SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6QZG7 Cluster: Predicted protein; n=1; Ajellomyces cap...    39   0.12 
UniRef50_A5IYC4 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  

>UniRef50_A6QZG7 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 804

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 25/83 (30%), Positives = 42/83 (50%)
 Frame = -3

Query: 482 LLQLIRTSALNNR*VHISYVK*IDTAAVFISQSPKRHYGSSRSLNGAFKYHKHRSPPSAN 303
           L QL    ++++   H S+++    A  F+ ++P+  Y      N  F+ + HR  PSA+
Sbjct: 14  LQQLSMDPSVHDPFGHTSFIE----APSFLVEAPQHSYSDGHPSNQKFESYAHR--PSAS 67

Query: 302 PSLATKGSTSKLTQPTEFLAGPS 234
           PS+AT  S+   T      +GPS
Sbjct: 68  PSIATAFSSDLSTSTNSSASGPS 90


>UniRef50_A5IYC4 Cluster: Putative uncharacterized protein; n=1;
           Mycoplasma agalactiae|Rep: Putative uncharacterized
           protein - Mycoplasma agalactiae
          Length = 84

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +2

Query: 377 VWG-SEI*ILPLYRFTLHKKCVPTYCSEPRYVSAVTMIAVSVCHLACLCY**TVSCLFPK 553
           +W  SEI +L +    L  K  P Y    +  S +T   V VC+  CL Y   +SC+ P 
Sbjct: 11  LWSVSEIIVLMIASIDLSSKFFPIYLFRNKCFS-ITACVVFVCY--CLIYKLIISCIKPY 67

Query: 554 IFTYLGTFVFVVRI 595
            F Y+  F+   R+
Sbjct: 68  EFLYIIDFMCCFRL 81


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 632,511,974
Number of Sequences: 1657284
Number of extensions: 12604363
Number of successful extensions: 30734
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 29700
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30723
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 48760335122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -