M  P  TT SRR+PPST C  FVV
Sbjct: 6   RTRRAFPRTSSASSLLASSWRMAGPLLTTTSRRSPPSTLCSAFVV 50


>UniRef50_A7SRL4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 364

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQ---DKEGIPPNQQRLXFAGKQLEDGRTLS 457
           M I  KTL  +T  +E+   +T+  +K KI+    K+  P    +L +AGK L D   L 
Sbjct: 1   MIITFKTLQQQTFKVEIGEDETVLKLKQKIEADKGKDAYPHGNIKLIYAGKILNDDNPLK 60

Query: 456 DYNIQKES 433
           +YNI ++S
Sbjct: 61  EYNIDEKS 68


>UniRef50_P05161 Cluster: Interferon-induced 17 kDa protein
           precursor [Contains: Ubiquitin cross-reactive protein
           (hUCRP) (Interferon-induced 15 kDa protein)]; n=17;
           Eutheria|Rep: Interferon-induced 17 kDa protein
           precursor [Contains: Ubiquitin cross-reactive protein
           (hUCRP) (Interferon-induced 15 kDa protein)] - Homo
           sapiens (Human)
          Length = 165

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>UniRef50_Q6M029 Cluster: 30S ribosomal protein S27ae; n=6;
           Euryarchaeota|Rep: 30S ribosomal protein S27ae -
           Methanococcus maripaludis
          Length = 67

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = -1

Query: 315 FYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDDDK 163
           +YKV+ N  + RL++ C   +CGAGVFMA   +R  CGKC   M +K ++K
Sbjct: 16  YYKVEGN-TVERLKKVCP--KCGAGVFMAEHLNRFACGKC-GYMEYKKNEK 62


>UniRef50_Q9M0X2 Cluster: Putative uncharacterized protein
           AT4g05230; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein AT4g05230 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 206

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 22/69 (31%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +F +T +G T  +E+   DT+  +K KI+  + IP ++Q L F G  L+D   +    
Sbjct: 1   MDVFFETRSGSTFEIELGYWDTVLEIKQKIEKYQRIPVSKQTLLFQGNVLQDHLDIEQCV 60

Query: 447 IQKESTLHL 421
           I   S + L
Sbjct: 61  ILNHSRIQL 69


>UniRef50_Q10S80 Cluster: Ubiquitin family protein, expressed; n=15;
           Magnoliophyta|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 534

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 17/68 (25%), Positives = 38/68 (55%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQ 442
           + ++   G  + +  +   ++   KA + +   +P  QQRL + G+ L+D +TL+ Y ++
Sbjct: 18  LHIRCTNGSKLAVRADLGLSVGAFKAIVAESCDVPAPQQRLIYKGRILKDEQTLASYGVE 77

Query: 441 KESTLHLV 418
            + T+H+V
Sbjct: 78  TDHTIHMV 85


>UniRef50_Q17JC6 Cluster: Uv excision repair protein rad23; n=1;
           Aedes aegypti|Rep: Uv excision repair protein rad23 -
           Aedes aegypti (Yellowfever mosquito)
          Length = 347

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 3/64 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVE-PSDTIENVKAKI--QDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           M+I +KTL  +   +EV+   DT+  +K K   + K+  P  +QRL + GK +ED   LS
Sbjct: 1   MKITIKTLKQEAFQIEVDVEKDTVRTLKEKFFQESKQDYPVERQRLIYLGKIMEDDLPLS 60

Query: 456 DYNI 445
            Y++
Sbjct: 61  HYSL 64


>UniRef50_Q6BXC6 Cluster: Debaryomyces hansenii chromosome B of
           strain CBS767 of Debaryomyces hansenii; n=4;
           Saccharomycetales|Rep: Debaryomyces hansenii chromosome
           B of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 373

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/67 (29%), Positives = 38/67 (56%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQI  K    + I +EV+ SDT+   K K+  ++    +Q +  ++GK L+D +TL  + 
Sbjct: 1   MQIIFKDFKKQKIPIEVDLSDTVLATKEKLASEKDCEVSQLKFVYSGKVLQDEKTLESFK 60

Query: 447 IQKESTL 427
           I++  ++
Sbjct: 61  IKEGDSI 67


>UniRef50_Q15459 Cluster: Splicing factor 3 subunit 1; n=43;
           Coelomata|Rep: Splicing factor 3 subunit 1 - Homo
           sapiens (Human)
          Length = 793

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ +   +  +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +
Sbjct: 722 LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVI 781

Query: 426 HL 421
           HL
Sbjct: 782 HL 783


>UniRef50_UPI0000F2EC07 Cluster: PREDICTED: similar to interferon
           stimulated gene 17, partial; n=1; Monodelphis
           domestica|Rep: PREDICTED: similar to interferon
           stimulated gene 17, partial - Monodelphis domestica
          Length = 154

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I V+    +  +  ++ S T+  +K  +Q+KEG+  +Q  L F GK +ED   L DY 
Sbjct: 79  MDILVRN-NNQINSYRIQLSQTVAQLKKMLQEKEGVSVSQFWLSFDGKPMEDNEYLGDYG 137

Query: 447 IQKESTLHL 421
           +    T+ +
Sbjct: 138 LSPLCTIQM 146


>UniRef50_Q00Y37 Cluster: Chromosome 12 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 12 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 57

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 20/21 (95%), Positives = 20/21 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSD 565
           MQIFVKTLTGKTITLEVE SD
Sbjct: 35  MQIFVKTLTGKTITLEVESSD 55


>UniRef50_A3BJX7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 53

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 23/33 (69%), Positives = 26/33 (78%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDK 529
           MQIFV+TL  + ITLEVE SDTI +VK KI DK
Sbjct: 1   MQIFVRTLD-ECITLEVEGSDTIGDVKVKIHDK 32


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 529,007,480
Number of Sequences: 1657284
Number of extensions: 9649551
Number of successful extensions: 24986
Number of sequences better than 10.0: 367
Number of HSP's better than 10.0 without gapping: 24095
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24939
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -