SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P46778 Cluster: 60S ribosomal protein L21; n=329; Fungi...   197   2e-49
UniRef50_Q7PZX9 Cluster: ENSANGP00000014054; n=2; Culicidae|Rep:...   190   1e-47
UniRef50_Q4KTG5 Cluster: L21; n=2; Metazoa|Rep: L21 - Suberites ...   175   4e-43
UniRef50_Q02753 Cluster: 60S ribosomal protein L21-A; n=31; Euka...   172   4e-42
UniRef50_Q43291 Cluster: 60S ribosomal protein L21-1; n=24; Euka...   149   4e-35
UniRef50_Q7XYA8 Cluster: 60S ribosome protein L21; n=1; Griffith...   140   3e-32
UniRef50_Q7R5F3 Cluster: GLP_165_41283_41762; n=3; Eukaryota|Rep...   129   4e-29
UniRef50_UPI0000E24650 Cluster: PREDICTED: similar to Ribosomal ...   127   1e-28
UniRef50_A3E3H5 Cluster: 60S ribosomal protein I21; n=3; Alveola...   125   8e-28
UniRef50_Q7REC3 Cluster: Ribosomal protein L21e, putative; n=5; ...   124   1e-27
UniRef50_A2F2S5 Cluster: Ribosomal protein L21e, putative; n=6; ...   124   1e-27
UniRef50_Q5CX53 Cluster: 60s ribosomal protein L21; n=3; Cryptos...   121   1e-26
UniRef50_Q23TC8 Cluster: 60S ribosomal protein L21, putative; n=...   115   6e-25
UniRef50_P38653 Cluster: 60S ribosomal protein L21; n=2; Entamoe...   113   2e-24
UniRef50_Q1KYN7 Cluster: RPL21; n=1; Streblomastix strix|Rep: RP...   109   5e-23
UniRef50_Q8SRW8 Cluster: 60S ribosomal protein L21; n=1; Encepha...   106   3e-22
UniRef50_UPI0000DD8153 Cluster: PREDICTED: similar to ribosomal ...    71   1e-21
UniRef50_Q4QEX4 Cluster: 60S ribosomal protein l21, putative; n=...    96   4e-19
UniRef50_UPI0001553B37 Cluster: PREDICTED: similar to ribosomal ...    81   1e-14
UniRef50_A6RC90 Cluster: 60s ribosomal protein l21; n=1; Ajellom...    71   2e-11
UniRef50_UPI0000D9A1A6 Cluster: PREDICTED: similar to 60S riboso...    70   3e-11
UniRef50_Q9AW28 Cluster: 60S ribosomal protein L21; n=1; Guillar...    68   2e-10
UniRef50_Q9SHE5 Cluster: T19E23.15; n=1; Arabidopsis thaliana|Re...    59   8e-08
UniRef50_UPI0000DA1EED Cluster: PREDICTED: similar to 60S riboso...    58   1e-07
UniRef50_UPI0000DC1311 Cluster: UPI0000DC1311 related cluster; n...    51   2e-05
UniRef50_Q9M2R5 Cluster: Putative uncharacterized protein T10K17...    50   4e-05
UniRef50_Q64E17 Cluster: Ribosomal protein L21E; n=3; environmen...    46   4e-04
UniRef50_A4D227 Cluster: Similar to 60S RIBOSOMAL PROTEIN L21; n...    43   0.005
UniRef50_Q4JB11 Cluster: 50S ribosomal protein L21e; n=8; Archae...    43   0.005
UniRef50_Q9UXE0 Cluster: 50S ribosomal protein L21e; n=6; Thermo...    40   0.029
UniRef50_O28743 Cluster: 50S ribosomal protein L21e; n=5; Euryar...    40   0.050
UniRef50_Q75F53 Cluster: AAL125Wp; n=1; Eremothecium gossypii|Re...    38   0.12 
UniRef50_Q5MGB3 Cluster: Transposase; n=1; Phytophthora infestan...    35   1.1  
UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;...    35   1.4  
UniRef50_A0BGP7 Cluster: Chromosome undetermined scaffold_106, w...    34   1.9  
UniRef50_Q1E5R4 Cluster: Putative uncharacterized protein; n=2; ...    34   1.9  
UniRef50_A5FGL8 Cluster: ABC transporter related; n=1; Flavobact...    34   2.5  
UniRef50_A0RUT3 Cluster: Ribosomal protein L21E; n=2; Thermoprot...    34   2.5  
UniRef50_UPI0000DB7140 Cluster: PREDICTED: hypothetical protein;...    33   3.3  
UniRef50_Q6L228 Cluster: 50S ribosomal protein L21e; n=2; Thermo...    33   3.3  
UniRef50_Q0YGP7 Cluster: Orn/DAP/Arg decarboxylase 2; n=3; Desul...    33   4.4  
UniRef50_Q4WRE2 Cluster: SWR1-complex protein 5; n=7; Trichocoma...    33   4.4  
UniRef50_A7HA29 Cluster: Rod shape-determining protein MreC prec...    32   7.6  

>UniRef50_P46778 Cluster: 60S ribosomal protein L21; n=329;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L21 -
           Homo sapiens (Human)
          Length = 160

 Score =  197 bits (480), Expect = 2e-49
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>UniRef50_Q7PZX9 Cluster: ENSANGP00000014054; n=2; Culicidae|Rep:
           ENSANGP00000014054 - Anopheles gambiae str. PEST
          Length = 162

 Score =  190 bits (464), Expect = 1e-47
 Identities = 88/133 (66%), Positives = 109/133 (81%), Gaps = 3/133 (2%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YMK+YK GD VDI+G+GAV KGMP+K YHGKTGRVYNV+ HALGVIVNKRVRG+I+PKRI
Sbjct: 30  YMKIYKSGDYVDIKGHGAVHKGMPYKAYHGKTGRVYNVSKHALGVIVNKRVRGKILPKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKEN--ERL-LKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 475
           N+RVEHV+ S+CR+DFL+RVKEN  +R+ L+  K  G  V+LKR+P  P+ A ++    K
Sbjct: 90  NVRVEHVQPSRCREDFLRRVKENVEKRMALRGKKLPGFKVSLKRKPKQPRQAQVIKNPPK 149

Query: 476 PVLLAPIPYEFVA 514
           P+ LAPIPYEFVA
Sbjct: 150 PIFLAPIPYEFVA 162


>UniRef50_Q4KTG5 Cluster: L21; n=2; Metazoa|Rep: L21 - Suberites
           domuncula (Sponge)
          Length = 160

 Score =  175 bits (427), Expect = 4e-43
 Identities = 82/131 (62%), Positives = 101/131 (77%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YMKVYKVGDIVD++GNGA  KGMP+K YHGKTG+VYNVT  A+GVIVNK +R +I+ KRI
Sbjct: 30  YMKVYKVGDIVDVKGNGAFHKGMPYKFYHGKTGKVYNVTKRAVGVIVNKPLRNKILQKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQP-APPKAAHIVSGTEKPV 481
           N+R+EHVKHS+CR+DFL RVK NE     A+  G+ V  KR P AP KA+ +    ++P 
Sbjct: 90  NVRIEHVKHSRCREDFLSRVKLNEEKKHAARERGEKVVCKRMPLAPRKASFVKMQGKEPE 149

Query: 482 LLAPIPYEFVA 514
           L+ PIPYEFVA
Sbjct: 150 LVEPIPYEFVA 160


>UniRef50_Q02753 Cluster: 60S ribosomal protein L21-A; n=31;
           Eukaryota|Rep: 60S ribosomal protein L21-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 160

 Score =  172 bits (419), Expect = 4e-42
 Identities = 81/128 (63%), Positives = 97/128 (75%), Gaps = 1/128 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y+KVYKVGDIVDI+ NG++QKGMPHK Y GKTG VYNVT  ++GVI+NK V  R + KR+
Sbjct: 30  YLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRL 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT-EKPV 481
           N+RVEH+KHSKCRQ+FL+RVK N     EAKA G  V LKRQPA P+ + IVS     P 
Sbjct: 90  NLRVEHIKHSKCRQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQ 149

Query: 482 LLAPIPYE 505
            LAP+PYE
Sbjct: 150 TLAPVPYE 157


>UniRef50_Q43291 Cluster: 60S ribosomal protein L21-1; n=24;
           Eukaryota|Rep: 60S ribosomal protein L21-1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 164

 Score =  149 bits (361), Expect = 4e-35
 Identities = 67/129 (51%), Positives = 93/129 (72%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++NVT  A+GV VNK++  RII KRI
Sbjct: 30  YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++F  R K+N+ L   AKA G+T++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVEGMTLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>UniRef50_Q7XYA8 Cluster: 60S ribosome protein L21; n=1; Griffithsia
           japonica|Rep: 60S ribosome protein L21 - Griffithsia
           japonica (Red alga)
          Length = 159

 Score =  140 bits (338), Expect = 3e-32
 Identities = 70/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++V+K+G+ VDI  N  + KGMPHK YHG+TGRV+NV+  A+GV V+KRVR RII KR 
Sbjct: 30  YLQVFKIGEYVDIHINPTIMKGMPHKFYHGRTGRVFNVSRTAVGVEVSKRVRHRIINKRF 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAG-KTVNLKRQPAPPKAAHIVSGTEKPV 481
           +IR+EHV+ S+C +DFL R K  E   +EA   G K   +KR PA P+ AH+V+  E   
Sbjct: 90  HIRIEHVRKSQCNKDFLDRCKLREIEAQEAHKRGEKYTVVKRTPALPRDAHLVTAGEME- 148

Query: 482 LLAPIPYEFV 511
           L+ PIPYEFV
Sbjct: 149 LVEPIPYEFV 158


>UniRef50_Q7R5F3 Cluster: GLP_165_41283_41762; n=3; Eukaryota|Rep:
           GLP_165_41283_41762 - Giardia lamblia ATCC 50803
          Length = 159

 Score =  129 bits (312), Expect = 4e-29
 Identities = 64/130 (49%), Positives = 90/130 (69%), Gaps = 1/130 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y +VYK+G  V+I+ NGA  KGMPH+ Y+G+TG ++N+   ALGV + KRVRGRI+ KRI
Sbjct: 30  YNRVYKLGQYVNIKVNGAYHKGMPHRYYNGRTGTIFNIGPRALGVQIQKRVRGRIMLKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVN-LKRQPAPPKAAHIVSGTEKPV 481
           N+R+EHV  S CR++ L+RV  N+   + AK  G+ V  LKRQ A P+AAH+VS     +
Sbjct: 90  NVRLEHVHPSDCRKNHLERVAANDAARRLAKETGQPVPCLKRQNALPRAAHVVS-IASAI 148

Query: 482 LLAPIPYEFV 511
            + P+ Y+ V
Sbjct: 149 DITPLKYDGV 158


>UniRef50_UPI0000E24650 Cluster: PREDICTED: similar to Ribosomal
           protein L21; n=1; Pan troglodytes|Rep: PREDICTED:
           similar to Ribosomal protein L21 - Pan troglodytes
          Length = 234

 Score =  127 bits (307), Expect = 1e-28
 Identities = 63/134 (47%), Positives = 88/134 (65%), Gaps = 1/134 (0%)
 Frame = +2

Query: 116 SPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIP 295
           +P+ + V   GDIVDI+G GAVQKG+PHK +HGKT +       A+G++ NK   G+ + 
Sbjct: 104 NPKGISVVAEGDIVDIKGMGAVQKGIPHKHFHGKTQKSLQCYQQAVGIVGNK---GKNLV 160

Query: 296 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 475
           K++N+ +EH+KHS+    FLK +K N++  K+AK     V LKRQPAPP+ A IV    K
Sbjct: 161 KKMNVLIEHIKHSESWNHFLKHIKINDQKKKDAKEKSMWVQLKRQPAPPREARIVKTNGK 220

Query: 476 -PVLLAPIPYEFVA 514
              LL P+PYEF+A
Sbjct: 221 ASELLEPVPYEFIA 234


>UniRef50_A3E3H5 Cluster: 60S ribosomal protein I21; n=3;
           Alveolata|Rep: 60S ribosomal protein I21 - Pfiesteria
           piscicida
          Length = 165

 Score =  125 bits (301), Expect = 8e-28
 Identities = 60/128 (46%), Positives = 85/128 (66%), Gaps = 1/128 (0%)
 Frame = +2

Query: 122 RYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKR 301
           RYM V++ GD VDI  + +VQ GMPH  YHG+TG V+NV  +ALGV + K V  R + KR
Sbjct: 33  RYMAVFRRGDYVDICVDSSVQVGMPHSFYHGRTGIVFNVNRNALGVEITKIVGNRQLRKR 92

Query: 302 INIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPV 481
           I++ + HV+ S+C + FL+RVKEN++  ++AK  G  +  KRQP  PK   IV   +  V
Sbjct: 93  IHVNIAHVRKSRCNEAFLRRVKENDQKKRDAKLQGLKIVCKRQPVGPKEMKIVKAEDDDV 152

Query: 482 -LLAPIPY 502
            +LAP+P+
Sbjct: 153 EVLAPLPF 160


>UniRef50_Q7REC3 Cluster: Ribosomal protein L21e, putative; n=5;
           Plasmodium|Rep: Ribosomal protein L21e, putative -
           Plasmodium yoelii yoelii
          Length = 161

 Score =  124 bits (299), Expect = 1e-27
 Identities = 56/128 (43%), Positives = 88/128 (68%), Gaps = 1/128 (0%)
 Frame = +2

Query: 122 RYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKR 301
           +Y++    GD VDI  + + QKGMP   YHG+TG+V+++T   +GV+VNKRVR RII K+
Sbjct: 30  KYLENINYGDYVDIVCDSSQQKGMPFNFYHGRTGKVFHITKRGVGVLVNKRVRHRIIQKK 89

Query: 302 INIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPK-AAHIVSGTEKP 478
           + +R+EHV+ S+C +DF+ R K+N+ L+KEAK   + +++KR+   PK AA I     K 
Sbjct: 90  VCVRIEHVRKSRCNEDFILRKKKNQELIKEAKLKNERISVKRKTEGPKPAAMIQVPPSKL 149

Query: 479 VLLAPIPY 502
           + + P+P+
Sbjct: 150 ITVEPLPF 157


>UniRef50_A2F2S5 Cluster: Ribosomal protein L21e, putative; n=6;
           Trichomonas vaginalis G3|Rep: Ribosomal protein L21e,
           putative - Trichomonas vaginalis G3
          Length = 159

 Score =  124 bits (299), Expect = 1e-27
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 1/124 (0%)
 Frame = +2

Query: 128 MKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRIN 307
           ++ +++GDIVDI+ NGA+  GMP++VYHG TG V+NV+ HA+G++V +RV   I PKRI 
Sbjct: 31  LRTFRIGDIVDIKVNGALHSGMPNRVYHGATGIVWNVSPHAVGILVKRRVNNHIAPKRIY 90

Query: 308 IRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNL-KRQPAPPKAAHIVSGTEKPVL 484
           +R EHV  SK + DF+ R + N +  +EAK AG  + L KR PA P+A+H+V    KP L
Sbjct: 91  VRTEHVFPSKSKNDFVARCQANLKAHEEAKKAGTKIALPKRLPAQPRASHVV----KPEL 146

Query: 485 LAPI 496
           +  I
Sbjct: 147 IQTI 150


>UniRef50_Q5CX53 Cluster: 60s ribosomal protein L21; n=3;
           Cryptosporidium|Rep: 60s ribosomal protein L21 -
           Cryptosporidium parvum Iowa II
          Length = 159

 Score =  121 bits (291), Expect = 1e-26
 Identities = 63/122 (51%), Positives = 78/122 (63%), Gaps = 1/122 (0%)
 Frame = +2

Query: 122 RYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKR 301
           RY+K  KVGD VDI  + ++ KGMP+  YHG+TG VYNV   ALGVIVNK V  R I KR
Sbjct: 29  RYLKPIKVGDYVDIVVDSSIHKGMPYHFYHGRTGVVYNVAPRALGVIVNKVVGNRQIAKR 88

Query: 302 INIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAG-KTVNLKRQPAPPKAAHIVSGTEKP 478
           IN+R+EHV+ S+C +DFLKRVK N+    EA  AG  +   KR P  P+    V  +   
Sbjct: 89  INVRIEHVRLSRCNEDFLKRVKANDAARHEAHVAGLPSPVTKRVPQLPREGGFVDCSNME 148

Query: 479 VL 484
           VL
Sbjct: 149 VL 150


>UniRef50_Q23TC8 Cluster: 60S ribosomal protein L21, putative; n=9;
           Oligohymenophorea|Rep: 60S ribosomal protein L21,
           putative - Tetrahymena thermophila SB210
          Length = 180

 Score =  115 bits (277), Expect = 6e-25
 Identities = 53/118 (44%), Positives = 77/118 (65%)
 Frame = +2

Query: 113 RSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
           R  RY+  YKVG+ VDI  +G+  KGMP+K+YHG+TG+V+NV   ++GVIV++ V GR I
Sbjct: 49  RISRYLTTYKVGEYVDIMVDGSQHKGMPYKLYHGRTGKVFNVNPRSIGVIVHRIVNGRYI 108

Query: 293 PKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSG 466
            KR+++++EHV+ S  +    KR + N++   E   AGK V+ KR P  P  A  V G
Sbjct: 109 EKRLHVKIEHVRPSNVKTALSKRYQANDQAKAEGNKAGKRVSTKRNPGQPLEAVQVQG 166


>UniRef50_P38653 Cluster: 60S ribosomal protein L21; n=2; Entamoeba
           histolytica|Rep: 60S ribosomal protein L21 - Entamoeba
           histolytica
          Length = 166

 Score =  113 bits (273), Expect = 2e-24
 Identities = 58/134 (43%), Positives = 86/134 (64%), Gaps = 8/134 (5%)
 Frame = +2

Query: 128 MKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRIN 307
           +  YKVGD V I  N ++Q G+P+K +HGKTGRV+NV  HA+GV+VNK+V  RI+ KR++
Sbjct: 31  LHTYKVGDYVTILCNSSIQHGLPYKAFHGKTGRVWNVNPHAIGVMVNKKVNNRIVVKRLH 90

Query: 308 IRVEHVKHSKCRQDFLKRV-------KENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSG 466
           I  EH++ S C++DFL+R        K+N +L KE K     +  KR P  P+ A ++ G
Sbjct: 91  ISPEHIRPSGCQKDFLERKAAVAAIRKQNIQLKKEGKPL-LPLPAKRLPKQPRPAELIKG 149

Query: 467 TE-KPVLLAPIPYE 505
            + K   +AP+ +E
Sbjct: 150 ADIKFTTVAPLKFE 163


>UniRef50_Q1KYN7 Cluster: RPL21; n=1; Streblomastix strix|Rep: RPL21
           - Streblomastix strix
          Length = 146

 Score =  109 bits (261), Expect = 5e-23
 Identities = 47/103 (45%), Positives = 74/103 (71%), Gaps = 1/103 (0%)
 Frame = +2

Query: 122 RYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKR 301
           RY++ + +GD VDI+ + A+ KGMP + YHG+TGR++ +  HA+G+ VNKR   RII KR
Sbjct: 29  RYLQKFNIGDYVDIKADSAIHKGMPFRYYHGRTGRIWALFNHAVGIEVNKRWGNRIIQKR 88

Query: 302 INIRVEHVKHSKCRQDFLKRVKEN-ERLLKEAKAAGKTVNLKR 427
           + IR+EHV+ SKCRQDFL+R K +  + + +    G+ V++++
Sbjct: 89  VYIRIEHVRKSKCRQDFLQRCKTHAPKRVPQGPRKGQIVHIRK 131


>UniRef50_Q8SRW8 Cluster: 60S ribosomal protein L21; n=1;
           Encephalitozoon cuniculi|Rep: 60S ribosomal protein L21
           - Encephalitozoon cuniculi
          Length = 160

 Score =  106 bits (255), Expect = 3e-22
 Identities = 48/129 (37%), Positives = 83/129 (64%), Gaps = 2/129 (1%)
 Frame = +2

Query: 122 RYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKR 301
           +Y++ Y++GD+VDI  N A+ KGMPHK YHG+TGRVY+V   +L V + KRVRG+ + K+
Sbjct: 28  KYLEKYEIGDMVDILVNPAMMKGMPHKYYHGRTGRVYDVKPRSLNVALYKRVRGKYVIKK 87

Query: 302 INIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTV--NLKRQPAPPKAAHIVSGTEK 475
           I +R+EHV+ S+C ++  KR+     + ++A++ G  +  + ++   P KA  +     +
Sbjct: 88  IIVRIEHVRKSRCSEESQKRILMAAEMARDAESRGVVLAPSKRKIEGPRKAVEVSLDNNQ 147

Query: 476 PVLLAPIPY 502
           P+ +   P+
Sbjct: 148 PIEVGYEPH 156


>UniRef50_UPI0000DD8153 Cluster: PREDICTED: similar to ribosomal
           protein L21; n=1; Homo sapiens|Rep: PREDICTED: similar
           to ribosomal protein L21 - Homo sapiens
          Length = 125

 Score = 71.3 bits (167), Expect(2) = 1e-21
 Identities = 30/48 (62%), Positives = 36/48 (75%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 268
           YM++ K GDI+DI+G G VQKGMPHK YHGK  RVY V  HA G++ N
Sbjct: 30  YMQICKKGDIIDIKGVGTVQKGMPHKCYHGKAERVYLVPQHAAGIVEN 77



 Score = 54.4 bits (125), Expect(2) = 1e-21
 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 1/52 (1%)
 Frame = +2

Query: 362 VKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPVLLAPIPYEFVA 514
           + EN++  KEAK  G  V LKRQP PP+ A  V +  +KP LL P+PYEF+A
Sbjct: 74  IVENDQKKKEAKENGTWVQLKRQPPPPRKADFVRTNGKKPELLDPLPYEFMA 125


>UniRef50_Q4QEX4 Cluster: 60S ribosomal protein l21, putative; n=10;
           Trypanosomatidae|Rep: 60S ribosomal protein l21,
           putative - Leishmania major
          Length = 159

 Score = 96.3 bits (229), Expect = 4e-19
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 1/93 (1%)
 Frame = +2

Query: 140 KVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVE 319
           KVGD VD+  + AV++GMPHK YHG+TG V+NVT   +GVI+NK VR R + KRI +R E
Sbjct: 35  KVGDYVDVVADSAVREGMPHKYYHGRTGIVWNVTPRGVGVIINKPVRTRTLRKRICVRFE 94

Query: 320 HVKHSKCRQDFLKRVKENE-RLLKEAKAAGKTV 415
           HV+ S+C++ F  + KE++ +    AK AGK +
Sbjct: 95  HVRKSRCQEAF--KAKEHQFQAYLAAKKAGKAL 125


>UniRef50_UPI0001553B37 Cluster: PREDICTED: similar to ribosomal
           protein L21; n=1; Mus musculus|Rep: PREDICTED: similar
           to ribosomal protein L21 - Mus musculus
          Length = 159

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHA 250
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHA 71


>UniRef50_A6RC90 Cluster: 60s ribosomal protein l21; n=1;
           Ajellomyces capsulatus NAm1|Rep: 60s ribosomal protein
           l21 - Ajellomyces capsulatus NAm1
          Length = 163

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 53/133 (39%), Positives = 70/133 (52%), Gaps = 6/133 (4%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKG-MPHKVYHGKTG-RVYNVTAHALGVIVNKRVRGRIIPK 298
           YM+VY+VGDIVDI+ NGAVQ+G    KVYHGKTG  +    + A GVI+ KRV  R I +
Sbjct: 30  YMRVYRVGDIVDIKVNGAVQQGSYAIKVYHGKTGVCLQRDKSLAFGVIIYKRVGNRYIGE 89

Query: 299 RINIRVEHVKHSKCRQDFLKRVKENERLLKE---AKAAGKTVNLKRQPAPPKAAHIVSGT 469
                      +   ++      E+ R L +    K  G  ++LKRQP  P+ A  VS  
Sbjct: 90  ARQRPPSSTFPTPDPEE--NSSGESRRTLSKDGRPKEEGIHIHLKRQPIGPREARTVSTE 147

Query: 470 -EKPVLLAPIPYE 505
              P  + PI YE
Sbjct: 148 GNMPETITPIAYE 160


>UniRef50_UPI0000D9A1A6 Cluster: PREDICTED: similar to 60S ribosomal
           protein L21; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to 60S ribosomal protein L21 - Macaca mulatta
          Length = 82

 Score = 70.1 bits (164), Expect = 3e-11
 Identities = 43/108 (39%), Positives = 61/108 (56%)
 Frame = +2

Query: 191 MPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKE 370
           MPHK YH KTGRVYN+T +A+G++VNK+V+G+I+ K+                  KR   
Sbjct: 1   MPHKCYHSKTGRVYNITQNAVGIVVNKQVKGKILAKK------------------KR--- 39

Query: 371 NERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYEFVA 514
                 EAK  G  V L + P+P +A  + +  ++P LLAP PYE +A
Sbjct: 40  ------EAKEKGTWVQLCQAPSPGEARFVKTTGKEPELLAPSPYELMA 81


>UniRef50_Q9AW28 Cluster: 60S ribosomal protein L21; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L21 - Guillardia theta
           (Cryptomonas phi)
          Length = 156

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 51/75 (68%)
 Frame = +2

Query: 143 VGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEH 322
           +GD+VDI  + + Q  MP K YHGKTG V+++ +++LG+ + K V  R + K+INI +EH
Sbjct: 35  IGDLVDIVIDPSFQSTMPFKFYHGKTGEVFSLNSNSLGIKIQKIVGNRKVCKKINIGLEH 94

Query: 323 VKHSKCRQDFLKRVK 367
           ++ SK    F +++K
Sbjct: 95  LRISKSNFFFEEKIK 109


>UniRef50_Q9SHE5 Cluster: T19E23.15; n=1; Arabidopsis thaliana|Rep:
           T19E23.15 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 137

 Score = 58.8 bits (136), Expect = 8e-08
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 10/105 (9%)
 Frame = +2

Query: 215 KTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSK----------CRQDFLKRV 364
           K G   NV  +     VNK+++ R I KRI++RVEHV+ S+          C  +F  R 
Sbjct: 24  KVGDYVNVKVNGAIHKVNKQIKNRNIRKRIHVRVEHVQQSRTMCLRLQQSRCDDEFSLRK 83

Query: 365 KENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIP 499
           K+N+     AKA  +T++ KRQP  PK   +V G      + PIP
Sbjct: 84  KQNDVFKAAAKAKCETISTKRQPKGPKPCFMVEGMTLET-VTPIP 127


>UniRef50_UPI0000DA1EED Cluster: PREDICTED: similar to 60S ribosomal
           protein L21; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to 60S ribosomal protein L21 - Rattus norvegicus
          Length = 122

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 37/91 (40%), Positives = 48/91 (52%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK  D+VDI+G G VQK  P  V           TA              + P  I
Sbjct: 30  YMRIYKKVDVVDIKGMGTVQKECPKCV----------TTAQP--------EESTMSPSMI 71

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAK 397
           ++ +EH+KHSK R   LKRVKEN++  KEAK
Sbjct: 72  SVWIEHIKHSKSRDSLLKRVKENDQKKKEAK 102


>UniRef50_UPI0000DC1311 Cluster: UPI0000DC1311 related cluster; n=1;
           Rattus norvegicus|Rep: UPI0000DC1311 UniRef100 entry -
           Rattus norvegicus
          Length = 88

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 7/87 (8%)
 Frame = +2

Query: 275 VRGRIIPKRINIRVEHVKHSKCR------QDFLKRVKENERLLKEAKAAGKTVNLKRQPA 436
           +R + IP R  + V  V +   R      ++F K +   E   +EA+  G  V LKRQP 
Sbjct: 2   LRAQFIPGRALLCVSKVLYQAQRSPILSSREFKKDLVTKENQEEEAEEKGAWVQLKRQPV 61

Query: 437 PPKAAHIV-SGTEKPVLLAPIPYEFVA 514
           PP+ AH+V +  ++P    PIPYEF+A
Sbjct: 62  PPREAHLVRTNGKEPEWQEPIPYEFMA 88


>UniRef50_Q9M2R5 Cluster: Putative uncharacterized protein
           T10K17.30; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein T10K17.30 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 89

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 22/52 (42%), Positives = 36/52 (69%)
 Frame = +2

Query: 272 RVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKR 427
           ++  +II KRI++ VEHV+ S+C  +F  R K+N+ L   +KA G+T++ KR
Sbjct: 38  QIGDKIIRKRIHVLVEHVQQSRCAVEFKLRKKKNDELKAASKARGETISTKR 89


>UniRef50_Q64E17 Cluster: Ribosomal protein L21E; n=3; environmental
           samples|Rep: Ribosomal protein L21E - uncultured
           archaeon GZfos17A3
          Length = 130

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 24/63 (38%), Positives = 36/63 (57%)
 Frame = +2

Query: 137 YKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRV 316
           ++ G+ V IR + +V KGMPH+ +HG TG+V      A  V ++   R R   K + IR 
Sbjct: 54  FEPGESVHIRIDPSVHKGMPHQRFHGMTGKVIGERGRAFIVEISDGKRKRKKVKELFIRA 113

Query: 317 EHV 325
           EH+
Sbjct: 114 EHL 116


>UniRef50_A4D227 Cluster: Similar to 60S RIBOSOMAL PROTEIN L21; n=1;
           Homo sapiens|Rep: Similar to 60S RIBOSOMAL PROTEIN L21 -
           Homo sapiens (Human)
          Length = 112

 Score = 42.7 bits (96), Expect = 0.005
 Identities = 29/71 (40%), Positives = 39/71 (54%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM+VYK GD VDI+G   VQKG    V   K G V  V   A   + N+  +G+   +  
Sbjct: 18  YMRVYKKGDTVDIKGIDIVQKGSSAGVTAAKLG-VDRVLQRA---VANR--QGQDSCREN 71

Query: 305 NIRVEHVKHSK 337
            +R+EH +HSK
Sbjct: 72  YVRMEHTEHSK 82


>UniRef50_Q4JB11 Cluster: 50S ribosomal protein L21e; n=8;
           Archaea|Rep: 50S ribosomal protein L21e - Sulfolobus
           acidocaldarius
          Length = 103

 Score = 42.7 bits (96), Expect = 0.005
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +2

Query: 128 MKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
           M  Y  G+ V ++ N ++ KGMPH+ YHGK G V      A  V VN   + R++
Sbjct: 33  MHDYSQGEYVVVKINPSIHKGMPHRRYHGKVGLVVGKRGKAYEVKVNIGDKERVL 87


>UniRef50_Q9UXE0 Cluster: 50S ribosomal protein L21e; n=6;
           Thermoprotei|Rep: 50S ribosomal protein L21e -
           Sulfolobus solfataricus
          Length = 101

 Score = 40.3 bits (90), Expect = 0.029
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +2

Query: 122 RYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
           + M  YK GD V ++ N +V +GMPH+ Y GK G++      A  V V    + ++I
Sbjct: 31  KLMVEYKEGDNVVVKINPSVHQGMPHRRYQGKVGKIIGKRGRAYLVSVTLGDKEKVI 87


>UniRef50_O28743 Cluster: 50S ribosomal protein L21e; n=5;
           Euryarchaeota|Rep: 50S ribosomal protein L21e -
           Archaeoglobus fulgidus
          Length = 97

 Score = 39.5 bits (88), Expect = 0.050
 Identities = 25/72 (34%), Positives = 38/72 (52%)
 Frame = +2

Query: 113 RSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
           R  ++++ + VG  V I    A QKGMPH  + G+TG V      A   +V  R  G++ 
Sbjct: 26  RIRKFLQTFDVGQRVHIDIEPASQKGMPHPRFQGRTGVVIGQRGRA--YLVQVRDGGKM- 82

Query: 293 PKRINIRVEHVK 328
            K + +R EH+K
Sbjct: 83  -KTLIVRPEHLK 93


>UniRef50_Q75F53 Cluster: AAL125Wp; n=1; Eremothecium gossypii|Rep:
           AAL125Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 369

 Score = 38.3 bits (85), Expect = 0.12
 Identities = 18/62 (29%), Positives = 35/62 (56%)
 Frame = +2

Query: 296 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 475
           + +NI+    +  K + D L++ KEN+ L+K A + G   ++KR+  P +  ++ S  +K
Sbjct: 294 ENLNIKQAFARQDKYKTDVLEKQKENDILIKGAMSVGLQQDVKREGPPRQTTNLKSTVKK 353

Query: 476 PV 481
            V
Sbjct: 354 KV 355


>UniRef50_Q5MGB3 Cluster: Transposase; n=1; Phytophthora
           infestans|Rep: Transposase - Phytophthora infestans
           (Potato late blight fungus)
          Length = 724

 Score = 35.1 bits (77), Expect = 1.1
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +1

Query: 205 IPWKDRSRVQRDCSCSRCDCQQACSRKDYTEAHQ 306
           I  KDRSR  R+C+  R +C+    + DY E H+
Sbjct: 622 IALKDRSRAIRECTVCRFECRNPTQKTDYCEKHK 655


>UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 2326

 Score = 34.7 bits (76), Expect = 1.4
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +2

Query: 368 ENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLA 490
           ++E+ +KEAK A   + LK  PA  K A++V G E PV+++
Sbjct: 308 KDEKEMKEAKDAILKLELKTLPAELKYAYLVEGNEAPVVIS 348


>UniRef50_A0BGP7 Cluster: Chromosome undetermined scaffold_106,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_106,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 155

 Score = 34.3 bits (75), Expect = 1.9
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +2

Query: 365 KENERLLKEAKAAGKTVNLKRQPAPPKAA-HIVSGTEKPVLLAPIP 499
           ++ E ++K AKAA K     ++ APPKA  H+   T+KP    P P
Sbjct: 54  QKQENIIKMAKAATKGNKGAKKTAPPKATKHVKKVTKKPTETTPAP 99


>UniRef50_Q1E5R4 Cluster: Putative uncharacterized protein; n=2;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 122

 Score = 34.3 bits (75), Expect = 1.9
 Identities = 18/70 (25%), Positives = 33/70 (47%)
 Frame = -3

Query: 364 DSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTESMSSHVVHATCLSMVYFVWHTL 185
           +S++E++     LD+ N   D +     A  +       +SSH  H   L  ++ V+H  
Sbjct: 24  ESIEEIIEDKVCLDLCNIKTDHISKKLDAKNIKFTIIGMVSSHSYHLNMLLEIHNVFHVQ 83

Query: 184 LNCTIASDVY 155
           L C  A+D++
Sbjct: 84  LLCPAATDLF 93


>UniRef50_A5FGL8 Cluster: ABC transporter related; n=1;
           Flavobacterium johnsoniae UW101|Rep: ABC transporter
           related - Flavobacterium johnsoniae UW101
          Length = 413

 Score = 33.9 bits (74), Expect = 2.5
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = -3

Query: 376 LILFDSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTE 251
           +IL DSLK+++  + ++ +LN  +D L + P+   + DN  E
Sbjct: 108 VILADSLKDLIQDIAIIQLLNRVVDVLEFVPNKALIKDNTFE 149


>UniRef50_A0RUT3 Cluster: Ribosomal protein L21E; n=2;
           Thermoprotei|Rep: Ribosomal protein L21E - Cenarchaeum
           symbiosum
          Length = 102

 Score = 33.9 bits (74), Expect = 2.5
 Identities = 21/67 (31%), Positives = 34/67 (50%)
 Frame = +2

Query: 128 MKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRIN 307
           ++ Y  GD   I  +    KG+PH+ YHGK G V      A  V ++ R+  ++  K + 
Sbjct: 36  LREYSAGDRALIIIDPRQHKGLPHRRYHGKVGTVKEAGRRA--VTLDVRLGEKM--KTLI 91

Query: 308 IRVEHVK 328
            R +H+K
Sbjct: 92  TRYDHIK 98


>UniRef50_UPI0000DB7140 Cluster: PREDICTED: hypothetical protein;
           n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein
           - Apis mellifera
          Length = 438

 Score = 33.5 bits (73), Expect = 3.3
 Identities = 22/96 (22%), Positives = 36/96 (37%), Gaps = 3/96 (3%)
 Frame = +1

Query: 100 HGTIPLSTXH-ESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCS--RCDCQQ 270
           H T+ L   H +  +  RHC H    C  +         K++      C CS    +  +
Sbjct: 213 HSTLNLLQPHRDCCRQNRHCCHSHDHCHHRCDEYNRHSSKEKRLASDTCLCSSNNSNNSR 272

Query: 271 ACSRKDYTEAHQYPC*ACQALQVQTRLP*ESQRE*E 378
            C+R D+T   +  C  C     +  L  + Q + E
Sbjct: 273 GCNRNDHTTIRESTCNNCHGKDSEKMLAMQEQNDEE 308


>UniRef50_Q6L228 Cluster: 50S ribosomal protein L21e; n=2;
           Thermoplasmatales|Rep: 50S ribosomal protein L21e -
           Picrophilus torridus
          Length = 97

 Score = 33.5 bits (73), Expect = 3.3
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 128 MKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTG 223
           MK ++VGD   I  N AV  GMPH  + G TG
Sbjct: 32  MKTFEVGDRAAIVINSAVPDGMPHHDFQGITG 63


>UniRef50_Q0YGP7 Cluster: Orn/DAP/Arg decarboxylase 2; n=3;
           Desulfuromonadales|Rep: Orn/DAP/Arg decarboxylase 2 -
           Geobacter sp. FRC-32
          Length = 439

 Score = 33.1 bits (72), Expect = 4.4
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +2

Query: 140 KVGDIVDIRGNGAVQKGMPHKVY--HGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIR 313
           ++GD V I G GA  + M  + Y  H K G V    +  L +I  K+VR +I    ++++
Sbjct: 379 EIGDYVVIGGTGAYSESMSPENYNSHRKPGAVMKTCSGELVLIRKKQVREQIFQNELDVK 438

Query: 314 V 316
           +
Sbjct: 439 L 439


>UniRef50_Q4WRE2 Cluster: SWR1-complex protein 5; n=7;
           Trichocomaceae|Rep: SWR1-complex protein 5 - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 359

 Score = 33.1 bits (72), Expect = 4.4
 Identities = 19/89 (21%), Positives = 39/89 (43%)
 Frame = +2

Query: 158 DIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSK 337
           D    G ++K    +   G TG+  N++   +  +   R+       +  I+ E  +HSK
Sbjct: 269 DPNPTGTIKKSWEKQPTAGITGQTENISGPKINTVEKSRLDWAAYVDQAGIKDELKEHSK 328

Query: 338 CRQDFLKRVKENERLLKEAKAAGKTVNLK 424
            ++ FL R+    R++ + +   +   LK
Sbjct: 329 AKEGFLGRMDFLNRVVAKREEERRNARLK 357


>UniRef50_A7HA29 Cluster: Rod shape-determining protein MreC
           precursor; n=2; Anaeromyxobacter|Rep: Rod
           shape-determining protein MreC precursor -
           Anaeromyxobacter sp. Fw109-5
          Length = 291

 Score = 32.3 bits (70), Expect = 7.6
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
 Frame = +2

Query: 155 VDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIV----NKRVRGRIIPKRINIRVEH 322
           +D      V+K MP  V  G  GRV+ V+AH   V+V    N  +   +   R    V  
Sbjct: 139 IDRGAEDGVEKLMPVVVADGVVGRVHAVSAHTADVLVVTDRNSSIAAVVERTRARANVRG 198

Query: 323 V-KHSKCRQDFLKRVKE 370
           + K   C+ D+  RV++
Sbjct: 199 LGKPDACKLDYALRVED 215


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 538,309,791
Number of Sequences: 1657284
Number of extensions: 10724211
Number of successful extensions: 36268
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 34995
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36238
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 35822246242
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -