SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P46782 Cluster: 40S ribosomal protein S5; n=150; Eukary...   324   9e-88
UniRef50_O65731 Cluster: 40S ribosomal protein S5; n=15; Eukaryo...   273   2e-72
UniRef50_Q9P3T6 Cluster: 40S ribosomal protein S5-B; n=3; Fungi/...   229   3e-59
UniRef50_Q3LVW8 Cluster: Ribosomal protein S5; n=1; Bigelowiella...   174   2e-42
UniRef50_Q8TXJ3 Cluster: 30S ribosomal protein S7P; n=5; Archaea...   168   9e-41
UniRef50_Q8SS72 Cluster: 40S RIBOSOMAL PROTEIN S5; n=1; Encephal...   161   1e-38
UniRef50_Q8ZYK5 Cluster: 30S ribosomal protein S7P; n=13; Archae...   159   7e-38
UniRef50_UPI0000F2E821 Cluster: PREDICTED: hypothetical protein;...   153   5e-36
UniRef50_Q8TRC2 Cluster: 30S ribosomal protein S7P; n=9; Euryarc...   141   1e-32
UniRef50_P15763 Cluster: 30S ribosomal protein S7P; n=15; Euryar...   140   4e-32
UniRef50_P14037 Cluster: 30S ribosomal protein S7P; n=3; Euryarc...   139   5e-32
UniRef50_O59230 Cluster: 30S ribosomal protein S7P; n=10; Archae...   130   3e-29
UniRef50_A7I4X5 Cluster: Ribosomal protein S7; n=1; Candidatus M...   128   1e-28
UniRef50_UPI00003C8539 Cluster: hypothetical protein Faci_030012...   102   7e-21
UniRef50_Q59EK8 Cluster: Ribosomal protein S5 variant; n=1; Homo...    92   9e-18
UniRef50_Q16KF0 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_P49495 Cluster: Chloroplast 30S ribosomal protein S7; n...    50   6e-05
UniRef50_Q46517 Cluster: ORFD 65; n=1; Desulfurococcus mobilis|R...    49   1e-04
UniRef50_Q5AK02 Cluster: Likely mitochondrial ribosomal protein ...    44   0.002
UniRef50_P19458 Cluster: Chloroplast 30S ribosomal protein S7; n...    44   0.002
UniRef50_Q6BRT2 Cluster: Similar to CA4785|IPF3361 Candida albic...    40   0.039
UniRef50_P12339 Cluster: Chloroplast 30S ribosomal protein S7; n...    40   0.069
UniRef50_Q97SQ4 Cluster: 30S ribosomal protein S7; n=211; Bacter...    39   0.091
UniRef50_A0ARS1 Cluster: 30S ribosomal protein S7; n=3; Poales|R...    39   0.12 
UniRef50_O13744 Cluster: Mitochondrial ribosomal protein subunit...    38   0.28 
UniRef50_Q06SG5 Cluster: Chloroplast 30S ribosomal protein S7; n...    37   0.37 
UniRef50_Q2J9E2 Cluster: Putative uncharacterized protein; n=1; ...    36   0.64 
UniRef50_Q4P8U6 Cluster: Putative uncharacterized protein; n=1; ...    36   0.64 
UniRef50_P41911 Cluster: Glycerol-3-phosphate dehydrogenase [NAD...    36   0.85 
UniRef50_Q6FWL2 Cluster: Similarities with sp|P47150 Saccharomyc...    36   1.1  
UniRef50_Q5KFI5 Cluster: Putative uncharacterized protein; n=2; ...    35   1.5  
UniRef50_P61841 Cluster: Chloroplast 30S ribosomal protein S7; n...    35   2.0  
UniRef50_Q9HWD1 Cluster: 30S ribosomal protein S7; n=89; Bacteri...    34   2.6  
UniRef50_Q1JY60 Cluster: Multicopper oxidase, type 3 precursor; ...    33   4.5  
UniRef50_A7TS76 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_P14760 Cluster: Plastid 30S ribosomal protein S7; n=1; ...    33   6.0  

>UniRef50_P46782 Cluster: 40S ribosomal protein S5; n=150;
           Eukaryota|Rep: 40S ribosomal protein S5 - Homo sapiens
           (Human)
          Length = 204

 Score =  324 bits (797), Expect = 9e-88
 Identities = 153/170 (90%), Positives = 162/170 (95%)
 Frame = +2

Query: 143 PQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPI 322
           P  A+ P+IKLFG+WS  DVQ++D+SLQDYI+VKEKYAKYLPHSAGRYA KRFRKAQCPI
Sbjct: 9   PAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPI 68

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGENPLQVLV AIINSGPREDSTRI
Sbjct: 69  VERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI 128

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 129 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI 178


>UniRef50_O65731 Cluster: 40S ribosomal protein S5; n=15;
           Eukaryota|Rep: 40S ribosomal protein S5 - Cicer
           arietinum (Chickpea) (Garbanzo)
          Length = 197

 Score =  273 bits (670), Expect = 2e-72
 Identities = 130/164 (79%), Positives = 148/164 (90%), Gaps = 1/164 (0%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISV-KEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTN 340
           E+KLF RWS  DVQ+SD+SL DYI V   K+A Y+PH+AGRY+ KRFRKAQCPIVERLTN
Sbjct: 8   EVKLFNRWSFDDVQLSDVSLIDYIGVVPSKHATYVPHTAGRYSVKRFRKAQCPIVERLTN 67

Query: 341 SLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTV 520
           SLMMHGRNNGKKLMAVRI+KHA EIIHLLT +NP+QV+V A++NSGPRED+TRIG AG V
Sbjct: 68  SLMMHGRNNGKKLMAVRIIKHAMEIIHLLTDQNPIQVIVDAVVNSGPREDATRIGSAGVV 127

Query: 521 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           RRQAVD+SPLRRVNQAI+LL TGAREAAFRNIK+IAEC+ADELI
Sbjct: 128 RRQAVDISPLRRVNQAIYLLTTGAREAAFRNIKSIAECLADELI 171


>UniRef50_Q9P3T6 Cluster: 40S ribosomal protein S5-B; n=3;
           Fungi/Metazoa group|Rep: 40S ribosomal protein S5-B -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 203

 Score =  229 bits (561), Expect = 3e-59
 Identities = 117/181 (64%), Positives = 144/181 (79%)
 Frame = +2

Query: 110 AGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 289
           A S++ + +SL +      IKLF ++    V+V D+SL DYI++     + LPH+AGR+ 
Sbjct: 2   AASIIPKEVSLDETG---HIKLFNKFPFEGVEVKDISLVDYITIGN--GQPLPHTAGRFQ 56

Query: 290 HKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAII 469
            KRFRKA+C IVERLTNSLMM+GRNNGKKL+A RIVKHAFEII LLT +NPLQVLV A+ 
Sbjct: 57  TKRFRKARCFIVERLTNSLMMNGRNNGKKLLATRIVKHAFEIIALLTDQNPLQVLVDAVA 116

Query: 470 NSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADEL 649
             GPREDSTRIG AGTVRRQAVDVSPLRRVNQA+ L+  GAREAAFRN+K+I+EC+A+E+
Sbjct: 117 ACGPREDSTRIGSAGTVRRQAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEI 176

Query: 650 I 652
           I
Sbjct: 177 I 177


>UniRef50_Q3LVW8 Cluster: Ribosomal protein S5; n=1; Bigelowiella
           natans|Rep: Ribosomal protein S5 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 207

 Score =  174 bits (423), Expect = 2e-42
 Identities = 75/163 (46%), Positives = 116/163 (71%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNS 343
           ++K+F RW    V+++D+S+ +YI   +KY + +PHS+G Y  K F+K  CPI+ERL  S
Sbjct: 19  KMKVFNRWELEKVKINDISISNYIYFNKKYGELVPHSSGNYDKKPFKKTYCPILERLVCS 78

Query: 344 LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR 523
           LM+  RN+GKK+  + IVKHAF ++H  TG+NP+Q+LV AI N  P EDS  +  +G  +
Sbjct: 79  LMLKSRNSGKKIKTIAIVKHAFYLLHKTTGKNPIQLLVDAISNCAPHEDSLMLSNSGQKK 138

Query: 524 RQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           R+AVDVSP R+++QAI+ +  G ++AAF+N K+I+  + DE++
Sbjct: 139 REAVDVSPYRKISQAIYFIAVGTKKAAFKNPKSISIALHDEIL 181


>UniRef50_Q8TXJ3 Cluster: 30S ribosomal protein S7P; n=5;
           Archaea|Rep: 30S ribosomal protein S7P - Methanopyrus
           kandleri
          Length = 197

 Score =  168 bits (409), Expect = 9e-41
 Identities = 85/163 (52%), Positives = 114/163 (69%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNS 343
           E+K+FG+W   +V+V D  L+DYI +K  Y   LPH+ GR+A KRF KA+ PIVERL N 
Sbjct: 12  EMKVFGKWDPTEVEVRDPGLKDYICLKPMY---LPHTGGRHAKKRFAKAEVPIVERLINR 68

Query: 344 LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR 523
           +M   +N GKK +A  IVK AF+IIH  TGENP+QVLV A+ N+ PRE++T I   G   
Sbjct: 69  VMRTEKNTGKKHLAYNIVKRAFDIIHERTGENPIQVLVQALENAAPREETTTIIYGGISY 128

Query: 524 RQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
            +AVD SP RR++ A+ L+  GA++ AFRN K I EC+A+E+I
Sbjct: 129 HEAVDSSPQRRLDIALRLITEGAQQRAFRNPKPIEECLAEEII 171


>UniRef50_Q8SS72 Cluster: 40S RIBOSOMAL PROTEIN S5; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S5 -
           Encephalitozoon cuniculi
          Length = 208

 Score =  161 bits (392), Expect = 1e-38
 Identities = 84/163 (51%), Positives = 116/163 (71%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNS 343
           EI LF ++S  +V+V+++SL+ YI++  +    +PH+A         KA+ PI ER   S
Sbjct: 22  EINLFEKYSYEEVKVNNVSLRPYINLSRR--GIVPHAATTITKGTTGKARIPIAERFVCS 79

Query: 344 LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR 523
           LM HGRN+GKK +A+ I + A  IIH +T +NPLQVLV AI+NSGPRED+ RIGRAG++R
Sbjct: 80  LMRHGRNSGKKRLAINIFEDACFIIHSMTKKNPLQVLVDAIVNSGPREDTARIGRAGSMR 139

Query: 524 RQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           R +VDVSPL+R++ AI  L  G R A+FRN  T+AE +A+ELI
Sbjct: 140 RTSVDVSPLKRISIAISNLSAGIRNASFRNRITLAEAIANELI 182


>UniRef50_Q8ZYK5 Cluster: 30S ribosomal protein S7P; n=13;
           Archaea|Rep: 30S ribosomal protein S7P - Pyrobaculum
           aerophilum
          Length = 223

 Score =  159 bits (385), Expect = 7e-38
 Identities = 84/162 (51%), Positives = 106/162 (65%)
 Frame = +2

Query: 167 IKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSL 346
           I LFG+WS  DV V D  L+ YI +K      LPH+ GRY + RF KA+ PIVERL N +
Sbjct: 39  ILLFGKWSYEDVVVRDPGLRRYICLKPVI---LPHTEGRYQNTRFGKARIPIVERLINLM 95

Query: 347 MMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRR 526
           M  GRN GKK  A  IVK AF++I+  TG+NPLQV + AIIN+ PRE+ TRI   G    
Sbjct: 96  MRPGRNTGKKHKAYNIVKRAFDLIYYKTGKNPLQVFIDAIINTAPREEITRIIMGGIAYS 155

Query: 527 QAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
            +VDVSP RR++ A+  +  GAR  +F N K I EC+ADE+I
Sbjct: 156 VSVDVSPQRRLDLALRWITEGARACSFNNPKPIEECLADEII 197


>UniRef50_UPI0000F2E821 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 280

 Score =  153 bits (370), Expect = 5e-36
 Identities = 73/81 (90%), Positives = 77/81 (95%)
 Frame = +2

Query: 410 EIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTG 589
           ++ HLL  +NPLQVLV AIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTG
Sbjct: 174 QLQHLLLAQNPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTG 233

Query: 590 AREAAFRNIKTIAECVADELI 652
           AREAAFRNIKTIAEC+ADELI
Sbjct: 234 AREAAFRNIKTIAECLADELI 254


>UniRef50_Q8TRC2 Cluster: 30S ribosomal protein S7P; n=9;
           Euryarchaeota|Rep: 30S ribosomal protein S7P -
           Methanosarcina acetivorans
          Length = 189

 Score =  141 bits (342), Expect = 1e-32
 Identities = 68/161 (42%), Positives = 108/161 (67%)
 Frame = +2

Query: 170 KLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLM 349
           K+FG+W   +V+V D+ ++ Y+S+       +PHS+G++A ++F K++  IVERL N+LM
Sbjct: 6   KIFGKWDPTEVEVKDLGIKRYVSLTPVI---VPHSSGKHARQQFNKSEISIVERLANNLM 62

Query: 350 MHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRRQ 529
               N GKK + +R V+ AF+I++  T +NP+QVLV AI N+GPRE+  R+   G    +
Sbjct: 63  RTETNTGKKQVTLRAVEEAFDIVNKKTKQNPIQVLVDAIANAGPREEVVRLKYGGISVPK 122

Query: 530 AVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           AVD +P RRV+ A+  +  G   AAF++ +++AEC+A ELI
Sbjct: 123 AVDTAPQRRVDTALRYISMGTNAAAFKSKRSVAECLATELI 163


>UniRef50_P15763 Cluster: 30S ribosomal protein S7P; n=15;
           Euryarchaeota|Rep: 30S ribosomal protein S7P -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 210

 Score =  140 bits (338), Expect = 4e-32
 Identities = 76/190 (40%), Positives = 114/190 (60%)
 Frame = +2

Query: 80  EENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAK 259
           E+   D+  EA +   +T  +   A     KLFG+W   ++   D S + Y++V      
Sbjct: 4   EQPAEDETEEAAAESEDTQEVAANA-----KLFGKWDVAEIHYEDPSTRRYLAVTP---- 54

Query: 260 YLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGEN 439
            + H+ GR+A K+F+K++  IVERL N LM  G N GKK  A++IV+ AF+I+H  T EN
Sbjct: 55  -VAHTMGRHAQKQFKKSEISIVERLANRLMKTGANAGKKQQALKIVRDAFDIVHERTDEN 113

Query: 440 PLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIK 619
           P+QVLV+A+ N+ PRE++ R+   G    QAVD +P RRV+QA+  L  GA  A+F+   
Sbjct: 114 PIQVLVSAVENAAPREETVRLKYGGISVPQAVDTAPQRRVDQALKFLADGAHSASFKTPT 173

Query: 620 TIAECVADEL 649
             AE +A++L
Sbjct: 174 DAAEALANQL 183


>UniRef50_P14037 Cluster: 30S ribosomal protein S7P; n=3;
           Euryarchaeota|Rep: 30S ribosomal protein S7P -
           Methanococcus vannielii
          Length = 194

 Score =  139 bits (337), Expect = 5e-32
 Identities = 74/163 (45%), Positives = 103/163 (63%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNS 343
           EIKLFG+W    V V D SL+ +IS+       +PH+AGR + K F K +  +VERL N 
Sbjct: 8   EIKLFGKWDSTSVTVKDPSLKSHISLNPVL---IPHTAGRNSKKMFDKNKMHVVERLANK 64

Query: 344 LMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVR 523
           LM    N GKK   + I++ A  I+   T ENP+QV+V A+ NSGPRE++TRI   G   
Sbjct: 65  LMATQVNTGKKNEVLSIIEEALTIVENRTKENPIQVVVDALENSGPREETTRISYGGIAF 124

Query: 524 RQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
            Q+VDVSP RR++ A   +  GA + A ++ K+IA+C+ADEL+
Sbjct: 125 LQSVDVSPSRRLDTAFRNISLGASQGAHKSKKSIAQCLADELV 167


>UniRef50_O59230 Cluster: 30S ribosomal protein S7P; n=10;
           Archaea|Rep: 30S ribosomal protein S7P - Pyrococcus
           horikoshii
          Length = 218

 Score =  130 bits (314), Expect = 3e-29
 Identities = 77/179 (43%), Positives = 106/179 (59%), Gaps = 16/179 (8%)
 Frame = +2

Query: 164 EIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNS 343
           EIK+ GRWS  DV+V D SL+ YI+++ +    LPH+ GR+A K F KA   IVERL N 
Sbjct: 17  EIKVMGRWSTEDVEVKDPSLKPYINLEPRL---LPHTHGRHAKKHFGKANVHIVERLINK 73

Query: 344 LMMHGRN----------------NGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINS 475
           +M  G +                N KK+ A  +VK AF+II   TG+NP+QVLV AI N+
Sbjct: 74  VMRSGGSHYKVAGHFMRREHRSLNSKKVRAYEVVKEAFKIIEKRTGKNPIQVLVWAIENA 133

Query: 476 GPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
            PRED+T +   G     AVD+SPLRR++ A+  +  GA    +R   + AE +A+E+I
Sbjct: 134 APREDTTSVMFGGIRYHVAVDISPLRRLDVALRNIALGASAKCYRTKMSFAEALAEEII 192


>UniRef50_A7I4X5 Cluster: Ribosomal protein S7; n=1; Candidatus
           Methanoregula boonei 6A8|Rep: Ribosomal protein S7 -
           Methanoregula boonei (strain 6A8)
          Length = 204

 Score =  128 bits (309), Expect = 1e-28
 Identities = 69/177 (38%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
 Frame = +2

Query: 128 ETMSLPQAADIPEIK--LFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRF 301
           E  + P+    P+ K  LF +W   +V+V+D SL  Y+++  +    +PHS G+++ + F
Sbjct: 5   EVKAQPEGDAAPQSKALLFNKWDVSEVKVTDPSLVRYVNLTPQI---IPHSCGKFSRQEF 61

Query: 302 RKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP 481
            KA   IVERL N LM    N GKK +A+ IV+ AFE+I+  T  NP++VLV AI N+GP
Sbjct: 62  NKANMMIVERLINRLMQTENNTGKKQLAIGIVRDAFELINKKTKRNPIEVLVEAIGNTGP 121

Query: 482 REDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           RE++ R+   G    ++VD +PLRRV+ AI  +     +++ ++ K  +  +ADELI
Sbjct: 122 REETVRLKYGGINVPKSVDTAPLRRVDSAIGFIAEAVWKSSRKSKKPASAILADELI 178


>UniRef50_UPI00003C8539 Cluster: hypothetical protein Faci_03001272;
           n=1; Ferroplasma acidarmanus fer1|Rep: hypothetical
           protein Faci_03001272 - Ferroplasma acidarmanus fer1
          Length = 182

 Score =  102 bits (245), Expect = 7e-21
 Identities = 56/152 (36%), Positives = 93/152 (61%), Gaps = 1/152 (0%)
 Frame = +2

Query: 200 VQVSDMSLQDYISVKEKYAKYLP-HSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKK 376
           +Q+ D  L  YI++      YL   + GR+++    K     +ERL N+LM   +  GKK
Sbjct: 9   IQIKDQGLATYINL----TSYLNLDTGGRFSNYLSGKRNVNTIERLLNNLMRTEKWTGKK 64

Query: 377 LMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRR 556
             A +++  AF+II   T +NP+Q+LV+AI NS PRE+ TR+   G    ++VDVSP RR
Sbjct: 65  YSAYKVMSQAFDIIATKTKQNPVQILVSAIENSAPREEVTRLKYGGIAVPKSVDVSPSRR 124

Query: 557 VNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           +++A+  +  GA +A+F++   I +C+A+E++
Sbjct: 125 LDEALRNIARGATKASFKHKIHIQDCLANEIL 156


>UniRef50_Q59EK8 Cluster: Ribosomal protein S5 variant; n=1; Homo
           sapiens|Rep: Ribosomal protein S5 variant - Homo sapiens
           (Human)
          Length = 107

 Score = 92.3 bits (219), Expect = 9e-18
 Identities = 45/52 (86%), Positives = 46/52 (88%)
 Frame = +2

Query: 308 AQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTA 463
           AQCPIVERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGE  L  LV A
Sbjct: 1   AQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGEVGLCGLVRA 52


>UniRef50_Q16KF0 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 77

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +2

Query: 74  MAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYIS 238
           M+E    D+  E    V E   + Q A++P+IKLFGRWS  D+ +SD+S+ DYI+
Sbjct: 1   MSEVEAFDNFEEEQPQVFEQAPVVQPAELPDIKLFGRWSSDDIHISDISVSDYIA 55


>UniRef50_P49495 Cluster: Chloroplast 30S ribosomal protein S7; n=1;
           Odontella sinensis|Rep: Chloroplast 30S ribosomal
           protein S7 - Odontella sinensis (Marine centric diatom)
          Length = 158

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 36/99 (36%), Positives = 52/99 (52%), Gaps = 3/99 (3%)
 Frame = +2

Query: 293 KRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIIN 472
           KRF +A       L + L+     +GKK +A  IV  AFEII + T E+PL V   AI N
Sbjct: 9   KRFPEADSTYNSYLVSLLITRILKSGKKNLAQNIVNAAFEIIKVKTNEDPLVVFERAIRN 68

Query: 473 SGP--REDSTRIGRAGTVRRQAVDVSPLRRVNQAI-WLL 580
           + P     + RIG  G+  +  V+VS  R  N ++ W++
Sbjct: 69  ASPVVEVKARRIG--GSTYQVPVEVSGFRATNLSLRWII 105


>UniRef50_Q46517 Cluster: ORFD 65; n=1; Desulfurococcus mobilis|Rep:
           ORFD 65 - Desulfurococcus mobilis
          Length = 65

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = -3

Query: 414 ISNACLTIRTAISFLPLFRPCIIREFVRRSTIGHWALRKRLCAYLPAE*GKYFAY 250
           +S A LT+  A  FLP+F P  I  F+  ST+G W L KRLC+ LP   G+Y  +
Sbjct: 1   MSKAFLTMWYARCFLPMFLPGRITLFISLSTMGTWVLPKRLCSCLPPVCGRYTGF 55


>UniRef50_Q5AK02 Cluster: Likely mitochondrial ribosomal protein S7;
           n=3; Saccharomycetales|Rep: Likely mitochondrial
           ribosomal protein S7 - Candida albicans (Yeast)
          Length = 251

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 26/87 (29%), Positives = 45/87 (51%)
 Frame = +2

Query: 281 RYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVT 460
           +YA+K+      P V+ LTN +M H    GKK  A ++V  A  I+ L   ++P++VL  
Sbjct: 105 KYANKKIPLRSDPTVDNLTNLIMRH----GKKAKAQKVVSRALYIVQLKLRKDPIEVLRE 160

Query: 461 AIINSGPREDSTRIGRAGTVRRQAVDV 541
            +   GP   +T+    G  +++ V +
Sbjct: 161 TLDKLGPLV-NTKTMSTGVAKKRVVPI 186


>UniRef50_P19458 Cluster: Chloroplast 30S ribosomal protein S7;
           n=22; cellular organisms|Rep: Chloroplast 30S ribosomal
           protein S7 - Guillardia theta (Cryptomonas phi)
          Length = 156

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 2/98 (2%)
 Frame = +2

Query: 329 RLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPRED--STRI 502
           RL N L +     GKK +A RI+ +AF+II   TGE+ + V  +AI    P  +  + RI
Sbjct: 21  RLVNMLTVRILKEGKKHLAQRIIYNAFDIIKQRTGEDAILVFESAIKKVTPLVEVKARRI 80

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNI 616
           G  G+  +  ++V   R  N A+  +   ARE A +++
Sbjct: 81  G--GSTYQVPMEVRAFRGTNLALRWITKYARERAGKSM 116


>UniRef50_Q6BRT2 Cluster: Similar to CA4785|IPF3361 Candida albicans
           IPF3361; n=2; Saccharomycetaceae|Rep: Similar to
           CA4785|IPF3361 Candida albicans IPF3361 - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 263

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 25/91 (27%), Positives = 47/91 (51%)
 Frame = +2

Query: 284 YAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTA 463
           +A+KR      P ++  TN +M     +GKK  A +I+  A  I++L T ++PL +L   
Sbjct: 118 FANKRIPLPSNPTIDNFTNLIM----RDGKKSKAQKILSRALYIVYLKTRKDPLVILEET 173

Query: 464 IINSGPREDSTRIGRAGTVRRQAVDVSPLRR 556
           +    P   +T++ + G  + + V   PL++
Sbjct: 174 LDKMAPLM-ATKVQKTGAAKNRTVPY-PLKK 202


>UniRef50_P12339 Cluster: Chloroplast 30S ribosomal protein S7;
           n=94; cellular organisms|Rep: Chloroplast 30S ribosomal
           protein S7 - Zea mays (Maize)
          Length = 156

 Score = 39.5 bits (88), Expect = 0.069
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 2/100 (2%)
 Frame = +2

Query: 287 AHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAI 466
           A KR  K+      RL N ++     +GKK +A +I+  A + I   T  NPL VL  AI
Sbjct: 7   AEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLLVLRQAI 66

Query: 467 INSGPRED-STRIGRAGTVRRQAVDVSPLRRVNQAI-WLL 580
               P     TR  + G+ R+  +++   +    AI WLL
Sbjct: 67  RRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLL 106


>UniRef50_Q97SQ4 Cluster: 30S ribosomal protein S7; n=211;
           Bacteria|Rep: 30S ribosomal protein S7 - Streptococcus
           pneumoniae
          Length = 156

 Score = 39.1 bits (87), Expect = 0.091
 Identities = 39/112 (34%), Positives = 54/112 (48%), Gaps = 1/112 (0%)
 Frame = +2

Query: 320 IVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTR 499
           +V RL N +M+    +GK+  A  IV  AFE I   TG + L+V  TA+ N  P  +  R
Sbjct: 22  LVTRLINRVML----DGKRGTAASIVYGAFEQIKEATGNDALEVFETAMENIMPVLE-VR 76

Query: 500 IGRAGTVRRQA-VDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
             R G    Q  V V P RR    +  L T AR    R   T+ + +A E++
Sbjct: 77  ARRVGGSNYQVPVKVRPERRTTLGLRWLVTIAR---LRGEHTMQDRLAKEIL 125


>UniRef50_A0ARS1 Cluster: 30S ribosomal protein S7; n=3; Poales|Rep:
           30S ribosomal protein S7 - Elegia fenestrata
          Length = 217

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 37/119 (31%), Positives = 54/119 (45%), Gaps = 2/119 (1%)
 Frame = +2

Query: 287 AHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAI 466
           A KR  K+      RL N ++     +GKK +A +I   A + I   T  NPL VL  AI
Sbjct: 7   AEKRTAKSDPIYRNRLVNMVVNRIMKHGKKALAYQIFYRAAQKIQQ-TETNPLFVLREAI 65

Query: 467 INSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRN--IKTIAECV 637
               P+       +AG  R+  +++ P +    AI  L   +R+   +N  IK  AE V
Sbjct: 66  RRITPQIGVKARRKAGLTRQVPIEIQPRQAKVLAIRWLLEASRKRPGQNMAIKLSAELV 124


>UniRef50_O13744 Cluster: Mitochondrial ribosomal protein subunit
           S7; n=1; Schizosaccharomyces pombe|Rep: Mitochondrial
           ribosomal protein subunit S7 - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 259

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 23/53 (43%), Positives = 28/53 (52%)
 Frame = +2

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP 481
           V+ L N +M     +GKK  A +IV  A  II   TGENP+ VL  AI    P
Sbjct: 126 VQHLVNLIM----RDGKKAKAEKIVATALSIIQKETGENPIDVLKQAIAEISP 174


>UniRef50_Q06SG5 Cluster: Chloroplast 30S ribosomal protein S7; n=3;
           Chlorophyceae|Rep: Chloroplast 30S ribosomal protein S7
           - Stigeoclonium helveticum (Green alga)
          Length = 174

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 4/99 (4%)
 Frame = +2

Query: 317 PIVERLTNSLMMHG-RNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDS 493
           PI  +++  ++++    NGKK +A RIV   F  I     +NP++V   A+ N  PR + 
Sbjct: 16  PIYNKVSVHMLVNRILKNGKKSIAYRIVYSVFRKISETMNQNPVEVWEKALNNVKPRVEV 75

Query: 494 TRIGRAGTVRRQAVDVSPLRRVNQAI---WLLCTGAREA 601
               RAG++ +Q   V P     +AI   W++    ++A
Sbjct: 76  KPRRRAGSI-QQVPRVMPSAERARAIAIRWIVSACQKKA 113


>UniRef50_Q2J9E2 Cluster: Putative uncharacterized protein; n=1;
           Frankia sp. CcI3|Rep: Putative uncharacterized protein -
           Frankia sp. (strain CcI3)
          Length = 374

 Score = 36.3 bits (80), Expect = 0.64
 Identities = 29/99 (29%), Positives = 42/99 (42%)
 Frame = +2

Query: 218 SLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIV 397
           +LQ  +  + K A   P +A R    R         +  TN L   G  +G   +A+   
Sbjct: 93  NLQQELEYRNKVAPVAPAAADRTLRMRVSLHVGSTTDSGTNRL---GDGSGAARIALHRQ 149

Query: 398 KHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAG 514
             A  + HLL   NP   LV AI++S   ED+   G +G
Sbjct: 150 LDAAAVRHLLEESNPRTTLVAAILSSRAYEDAVLSGYSG 188


>UniRef50_Q4P8U6 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 299

 Score = 36.3 bits (80), Expect = 0.64
 Identities = 21/55 (38%), Positives = 28/55 (50%)
 Frame = +2

Query: 317 PIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP 481
           P +E LTN LM     +GKK  A R +     II  +T  NPL ++  AI  + P
Sbjct: 164 PTLEFLTNLLM----KDGKKAQAQRFITRTLSIISSVTNSNPLPLIHDAIYKAAP 214


>UniRef50_P41911 Cluster: Glycerol-3-phosphate dehydrogenase [NAD+]
           2, mitochondrial precursor; n=37; Saccharomycetales|Rep:
           Glycerol-3-phosphate dehydrogenase [NAD+] 2,
           mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 440

 Score = 35.9 bits (79), Expect = 0.85
 Identities = 20/70 (28%), Positives = 36/70 (51%)
 Frame = +2

Query: 62  KVPIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISV 241
           KV ++   NW   +A+   V+ E   L      PE+++   W  +D ++ D +L D I+ 
Sbjct: 85  KVTVIGSGNWGTTIAK---VIAENTELHSHIFEPEVRM---W-VFDEKIGDENLTDIINT 137

Query: 242 KEKYAKYLPH 271
           + +  KYLP+
Sbjct: 138 RHQNVKYLPN 147


>UniRef50_Q6FWL2 Cluster: Similarities with sp|P47150 Saccharomyces
           cerevisiae YJR113c RSM7; n=2; Saccharomycetales|Rep:
           Similarities with sp|P47150 Saccharomyces cerevisiae
           YJR113c RSM7 - Candida glabrata (Yeast) (Torulopsis
           glabrata)
          Length = 274

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +2

Query: 317 PIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP 481
           P V+ +TN +M H    GKK  A +I+  A   +H  T ++P+++L  A+ +  P
Sbjct: 139 PTVQHVTNMIMRH----GKKDRAQKIISRALYFLHCKTRKDPVELLKKALDDMAP 189


>UniRef50_Q5KFI5 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 468

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 3/79 (3%)
 Frame = +2

Query: 53  SNRKVPIMAEENWNDDVAEAGSVVVE-TMSLPQAADIPEIKLF--GRWSCYDVQVSDMSL 223
           S+ +  ++AEENW   +A+AG  + +  MS+   +D+ E+ L+  GR +  ++++ D   
Sbjct: 201 SDEEEALVAEENWGQSIADAGGYMHKGKMSVWARSDMDEMCLWGAGRGNIGEIELQDH-- 258

Query: 224 QDYISVKEKYAKYLPHSAG 280
           + Y S + K+  + P   G
Sbjct: 259 KQYPSSEFKFKTFTPPKTG 277


>UniRef50_P61841 Cluster: Chloroplast 30S ribosomal protein S7;
           n=191; Magnoliophyta|Rep: Chloroplast 30S ribosomal
           protein S7 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 155

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 2/98 (2%)
 Frame = +2

Query: 329 RLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGP--REDSTRI 502
           RL N L+     +GKK +A +I+  A + I   T  NPL VL  AI    P     + R+
Sbjct: 21  RLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRV 80

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNI 616
           G  G+  +  +++   +    AI  L   +R+   RN+
Sbjct: 81  G--GSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNM 116


>UniRef50_Q9HWD1 Cluster: 30S ribosomal protein S7; n=89;
           Bacteria|Rep: 30S ribosomal protein S7 - Pseudomonas
           aeruginosa
          Length = 156

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 2/126 (1%)
 Frame = +2

Query: 281 RYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVT 460
           R A KR   A      ++    M H   +GKK +A RIV  A + +      +PL+    
Sbjct: 5   RVAAKREVLADPKYGSQILAKFMNHVMESGKKAVAERIVYGALDKVKERGKADPLETFEK 64

Query: 461 AIINSGPRED--STRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC 634
           A+    P  +  S R+G  G   +  V+V P RR   A+  L   AR+   R  K++A  
Sbjct: 65  ALDAIAPLVEVKSRRVG--GATYQVPVEVRPSRRNALAMRWLVDFARK---RGEKSMALR 119

Query: 635 VADELI 652
           +A EL+
Sbjct: 120 LAGELL 125


>UniRef50_Q1JY60 Cluster: Multicopper oxidase, type 3 precursor;
           n=1; Desulfuromonas acetoxidans DSM 684|Rep: Multicopper
           oxidase, type 3 precursor - Desulfuromonas acetoxidans
           DSM 684
          Length = 782

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 14/29 (48%), Positives = 19/29 (65%)
 Frame = +3

Query: 462 PLSTLDPVKIRLGSVVRVQFVVKPLMFHP 548
           PLS  D ++IR G VVR   V + +M+HP
Sbjct: 507 PLSAGDDIRIRQGEVVRFMMVNRTMMYHP 535


>UniRef50_A7TS76 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 589

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query: 326 ERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENP--LQVLVTAIINSGPREDSTR 499
           ER ++ L+   +   +K + V++ KH FEI+H + G  P  + VL T +++S  R+ +  
Sbjct: 477 ERNSSKLLSQRQKQYQKFLHVKM-KHVFEILHSIEGNKPYTMTVLSTLVVDS-LRDGNNP 534

Query: 500 IG 505
           IG
Sbjct: 535 IG 536


>UniRef50_P14760 Cluster: Plastid 30S ribosomal protein S7; n=1;
           Euglena longa|Rep: Plastid 30S ribosomal protein S7 -
           Astasia longa (Euglenophycean alga)
          Length = 178

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +2

Query: 362 NNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPR-EDSTRIGRAGTVRRQAVD 538
           + GKK +A  I   + + I  +  ENPL +   A+ N+ P  E  T+  + G + + ++ 
Sbjct: 32  SKGKKNIARYIFYKSMQNIEKIKNENPLDIFKKAVDNATPSIELRTQKRKKGQISKISIK 91

Query: 539 VSPLRRVNQAIWLLCTGAREAAFRNI 616
               RR   A+  +   A++ + +NI
Sbjct: 92  TKLERRNKIALKFIINSAKKRSEKNI 117


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 656,311,312
Number of Sequences: 1657284
Number of extensions: 13255087
Number of successful extensions: 34282
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 32520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34099
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -