SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VH69 Cluster: 40S ribosomal protein S29; n=31; Eukary...    83   1e-15
UniRef50_Q8INN0 Cluster: CG8495-PC, isoform C; n=1; Drosophila m...    79   2e-14
UniRef50_P62273 Cluster: 40S ribosomal protein S29; n=66; Eukary...    77   8e-14
UniRef50_P90983 Cluster: Ribosomal protein, small subunit protei...    70   1e-11
UniRef50_UPI0001554864 Cluster: PREDICTED: similar to ribosomal ...    68   5e-11
UniRef50_UPI0000E202DC Cluster: PREDICTED: similar to ribosomal ...    66   1e-10
UniRef50_A1DNZ6 Cluster: 40S ribosomal protein S29, putative; n=...    61   4e-09
UniRef50_P54110 Cluster: 30S ribosomal protein S14P; n=7; Methan...    61   6e-09
UniRef50_Q680P8 Cluster: 40S ribosomal protein S29; n=4; Eukaryo...    60   8e-09
UniRef50_Q013Q2 Cluster: RS29_CULQU 40S ribosomal protein S29; n...    59   2e-08
UniRef50_O28368 Cluster: 30S ribosomal protein S14P; n=2; cellul...    58   4e-08
UniRef50_Q1DQB3 Cluster: Predicted protein; n=4; Pezizomycotina|...    57   7e-08
UniRef50_Q4Q817 Cluster: Ribosomal protein s29, putative; n=5; T...    56   2e-07
UniRef50_Q97BW2 Cluster: 30S ribosomal protein S14P; n=12; Archa...    54   7e-07
UniRef50_O05635 Cluster: 30S ribosomal protein S14P; n=11; Therm...    53   2e-06
UniRef50_Q6CFB0 Cluster: Similar to sp|P41057 Saccharomyces cere...    52   2e-06
UniRef50_O74329 Cluster: 40S ribosomal protein S29; n=12; cellul...    52   2e-06
UniRef50_Q9HPC0 Cluster: 30S ribosomal protein S14P; n=8; Euryar...    50   1e-05
UniRef50_Q7R0P0 Cluster: GLP_79_44835_45248; n=1; Giardia lambli...    50   1e-05
UniRef50_Q22MB0 Cluster: Putative uncharacterized protein; n=1; ...    50   1e-05
UniRef50_Q74NE6 Cluster: 30S ribosomal protein S14P; n=2; Archae...    49   2e-05
UniRef50_P26816 Cluster: 30S ribosomal protein S14P; n=3; Haloba...    48   4e-05
UniRef50_Q8SS73 Cluster: 40S ribosomal protein S29; n=1; Encepha...    45   3e-04
UniRef50_P62012 Cluster: 30S ribosomal protein S14P; n=10; Archa...    40   0.012
UniRef50_A2ZKX8 Cluster: Putative uncharacterized protein; n=3; ...    39   0.027
UniRef50_Q8XHT6 Cluster: 30S ribosomal protein S14 type Z; n=83;...    36   0.25 
UniRef50_Q381G0 Cluster: Putative uncharacterized protein; n=3; ...    35   0.44 
UniRef50_A2R3T9 Cluster: Similarity to hypothetical protein YHR0...    34   0.77 
UniRef50_Q1EB19 Cluster: Putative uncharacterized protein; n=1; ...    33   1.4  
UniRef50_Q7NEG5 Cluster: 30S ribosomal protein S14 type Z; n=3; ...    33   1.4  
UniRef50_UPI000023DF20 Cluster: hypothetical protein FG07181.1; ...    32   2.4  
UniRef50_Q5B9T7 Cluster: Putative uncharacterized protein; n=1; ...    31   4.1  
UniRef50_Q0CJL5 Cluster: Predicted protein; n=3; Trichocomaceae|...    31   4.1  
UniRef50_Q9GTH4 Cluster: Nuclear receptor NHR-43; n=3; Caenorhab...    31   5.5  
UniRef50_Q9PQP7 Cluster: 30S ribosomal protein S14 type Z; n=145...    31   7.2  
UniRef50_Q2U5J9 Cluster: Predicted protein; n=3; Trichocomaceae|...    30   9.5  

>UniRef50_Q9VH69 Cluster: 40S ribosomal protein S29; n=31;
           Eukaryota|Rep: 40S ribosomal protein S29 - Drosophila
           melanogaster (Fruit fly)
          Length = 56

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 34/36 (94%), Positives = 36/36 (100%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD
Sbjct: 21  CRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 56



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MG A +WYSHPR+YGQGSR
Sbjct: 1   MGFATLWYSHPRKYGQGSR 19


>UniRef50_Q8INN0 Cluster: CG8495-PC, isoform C; n=1; Drosophila
           melanogaster|Rep: CG8495-PC, isoform C - Drosophila
           melanogaster (Fruit fly)
          Length = 55

 Score = 79.4 bits (187), Expect = 2e-14
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 146 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD
Sbjct: 21  RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 55


>UniRef50_P62273 Cluster: 40S ribosomal protein S29; n=66;
           Eukaryota|Rep: 40S ribosomal protein S29 - Homo sapiens
           (Human)
          Length = 56

 Score = 77.0 bits (181), Expect = 8e-14
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR CSNRHGLIRKYGLN+CRQCFR+YA DIGF KLD
Sbjct: 20  SCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD 56



 Score = 35.9 bits (79), Expect = 0.19
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHPR++GQGSR
Sbjct: 1   MGHQQLYWSHPRKFGQGSR 19


>UniRef50_P90983 Cluster: Ribosomal protein, small subunit protein
           29; n=18; Eukaryota|Rep: Ribosomal protein, small
           subunit protein 29 - Caenorhabditis elegans
          Length = 56

 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 28/37 (75%), Positives = 32/37 (86%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR C+  HGLIRKYGL++CR+CFRE A DIGFKKLD
Sbjct: 20  SCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD 56



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MG  N+W+SHPR++G GSR
Sbjct: 1   MGFQNLWFSHPRKFGPGSR 19


>UniRef50_UPI0001554864 Cluster: PREDICTED: similar to ribosomal
           protein S29; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to ribosomal protein S29 -
           Ornithorhynchus anatinus
          Length = 168

 Score = 67.7 bits (158), Expect = 5e-11
 Identities = 28/33 (84%), Positives = 30/33 (90%)
 Frame = +2

Query: 146 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           R CSNRHGLIRKYGLN+CRQCFR+YA DIGF K
Sbjct: 85  RVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIK 117


>UniRef50_UPI0000E202DC Cluster: PREDICTED: similar to ribosomal
           protein S29; n=4; Theria|Rep: PREDICTED: similar to
           ribosomal protein S29 - Pan troglodytes
          Length = 56

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 29/37 (78%), Positives = 30/37 (81%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR  SNRHG IRKYGLN CRQCF +YA DIGF KLD
Sbjct: 20  SCRVYSNRHGRIRKYGLNKCRQCFHQYAKDIGFIKLD 56



 Score = 34.3 bits (75), Expect = 0.59
 Identities = 11/19 (57%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHP+++GQGSR
Sbjct: 1   MGHQQLYWSHPQKFGQGSR 19


>UniRef50_A1DNZ6 Cluster: 40S ribosomal protein S29, putative; n=2;
           Fungi/Metazoa group|Rep: 40S ribosomal protein S29,
           putative - Neosartorya fischeri (strain ATCC 1020 / DSM
           3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC
           1020 / DSM 3700 / NRRL 181))
          Length = 86

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 25/35 (71%), Positives = 30/35 (85%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 247
           CR C++R GLIRKYG++ICRQCFRE A DIGF K+
Sbjct: 21  CRVCAHRAGLIRKYGMDICRQCFREKAQDIGFYKV 55



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSRXMPILLQQAWLNPQVRFEHMQTVLQRVCS*HRIQEAGLNGV 261
           M H ++WYS PR++G+GSR   +   +A L   +R   M   + R C   + Q+ G   V
Sbjct: 1   MTHESVWYSRPRKFGKGSRECRVCAHRAGL---IRKYGMD--ICRQCFREKAQDIGFYKV 55

Query: 262 G 264
           G
Sbjct: 56  G 56


>UniRef50_P54110 Cluster: 30S ribosomal protein S14P; n=7;
           Methanococcales|Rep: 30S ribosomal protein S14P -
           Methanococcus jannaschii
          Length = 53

 Score = 60.9 bits (141), Expect = 6e-09
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (2%)
 Frame = +2

Query: 143 CRSCSN-RHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           C+ C +   GLIRKYGLN+CRQCFRE AH +GFKKLD
Sbjct: 17  CQRCGHVGPGLIRKYGLNLCRQCFREIAHKLGFKKLD 53


>UniRef50_Q680P8 Cluster: 40S ribosomal protein S29; n=4;
           Eukaryota|Rep: 40S ribosomal protein S29 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 56

 Score = 60.5 bits (140), Expect = 8e-09
 Identities = 25/34 (73%), Positives = 26/34 (76%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C N HGLIRKYGLN CRQCFR  A +IGF K
Sbjct: 21  CRVCGNSHGLIRKYGLNCCRQCFRSNAKEIGFIK 54



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP++YG GSR
Sbjct: 1   MGHSNVWNSHPKKYGPGSR 19


>UniRef50_Q013Q2 Cluster: RS29_CULQU 40S ribosomal protein S29; n=1;
           Ostreococcus tauri|Rep: RS29_CULQU 40S ribosomal protein
           S29 - Ostreococcus tauri
          Length = 157

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 146 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           R C N+  +IRKY LNICRQCFREYA DIGF+K
Sbjct: 123 RVCENQWAIIRKYNLNICRQCFREYAKDIGFQK 155



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+++W SHP  YG+GSR
Sbjct: 23  MGHSDVWASHPANYGKGSR 41


>UniRef50_O28368 Cluster: 30S ribosomal protein S14P; n=2; cellular
           organisms|Rep: 30S ribosomal protein S14P -
           Archaeoglobus fulgidus
          Length = 51

 Score = 58.0 bits (134), Expect = 4e-08
 Identities = 23/34 (67%), Positives = 26/34 (76%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C  R GLIR YGL +CRQCFRE A ++GFKK
Sbjct: 16  CRRCGRRRGLIRMYGLYLCRQCFREVASELGFKK 49


>UniRef50_Q1DQB3 Cluster: Predicted protein; n=4;
           Pezizomycotina|Rep: Predicted protein - Coccidioides
           immitis
          Length = 123

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C+++ GLIRKYGL +CRQCFRE + DIGF K
Sbjct: 21  CRVCAHKAGLIRKYGLLVCRQCFREKSQDIGFVK 54



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSRXMPILLQQAWL 171
           M H +++YS PR YG+GSR   +   +A L
Sbjct: 1   MTHESVFYSRPRNYGKGSRQCRVCAHKAGL 30


>UniRef50_Q4Q817 Cluster: Ribosomal protein s29, putative; n=5;
           Trypanosomatidae|Rep: Ribosomal protein s29, putative -
           Leishmania major
          Length = 57

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 24/35 (68%), Positives = 26/35 (74%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 247
           C  CSN+  LIRKY LN+CRQCFRE A  IGF KL
Sbjct: 22  CVICSNQKALIRKYELNVCRQCFRENAEHIGFTKL 56


>UniRef50_Q97BW2 Cluster: 30S ribosomal protein S14P; n=12;
           Archaea|Rep: 30S ribosomal protein S14P - Thermoplasma
           volcanium
          Length = 53

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 19/37 (51%), Positives = 27/37 (72%)
 Frame = +2

Query: 134 LGSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           +  C  C  + G++RKYGL++CRQCFRE A  +GF+K
Sbjct: 15  IDGCVRCGRKRGIVRKYGLHLCRQCFRETARQLGFEK 51


>UniRef50_O05635 Cluster: 30S ribosomal protein S14P; n=11;
           Thermoprotei|Rep: 30S ribosomal protein S14P -
           Sulfolobus acidocaldarius
          Length = 54

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 20/39 (51%), Positives = 29/39 (74%)
 Frame = +2

Query: 128 KDLGSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           K +  C+ C +R  +I+KYGL +CRQCFRE A+ +GF+K
Sbjct: 14  KGVQLCKRCGSRDSVIQKYGLYLCRQCFREVAYPMGFRK 52


>UniRef50_Q6CFB0 Cluster: Similar to sp|P41057 Saccharomyces
           cerevisiae YLR388w YS29A ribosomal protein S29; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P41057
           Saccharomyces cerevisiae YLR388w YS29A ribosomal protein
           S29 - Yarrowia lipolytica (Candida lipolytica)
          Length = 78

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 22/34 (64%), Positives = 27/34 (79%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR  +N++ +IRKYGLN+CRQ FRE A DIGF K
Sbjct: 43  CRITNNQNAVIRKYGLNLCRQSFREKAADIGFTK 76



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSRXMPILLQQ 162
           M H NIW+SHPR YG+G R   I   Q
Sbjct: 23  MAHENIWFSHPRHYGKGGRKCRITNNQ 49


>UniRef50_O74329 Cluster: 40S ribosomal protein S29; n=12; cellular
           organisms|Rep: 40S ribosomal protein S29 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 56

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           C     R GLIRKYGLNI RQ FREYA+DIGF K
Sbjct: 21  CAHTGRRLGLIRKYGLNISRQSFREYANDIGFVK 54



 Score = 40.3 bits (90), Expect = 0.009
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           M H N+W+SHPR+YG+GSR
Sbjct: 1   MAHENVWFSHPRKYGKGSR 19


>UniRef50_Q9HPC0 Cluster: 30S ribosomal protein S14P; n=8;
           Euryarchaeota|Rep: 30S ribosomal protein S14P -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 52

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C    GL+ KY + +CRQCFRE A  +GFKK
Sbjct: 17  CRRCGREQGLVGKYDIWLCRQCFREIARSMGFKK 50


>UniRef50_Q7R0P0 Cluster: GLP_79_44835_45248; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_79_44835_45248 - Giardia lamblia
           ATCC 50803
          Length = 137

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 21/35 (60%), Positives = 25/35 (71%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 247
           CR C N + + RKYGL ICR+CF+E A  IGF KL
Sbjct: 102 CRICGNYNSVYRKYGLFICRRCFKENAGKIGFVKL 136


>UniRef50_Q22MB0 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 239

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/40 (55%), Positives = 25/40 (62%)
 Frame = +2

Query: 128 KDLGSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 247
           KD   CR C  R GLI KY +  CR+CFRE A  IGF K+
Sbjct: 15  KDSKECRVCGARQGLITKYEMMTCRRCFREQAPHIGFVKV 54


>UniRef50_Q74NE6 Cluster: 30S ribosomal protein S14P; n=2;
           Archaea|Rep: 30S ribosomal protein S14P - Nanoarchaeum
           equitans
          Length = 69

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           C  C    G+IR+YGL +C+ CF+E AH++GF K
Sbjct: 33  CERCGRYDGIIRRYGLYLCKDCFKEVAHELGFFK 66


>UniRef50_P26816 Cluster: 30S ribosomal protein S14P; n=3;
           Halobacteriaceae|Rep: 30S ribosomal protein S14P -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 61

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = +2

Query: 134 LGSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           L SC+ C    GL+ KY + +CRQCFRE +  +GF+K
Sbjct: 23  LESCQRCGREQGLVGKYDIWLCRQCFREISRGMGFRK 59


>UniRef50_Q8SS73 Cluster: 40S ribosomal protein S29; n=1;
           Encephalitozoon cuniculi|Rep: 40S ribosomal protein S29
           - Encephalitozoon cuniculi
          Length = 55

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 22/37 (59%), Positives = 25/37 (67%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SC SC    G+IRK  L +CR+CFREYA DIGF   D
Sbjct: 21  SCVSCYTFRGIIRK--LMMCRRCFREYAGDIGFAIYD 55


>UniRef50_P62012 Cluster: 30S ribosomal protein S14P; n=10;
           Archaea|Rep: 30S ribosomal protein S14P - Pyrococcus
           abyssi
          Length = 56

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           C  C     +IR +GL +CR CFRE A  +GF+K +
Sbjct: 21  CIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE 56


>UniRef50_A2ZKX8 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 141

 Score = 38.7 bits (86), Expect = 0.027
 Identities = 13/19 (68%), Positives = 16/19 (84%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH+N+W SHP+ YG GSR
Sbjct: 1   MGHSNVWNSHPKNYGPGSR 19


>UniRef50_Q8XHT6 Cluster: 30S ribosomal protein S14 type Z; n=83;
           Bacteria|Rep: 30S ribosomal protein S14 type Z -
           Clostridium perfringens
          Length = 61

 Score = 35.5 bits (78), Expect = 0.25
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAH 226
           CR C   H +++K+G  ICR CFRE A+
Sbjct: 24  CRLCGRPHSVLKKFG--ICRICFRELAY 49


>UniRef50_Q381G0 Cluster: Putative uncharacterized protein; n=3;
            Trypanosoma|Rep: Putative uncharacterized protein -
            Trypanosoma brucei
          Length = 4128

 Score = 34.7 bits (76), Expect = 0.44
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -3

Query: 204  CLHMFKPYLRIKPCLLEQDRHXPRSLSVSARVRIPNICVAHFKKLNCC 61
            C H   P+  +   LL  +   P  L V   V IP +C  + K   CC
Sbjct: 2536 CAHSHHPFTEMGSNLLVSNNTPPSKLDVGMSVAIPAVCAFYLKSEGCC 2583


>UniRef50_A2R3T9 Cluster: Similarity to hypothetical protein YHR040w
           -Saccharomyces cerevisiae; n=1; Aspergillus niger|Rep:
           Similarity to hypothetical protein YHR040w
           -Saccharomyces cerevisiae - Aspergillus niger
          Length = 396

 Score = 33.9 bits (74), Expect = 0.77
 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 6/55 (10%)
 Frame = -1

Query: 260 TPFSPAS*I--LCHEHTL*STVCICSNRTCGLS----HACWSRIGMXRDPCPYLR 114
           TP SP S +  +CH          CS RTC L     H  WS+    RDP  YLR
Sbjct: 5   TPDSPLSDLCSICHLQPPKYRCPRCSTRTCSLPCTRRHKLWSQCSGVRDPAAYLR 59


>UniRef50_Q1EB19 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 393

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = -1

Query: 233 LCHEHTL*STVCICSNRTCGLS----HACWSRIGMXRDPCPYLR 114
           +CH +    T   CS RTC L     H  WS+    RDP  YL+
Sbjct: 12  ICHTNLPKYTCPRCSTRTCSLPCSKRHKLWSQCSGVRDPAAYLK 55


>UniRef50_Q7NEG5 Cluster: 30S ribosomal protein S14 type Z; n=3;
           Bacteria|Rep: 30S ribosomal protein S14 type Z -
           Gloeobacter violaceus
          Length = 68

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 15/28 (53%), Positives = 16/28 (57%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAH 226
           C  C    G IR +GL  CR CFRE AH
Sbjct: 31  CWRCGRPRGYIRDFGL--CRICFREMAH 56


>UniRef50_UPI000023DF20 Cluster: hypothetical protein FG07181.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07181.1 - Gibberella zeae PH-1
          Length = 59

 Score = 32.3 bits (70), Expect = 2.4
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           M H ++W S PR YG+GSR
Sbjct: 1   MSHESVWNSRPRNYGKGSR 19


>UniRef50_Q5B9T7 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 466

 Score = 31.5 bits (68), Expect = 4.1
 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 4/31 (12%)
 Frame = -1

Query: 194 CSNRTCGLS----HACWSRIGMXRDPCPYLR 114
           CS RTC L     H  WS+    RDP  YLR
Sbjct: 27  CSTRTCSLPCTRRHKLWSQCSGVRDPAAYLR 57


>UniRef50_Q0CJL5 Cluster: Predicted protein; n=3;
           Trichocomaceae|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 636

 Score = 31.5 bits (68), Expect = 4.1
 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 4/31 (12%)
 Frame = -1

Query: 194 CSNRTCGLS----HACWSRIGMXRDPCPYLR 114
           CS RTC L     H  WS+    RDP  YLR
Sbjct: 274 CSTRTCSLPCSRRHKLWSQCSGIRDPAAYLR 304


>UniRef50_Q9GTH4 Cluster: Nuclear receptor NHR-43; n=3;
           Caenorhabditis|Rep: Nuclear receptor NHR-43 -
           Caenorhabditis elegans
          Length = 459

 Score = 31.1 bits (67), Expect = 5.5
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 244
           CR C  R+   + +G++ICR C   +   +  KK
Sbjct: 57  CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 90


>UniRef50_Q9PQP7 Cluster: 30S ribosomal protein S14 type Z; n=145;
           Bacteria|Rep: 30S ribosomal protein S14 type Z -
           Ureaplasma parvum (Ureaplasma urealyticum biotype 1)
          Length = 61

 Score = 30.7 bits (66), Expect = 7.2
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAH 226
           C  C   H + RK+G  +CR CFR+ A+
Sbjct: 24  CVRCGRPHAVNRKFG--VCRLCFRDLAY 49


>UniRef50_Q2U5J9 Cluster: Predicted protein; n=3;
           Trichocomaceae|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 413

 Score = 30.3 bits (65), Expect = 9.5
 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%)
 Frame = -1

Query: 194 CSNRTCGLS----HACWSRIGMXRDPCPYLR 114
           CS RTC L     H  WS+    RDP  YL+
Sbjct: 27  CSTRTCSLPCSRRHKLWSQCSGVRDPAAYLK 57


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 260,084,485
Number of Sequences: 1657284
Number of extensions: 4536406
Number of successful extensions: 9723
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 9486
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9718
length of database: 575,637,011
effective HSP length: 89
effective length of database: 428,138,735
effective search space used: 11131607110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -