SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8SYY6 Cluster: RE27904p; n=8; Coelomata|Rep: RE27904p ...   111   7e-24
UniRef50_Q7ZUJ1 Cluster: Zgc:56419; n=5; Euteleostomi|Rep: Zgc:5...    90   2e-17
UniRef50_Q9Y6X1 Cluster: Ribosome-attached membrane protein 4; n...    90   3e-17
UniRef50_Q8MXH3 Cluster: Putative uncharacterized protein T09A12...    88   1e-16
UniRef50_Q5BTC1 Cluster: SJCHGC02042 protein; n=1; Schistosoma j...    69   6e-11
UniRef50_Q238X7 Cluster: Ribosome associated membrane protein RA...    65   1e-09
UniRef50_A7QP46 Cluster: Chromosome chr1 scaffold_136, whole gen...    61   2e-08
UniRef50_UPI0000E1FFEC Cluster: PREDICTED: similar to ribosome a...    59   5e-08
UniRef50_Q9FZK2 Cluster: F17L21.12; n=13; Magnoliophyta|Rep: F17...    56   4e-07
UniRef50_A0D197 Cluster: Chromosome undetermined scaffold_34, wh...    54   1e-06
UniRef50_Q7RG55 Cluster: Arabidopsis thaliana F17L21.12-related;...    53   4e-06
UniRef50_Q5CPN8 Cluster: Putative uncharacterized protein; n=1; ...    53   4e-06
UniRef50_A5KBT3 Cluster: Ribosome associated membrane protein RA...    52   8e-06
UniRef50_Q0IRG8 Cluster: Os11g0637400 protein; n=11; Liliopsida|...    51   1e-05
UniRef50_A3CD52 Cluster: Putative uncharacterized protein; n=2; ...    51   1e-05
UniRef50_UPI0000D9E6A9 Cluster: PREDICTED: similar to ribosome a...    42   0.006
UniRef50_Q553P6 Cluster: Putative uncharacterized protein; n=1; ...    37   0.23 
UniRef50_Q5ATU0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.23 
UniRef50_Q9HBV2 Cluster: Sperm acrosome membrane-associated prot...    33   3.8  
UniRef50_UPI0000D56160 Cluster: PREDICTED: similar to CG17922-PA...    33   5.0  
UniRef50_Q8YX06 Cluster: All1413 protein; n=3; Nostocaceae|Rep: ...    32   6.6  
UniRef50_A6R365 Cluster: Predicted protein; n=1; Ajellomyces cap...    32   6.6  
UniRef50_Q55LH7 Cluster: Putative uncharacterized protein; n=1; ...    32   8.7  

>UniRef50_Q8SYY6 Cluster: RE27904p; n=8; Coelomata|Rep: RE27904p -
           Drosophila melanogaster (Fruit fly)
          Length = 64

 Score =  111 bits (268), Expect = 7e-24
 Identities = 51/64 (79%), Positives = 57/64 (89%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQI+QS
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQS 60

Query: 280 IRLA 291
           IR A
Sbjct: 61  IRAA 64


>UniRef50_Q7ZUJ1 Cluster: Zgc:56419; n=5; Euteleostomi|Rep:
           Zgc:56419 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 66

 Score = 90.2 bits (214), Expect = 2e-17
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTK-EKEDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT+RGNV K+T+  +E++  V PWLLALF+FVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITLRGNVAKSTRGTQEEKAVVGPWLLALFVFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>UniRef50_Q9Y6X1 Cluster: Ribosome-attached membrane protein 4;
           n=33; Eumetazoa|Rep: Ribosome-attached membrane protein
           4 - Homo sapiens (Human)
          Length = 66

 Score = 89.8 bits (213), Expect = 3e-17
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>UniRef50_Q8MXH3 Cluster: Putative uncharacterized protein T09A12.5;
           n=2; Bilateria|Rep: Putative uncharacterized protein
           T09A12.5 - Caenorhabditis elegans
          Length = 63

 Score = 87.8 bits (208), Expect = 1e-16
 Identities = 37/63 (58%), Positives = 49/63 (77%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAPKQRM +AN   SKN+T RGNVPK  K  E ++P + WL+ LFIFVVCGSA+F++I+ 
Sbjct: 1   MAPKQRMAVANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFEVIRY 60

Query: 280 IRL 288
           I++
Sbjct: 61  IKV 63


>UniRef50_Q5BTC1 Cluster: SJCHGC02042 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02042 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 79

 Score = 68.9 bits (161), Expect = 6e-11
 Identities = 32/65 (49%), Positives = 44/65 (67%)
 Frame = +1

Query: 97  KMAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           +M+  QRM++ N  A  N+  RGNVPK+ K  + Q  +   +L L +FVVCGSAVF+IIQ
Sbjct: 14  RMSASQRMKVQNGKAHGNVVNRGNVPKSLKSSDSQSNMNACILGLIVFVVCGSAVFEIIQ 73

Query: 277 SIRLA 291
            IR+A
Sbjct: 74  HIRMA 78


>UniRef50_Q238X7 Cluster: Ribosome associated membrane protein RAMP4
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Ribosome associated membrane protein RAMP4
           containing protein - Tetrahymena thermophila SB210
          Length = 107

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 43/58 (74%)
 Frame = +1

Query: 109 KQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQSI 282
           KQ+M++ + + +KN+T RG VP + K KE++  V PW+L +F+FVV GSA+FQI+  +
Sbjct: 48  KQQMKLKSNLHNKNVTNRGKVPSSLKSKEEK-SVGPWVLGIFLFVVVGSAIFQILNVV 104


>UniRef50_A7QP46 Cluster: Chromosome chr1 scaffold_136, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_136, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 105

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 27/45 (60%), Positives = 35/45 (77%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           KNIT RG+VP+TT +K   YPV P LL  F+FVV GS++FQII++
Sbjct: 54  KNITKRGSVPETTTKKGSDYPVGPVLLGFFVFVVIGSSLFQIIRT 98


>UniRef50_UPI0000E1FFEC Cluster: PREDICTED: similar to ribosome
           attached membrane protein 4; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to ribosome attached membrane protein
           4 - Pan troglodytes
          Length = 231

 Score = 59.3 bits (137), Expect = 5e-08
 Identities = 26/39 (66%), Positives = 31/39 (79%)
 Frame = +1

Query: 172 PKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQSIRL 288
           P+     E++  V PWLLALFIFVVCGSA+FQIIQSIR+
Sbjct: 191 PRPRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRM 229


>UniRef50_Q9FZK2 Cluster: F17L21.12; n=13; Magnoliophyta|Rep:
           F17L21.12 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 77

 Score = 56.4 bits (130), Expect = 4e-07
 Identities = 26/45 (57%), Positives = 33/45 (73%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           KNI  RG VP+TT +K   YPV P LL  F+FVV GS++FQII++
Sbjct: 26  KNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT 70


>UniRef50_A0D197 Cluster: Chromosome undetermined scaffold_34, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_34,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 75

 Score = 54.4 bits (125), Expect = 1e-06
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +1

Query: 112 QRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQII 273
           Q M++ ++    N+  +G VPK+  +KE+  PV P LL +F+FVV GSA+FQI+
Sbjct: 13  QTMKLRSQNYQGNVNKQGKVPKSLIKKEENLPVGPILLGVFLFVVVGSALFQIL 66


>UniRef50_Q7RG55 Cluster: Arabidopsis thaliana F17L21.12-related;
           n=3; Plasmodium|Rep: Arabidopsis thaliana
           F17L21.12-related - Plasmodium yoelii yoelii
          Length = 67

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 26/58 (44%), Positives = 35/58 (60%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQII 273
           MA  +++    E    NIT RGNVP +  +K  +Y V P LL +FIF+V GS V QI+
Sbjct: 1   MASNRKINKKIETFDNNITNRGNVPTSIAKKGKKYTVGPILLGIFIFIVIGSVVIQIL 58


>UniRef50_Q5CPN8 Cluster: Putative uncharacterized protein; n=1;
           Cryptosporidium parvum Iowa II|Rep: Putative
           uncharacterized protein - Cryptosporidium parvum Iowa II
          Length = 65

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 27/60 (45%), Positives = 39/60 (65%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MA  +  ++  E+  KNI  RG+V  ++ +K+  YPV P+ L LFIFVV GSA+ Q+I S
Sbjct: 1   MAQSRFTKLKGELYEKNIDKRGSV--SSSKKKSGYPVGPFALGLFIFVVIGSAIIQMIVS 58


>UniRef50_A5KBT3 Cluster: Ribosome associated membrane protein
           RAMP4, putative; n=3; Plasmodium|Rep: Ribosome
           associated membrane protein RAMP4, putative - Plasmodium
           vivax
          Length = 102

 Score = 52.0 bits (119), Expect = 8e-06
 Identities = 25/64 (39%), Positives = 38/64 (59%)
 Frame = +1

Query: 94  NKMAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQII 273
           +KMA  +++         NIT RGNVP +  +K  ++PV P LL +F+FVV GS   Q++
Sbjct: 33  SKMASNRKISQKINAFDNNITHRGNVPASLVKKGKKHPVGPILLVIFVFVVIGSVFIQML 92

Query: 274 QSIR 285
             I+
Sbjct: 93  SMIQ 96


>UniRef50_Q0IRG8 Cluster: Os11g0637400 protein; n=11;
           Liliopsida|Rep: Os11g0637400 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 573

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 255
           KNIT RG+VP+TT +K + YPV P +L  FIFVV GS
Sbjct: 27  KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFVVIGS 63


>UniRef50_A3CD52 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 460

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +1

Query: 145 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 255
           KNIT RG+VP+TT +K + YPV P +L  FIFVV GS
Sbjct: 17  KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFVVIGS 53


>UniRef50_UPI0000D9E6A9 Cluster: PREDICTED: similar to ribosome
           associated membrane protein 4; n=1; Macaca mulatta|Rep:
           PREDICTED: similar to ribosome associated membrane
           protein 4 - Macaca mulatta
          Length = 177

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 20/30 (66%), Positives = 23/30 (76%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKE 189
           M  KQR+R+ANE  SKNIT RGNV KT K+
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTLKK 30


>UniRef50_Q553P6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 59

 Score = 37.1 bits (82), Expect = 0.23
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M+  + +R  ++   +NI  RG    + K+KED   + P++L   IFVV GS + QI++
Sbjct: 1   MSQSRTLRQKSQKYQENIEKRGVA--SPKKKEDGLNINPYVLGFIIFVVVGSTLLQILK 57


>UniRef50_Q5ATU0 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 78

 Score = 37.1 bits (82), Expect = 0.23
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYP-VAPWLLALFIFVVCGSAVFQIIQ 276
           M    + R ANE  +K+   +   PKTT  K +  P ++   + L  FVVCG  VF++++
Sbjct: 1   MTQTPQQRRANEKFAKHEASKRGKPKTTTTKHNTKPSLSTGWVVLLAFVVCGGLVFELLR 60

Query: 277 SI 282
            +
Sbjct: 61  IV 62


>UniRef50_Q9HBV2 Cluster: Sperm acrosome membrane-associated protein
           1 precursor; n=17; Theria|Rep: Sperm acrosome
           membrane-associated protein 1 precursor - Homo sapiens
           (Human)
          Length = 294

 Score = 33.1 bits (72), Expect = 3.8
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +3

Query: 159 EGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINK 284
           E +C    +  R P  CG   P S  L SV L C+  +P+N+
Sbjct: 105 ESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNR 146


>UniRef50_UPI0000D56160 Cluster: PREDICTED: similar to CG17922-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG17922-PA - Tribolium castaneum
          Length = 715

 Score = 32.7 bits (71), Expect = 5.0
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +1

Query: 139 ASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           A+K  T  G  PK T+E E  +    WL+ +F+F +    +  II +
Sbjct: 352 ATKTATSIGKNPKPTQEIEYMFMTVSWLMGVFVFALLIGQIRDIIST 398


>UniRef50_Q8YX06 Cluster: All1413 protein; n=3; Nostocaceae|Rep:
           All1413 protein - Anabaena sp. (strain PCC 7120)
          Length = 536

 Score = 32.3 bits (70), Expect = 6.6
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = -2

Query: 248 HTTKMKRARSQGA-TGYWSSFSLVVLGTFPLIVMFLLAISLAIRILCLGAILFCYKVYLS 72
           H  ++KR   Q    G W S +L++LG FP    F +AI  A +I    A++ C   Y++
Sbjct: 211 HLQEVKRRLFQFTQVGIWGSGNLIILGLFPYTRTFQVAIFTAAQIPLRLAVV-CAGTYVA 269

Query: 71  V 69
           +
Sbjct: 270 I 270


>UniRef50_A6R365 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 80

 Score = 32.3 bits (70), Expect = 6.6
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 4/65 (6%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAP----WLLALFIFVVCGSAVFQ 267
           MA   + R ANE  +K    +   P+T  + + Q P +P    W++ L  FVVCG  +F+
Sbjct: 1   MAQTPQQRRANERFAKLEAAKRGKPETGVKSKKQKPKSPVPLGWVVVL-AFVVCGGMLFE 59

Query: 268 IIQSI 282
           + + +
Sbjct: 60  LARVV 64


>UniRef50_Q55LH7 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 654

 Score = 31.9 bits (69), Expect = 8.7
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +2

Query: 116 ECVSPTRSPVKTSQ*GGMYPKLPRKKKTNI 205
           +CV  TR P KT Q  G Y + P K  TN+
Sbjct: 191 DCVDSTRKPRKTDQYRGPYKRRPSKYTTNV 220


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 509,666,193
Number of Sequences: 1657284
Number of extensions: 10174218
Number of successful extensions: 25050
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 24412
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25042
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 30946432294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -