SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B01
         (653 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26; B...   223   4e-57
UniRef50_A6BM65 Cluster: Cytochrome oxidase subunit I; n=1; Peri...   205   8e-52
UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30; P...   194   2e-48
UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181; ...   184   2e-45
UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861; ...   178   1e-43
UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941; ...   175   8e-43
UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498...   174   2e-42
UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455; ...   170   2e-41
UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126; ...   169   4e-41
UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI...   165   1e-39
UniRef50_Q0H8Y1 Cluster: Probable intron-encoded endonuclease aI...   165   1e-39
UniRef50_Q58PB7 Cluster: Cytochrome c oxidase subunit I; n=106; ...   162   8e-39
UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;...   162   8e-39
UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179; ...   160   2e-38
UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;...   148   1e-34
UniRef50_Q9ZZX1 Cluster: Intron-encoded DNA endonuclease aI5 alp...   148   1e-34
UniRef50_P03878 Cluster: Intron-encoded DNA endonuclease aI4 pre...   148   1e-34
UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa group|...   146   4e-34
UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2 pol...   141   1e-32
UniRef50_Q8M352 Cluster: I-SceII DNA endonuclease-like protein; ...   141   2e-32
UniRef50_Q0H8Y0 Cluster: Probable intron-encoded endonuclease aI...   140   4e-32
UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825; ...   136   3e-31
UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1; Na...   133   3e-30
UniRef50_Q9B6E6 Cluster: COX1-i5 protein; n=3; Fungi/Metazoa gro...   129   7e-29
UniRef50_Q6ED53 Cluster: Cox1-i5 protein; n=2; Candida stellata|...   127   3e-28
UniRef50_Q6ED52 Cluster: Cox1-i4 protein; n=1; Candida stellata|...   127   3e-28
UniRef50_Q6ED51 Cluster: Cox-i3 protein; n=1; Candida stellata|R...   127   3e-28
UniRef50_Q6ED50 Cluster: Cox-i2 protein; n=1; Candida stellata|R...   127   3e-28
UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15; F...   125   8e-28
UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3; Alphaproteob...   118   2e-25
UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5; Na...   116   5e-25
UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular or...   107   2e-22
UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388; ...   104   2e-21
UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42; N...   102   7e-21
UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7; Eu...    98   1e-19
UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9; Co...    97   3e-19
UniRef50_Q0H8X8 Cluster: Probable intron-encoded endonuclease aI...    90   4e-17
UniRef50_Q59IQ0 Cluster: Cytochrome c oxidase subunit I; n=1; Wa...    88   2e-16
UniRef50_Q35061 Cluster: CoxI intron4 ORF; n=3; Marchantia polym...    84   2e-15
UniRef50_Q3L2S5 Cluster: Cytochrome c oxidase subunit I; n=1; Ae...    81   2e-14
UniRef50_Q8HCX2 Cluster: Cytochrome c oxidase subunit I; n=1; Ap...    79   1e-13
UniRef50_Q18JR5 Cluster: Cytochrome-c-like terminal oxidase, sub...    79   1e-13
UniRef50_Q9B6E4 Cluster: COX1-i3 protein; n=2; Yarrowia lipolyti...    76   9e-13
UniRef50_Q9XKD7 Cluster: Cytochrome c oxidase subunit I; n=1; Di...    72   1e-11
UniRef50_Q36097 Cluster: Cytochrome c oxidase subunit 1; n=3; Th...    71   2e-11
UniRef50_A6XEV4 Cluster: Cytochrome c oxidase subunit 1; n=1; Mu...    71   2e-11
UniRef50_Q9YDX6 Cluster: Heme-copper oxidase subunit I+III; n=1;...    71   2e-11
UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107; ...    70   4e-11
UniRef50_Q5K464 Cluster: Putative DNA endonuclease; n=1; Kluyver...    70   6e-11
UniRef50_A7HEB5 Cluster: Cytochrome-c oxidase; n=2; Cystobacteri...    69   1e-10
UniRef50_Q34463 Cluster: Cytochrome oxidase subunit I; n=3; Eugl...    68   2e-10
UniRef50_P34956 Cluster: Quinol oxidase subunit 1 (EC 1.10.3.-) ...    66   9e-10
UniRef50_O67935 Cluster: Cytochrome c oxidase subunit I; n=1; Aq...    65   1e-09
UniRef50_A6C5X9 Cluster: Cytochrome caa3 oxidase; n=3; Bacteria|...    65   1e-09
UniRef50_P33518 Cluster: Cytochrome c oxidase polypeptide 1; n=4...    64   2e-09
UniRef50_A7BSH8 Cluster: Cytochrome c oxidase aa3, subunit 1; n=...    63   5e-09
UniRef50_A7H8L4 Cluster: Cytochrome c oxidase subunit I type; n=...    63   6e-09
UniRef50_A5UVJ0 Cluster: Cytochrome-c oxidase; n=2; Roseiflexus|...    63   6e-09
UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1; M...    61   2e-08
UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93; A...    61   2e-08
UniRef50_A1XI88 Cluster: Cytochrome c oxidase subunit I; n=1; My...    59   8e-08
UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517; ...    59   1e-07
UniRef50_P98005 Cluster: Cytochrome c oxidase polypeptide I+III ...    59   1e-07
UniRef50_Q98P35 Cluster: Cytochrome C oxidase subunit I; n=16; c...    58   1e-07
UniRef50_Q0I8U1 Cluster: Cytochrome c oxidase subunit I; n=16; B...    58   2e-07
UniRef50_A3ZTG1 Cluster: Cytochrome c oxidase subunit I; n=1; Bl...    58   2e-07
UniRef50_Q06473 Cluster: Cytochrome c oxidase subunit 1 (EC 1.9....    57   3e-07
UniRef50_Q7NQZ0 Cluster: Cytochrome o ubiquinol oxidase, subunit...    56   7e-07
UniRef50_Q5V018 Cluster: Cytochrome c oxidase subunit I; n=3; Ha...    54   4e-06
UniRef50_A1ZL77 Cluster: Alternative Cytochrome c oxidase polype...    53   5e-06
UniRef50_A0RZ19 Cluster: Heme/copper-type cytochrome/quinol oxid...    52   9e-06
UniRef50_A3SJL2 Cluster: QoxA, Quinol oxidase subunit I; n=2; Rh...    52   1e-05
UniRef50_P24010 Cluster: Cytochrome c oxidase subunit 1 (EC 1.9....    51   2e-05
UniRef50_A0TRU9 Cluster: Cytochrome-c oxidase; n=30; Proteobacte...    51   3e-05
UniRef50_Q9WWR2 Cluster: Ubiquinol oxidase subunit 1 (EC 1.10.3....    50   4e-05
UniRef50_P98000 Cluster: Alternative cytochrome c oxidase subuni...    50   4e-05
UniRef50_Q9Z605 Cluster: Quinol oxidase subunit I; n=15; Proteob...    50   5e-05
UniRef50_Q8ZXD1 Cluster: Cytochrome C oxidase subunit I /III; n=...    50   6e-05
UniRef50_Q0AI64 Cluster: Cytochrome-c oxidase; n=3; Proteobacter...    49   9e-05
UniRef50_P11947 Cluster: Cytochrome c oxidase subunit 1; n=48; O...    48   3e-04
UniRef50_Q6KZG3 Cluster: Cytochrome c oxidase polypeptide I/III;...    46   8e-04
UniRef50_Q67ML1 Cluster: Cytochrome C oxidase subunit I; n=17; B...    44   0.003
UniRef50_Q05FH1 Cluster: Cytochrome O ubiquinol oxidase subunit ...    44   0.004
UniRef50_Q9RR77 Cluster: Cytochrome c oxidase, subunit I; n=2; D...    42   0.013
UniRef50_A0VUI8 Cluster: Cytochrome-c oxidase; n=1; Dinoroseobac...    42   0.013
UniRef50_Q94WV3 Cluster: Cytochrome oxidase subunit I; n=1; Pach...    42   0.013
UniRef50_Q7YI87 Cluster: Cytochrome oxidase subunit I; n=1; Cela...    41   0.023
UniRef50_A6C0L1 Cluster: Cytochrome c oxidase subunit I; n=1; Pl...    41   0.030
UniRef50_Q1H1C1 Cluster: Cytochrome-c oxidase; n=1; Methylobacil...    40   0.039
UniRef50_Q9B6E2 Cluster: Cytochrome c oxidase subunit I; n=2; Ya...    40   0.069
UniRef50_Q1IUK7 Cluster: Cytochrome-c oxidase; n=2; Acidobacteri...    39   0.091
UniRef50_P03876 Cluster: Putative COX1/OXI3 intron 2 protein; n=...    39   0.091
UniRef50_Q35062 Cluster: CoxI intron2 ORF; n=2; Marchantia polym...    39   0.12 
UniRef50_Q2N1P8 Cluster: Cytochrome c oxidase subunit I; n=2; Eu...    39   0.12 
UniRef50_Q11EK8 Cluster: Cytochrome c oxidase, subunit I; n=5; P...    38   0.28 
UniRef50_Q0R4Y4 Cluster: Maturase-like protein; n=2; Eukaryota|R...    36   0.85 
UniRef50_Q2ABI9 Cluster: NADH-ubiquinone oxidoreductase chain 2;...    35   1.5  
UniRef50_P03877 Cluster: Intron-encoded DNA endonuclease aI3 pre...    34   2.6  
UniRef50_P39481 Cluster: Quinol oxidase subunit 1/3; n=5; Sulfol...    34   3.4  
UniRef50_A5FXH8 Cluster: Cytochrome-c oxidase; n=1; Acidiphilium...    33   6.0  
UniRef50_A4WT83 Cluster: Cytochrome c, monohaem; n=3; Rhodobacte...    33   6.0  

>UniRef50_Q4FH11 Cluster: Cytochrome c oxidase subunit I; n=26;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Samia
           cynthia ricini (Indian eri silkmoth)
          Length = 510

 Score =  223 bits (544), Expect = 4e-57
 Identities = 122/216 (56%), Positives = 129/216 (59%)
 Frame = +1

Query: 4   RK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAX 183
           RK +YSTNHKDIGTLY                   AELG PGSLIGDDQIYNTIVTAHA 
Sbjct: 1   RKWLYSTNHKDIGTLYFIFGIWAGMVGTSLSLLIRAELGTPGSLIGDDQIYNTIVTAHAF 60

Query: 184 XXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAG 363
                           N LVPL+LGAPD+AFPR+NN+ F              IVENGAG
Sbjct: 61  IMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLISSSIVENGAG 120

Query: 364 TG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPL 543
           TG TVYPPLSSNIAH G SVDLAIFSLHLAGISS                   SFDQ+PL
Sbjct: 121 TGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFITTIINMRMNNLSFDQMPL 180

Query: 544 FV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           FV AVGITAF          GAIT+LLTDRNLNTSF
Sbjct: 181 FVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNTSF 216


>UniRef50_A6BM65 Cluster: Cytochrome oxidase subunit I; n=1;
           Periclimenes thermohydrophilus|Rep: Cytochrome oxidase
           subunit I - Periclimenes thermohydrophilus
          Length = 217

 Score =  205 bits (500), Expect = 8e-52
 Identities = 112/204 (54%), Positives = 130/204 (63%)
 Frame = -1

Query: 653 KNDVFKFRSVNNIVIAPGKTGSDNNNKNAVIPTAHTNKGN*SNDXXXXXXXXXXXXXXXX 474
           K +VFKFRSV +IVIAP  TGS++N+K AV  T  TN G  S                  
Sbjct: 15  KKEVFKFRSVKSIVIAPASTGSESNSKMAVSNTDQTNSGMRSMVIPADRMLITVVMKFTA 74

Query: 473 XXIDEIPAKCSEKIARSTDLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGGRSQNL 294
             I+E PAKC+EKI  STD P CAI   SGG TVHPVP P STI L  + ++EGG +QNL
Sbjct: 75  PKIEETPAKCNEKIPMSTDAPACAIPLASGGYTVHPVPTPLSTIPLNKSKVKEGGSNQNL 134

Query: 293 ILFIRGNAISGAPSIRGTNQFPNPPXXXXXXXXXXXXKACAVTIVL*I*SSPINDPGFPN 114
           +LFIRGNA+SGAP++ GTNQFPNPP            KA AVT+ L I S PI  PG PN
Sbjct: 135 MLFIRGNAMSGAPNMSGTNQFPNPPIMIGMTMKKIITKAWAVTMTL-IWSFPIKLPGCPN 193

Query: 113 SARIKSLKDVPIIPDQIPKIKYNV 42
           SARIKSL DVP +P   PK+KYNV
Sbjct: 194 SARIKSLSDVPTMPAHAPKMKYNV 217


>UniRef50_Q30DC3 Cluster: Cytochrome c oxidase subunit I; n=30;
           Panarthropoda|Rep: Cytochrome c oxidase subunit I -
           Pagyris cymothoe
          Length = 487

 Score =  194 bits (472), Expect = 2e-48
 Identities = 104/180 (57%), Positives = 112/180 (62%)
 Frame = +1

Query: 112 ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINN 291
           ELG PGSLIGDDQIYNTIVTAHA                 N L+PL+LGAPD+AFPR+NN
Sbjct: 13  ELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMLGAPDMAFPRMNN 72

Query: 292 IRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXX 471
           + F              IVENGAGTG TVYPPLSSNIAH G SVDLAIFSLHLAGISS  
Sbjct: 73  MSFWLLPPSLILLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSIL 132

Query: 472 XXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                            SFDQ+PLF+ AVGITA           GAIT+LLTDRNLNTSF
Sbjct: 133 GAINFITTIINMRINKMSFDQMPLFIWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSF 192


>UniRef50_Q9MCX7 Cluster: Cytochrome c oxidase subunit I; n=181;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Piculus
           rubiginosus
          Length = 504

 Score =  184 bits (447), Expect = 2e-45
 Identities = 103/213 (48%), Positives = 117/213 (54%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           ++STNHKDIGTLY                   AELG PG+L+GDDQIYN IVTAHA    
Sbjct: 8   LFSTNHKDIGTLYLIFGAWAGMIGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMI 67

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N LVPL++GAPD+AFPR+NN+ F               VE GAGTG 
Sbjct: 68  FFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLXPPSFLLLLASSTVEAGAGTGW 127

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           TVYPPL+ N+AH G SVDLAIFSLHLAGISS                   S  Q PLFV 
Sbjct: 128 TVYPPLAGNLAHAGASVDLAIFSLHLAGISSILGAINFITTAINMKPPAISQYQTPLFVW 187

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +V ITA             IT+LLTDRNLNT+F
Sbjct: 188 SVLITAVLLLLSLPVLAAGITMLLTDRNLNTTF 220


>UniRef50_Q9MIY8 Cluster: Cytochrome c oxidase subunit 1; n=861;
           root|Rep: Cytochrome c oxidase subunit 1 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 516

 Score =  178 bits (433), Expect = 1e-43
 Identities = 99/212 (46%), Positives = 113/212 (53%)
 Frame = +1

Query: 16  YSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXX 195
           +STNHKDIGTLY                   AEL  PG+L+GDDQIYN IVTAHA     
Sbjct: 8   FSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIF 67

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N LVPL++GAPD+AFPR+NN+ F               VE GAGTG T
Sbjct: 68  FMVMPILIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWT 127

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
           VYPPL+ N+AH G SVDL IFSLHLAG+SS                   S  Q PLFV A
Sbjct: 128 VYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKPPTISQYQTPLFVWA 187

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +TA             IT+LLTDRNLNT+F
Sbjct: 188 VLVTAVLLLLSLPVLAAGITMLLTDRNLNTTF 219


>UniRef50_Q6ZLV6 Cluster: Cytochrome c oxidase subunit I; n=941;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Ophisurus macrorhynchos
          Length = 546

 Score =  175 bits (426), Expect = 8e-43
 Identities = 97/212 (45%), Positives = 113/212 (53%)
 Frame = +1

Query: 16  YSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXX 195
           +STNHKDIGTLY                   AEL  PG+L+GDDQIYN IVTAHA     
Sbjct: 8   FSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIF 67

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N LVPL++GAPD+AFPR+NN+ F               VE GAGTG T
Sbjct: 68  FMVMPVMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWT 127

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
           VYPPL+ N+AH G SVDL IFSLHLAG+SS                   +  Q PLFV +
Sbjct: 128 VYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAITQYQTPLFVWS 187

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +TA             IT+LLTDRNLNT+F
Sbjct: 188 VLVTAVLLLLSLPVLAAGITMLLTDRNLNTTF 219


>UniRef50_P00395 Cluster: Cytochrome c oxidase subunit 1; n=44498;
           root|Rep: Cytochrome c oxidase subunit 1 - Homo sapiens
           (Human)
          Length = 513

 Score =  174 bits (423), Expect = 2e-42
 Identities = 96/213 (45%), Positives = 114/213 (53%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           ++STNHKDIGTLY                   AELG PG+L+G+D IYN IVTAHA    
Sbjct: 7   LFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMI 66

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N LVPL++GAPD+AFPR+NN+ F              +VE GAGTG 
Sbjct: 67  FFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGW 126

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           TVYPPL+ N +H G SVDL IFSLHLAG+SS                   +  Q PLFV 
Sbjct: 127 TVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVW 186

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +V ITA             IT+LLTDRNLNT+F
Sbjct: 187 SVLITAVLLLLSLPVLAAGITMLLTDRNLNTTF 219


>UniRef50_Q8SK39 Cluster: Cytochrome c oxidase subunit I; n=455;
           cellular organisms|Rep: Cytochrome c oxidase subunit I -
           Pandaka lidwilli
          Length = 507

 Score =  170 bits (414), Expect = 2e-41
 Identities = 96/208 (46%), Positives = 109/208 (52%)
 Frame = +1

Query: 28  HKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXX 207
           HKDIGTLY                   AEL  PG+L+GDDQIYN IVTAHA         
Sbjct: 1   HKDIGTLYLIFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVM 60

Query: 208 XXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPP 387
                   N L+PL++GAPD+AFPR+NN+ F               +E GAGTG TVYPP
Sbjct: 61  PIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGIEAGAGTGWTVYPP 120

Query: 388 LSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGIT 567
           L+ N+AH G SVDL IFSLHLAGISS                   S  Q PLFV AV IT
Sbjct: 121 LAGNLAHAGASVDLTIFSLHLAGISSILGAINFITTIMNMKPPAISQYQTPLFVWAVLIT 180

Query: 568 AFXXXXXXXXXXGAITILLTDRNLNTSF 651
           A             IT+LLTDRNLNT+F
Sbjct: 181 AVLLLLSLPVLAAGITMLLTDRNLNTTF 208


>UniRef50_A2T435 Cluster: Cytochrome c oxidase subunit I; n=126;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Placozoan sp. BZ2423
          Length = 498

 Score =  169 bits (412), Expect = 4e-41
 Identities = 92/212 (43%), Positives = 112/212 (52%)
 Frame = +1

Query: 16  YSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXX 195
           +S NHKDIG+LY                    EL +PGS++GDD +YN IVTAHA     
Sbjct: 9   FSCNHKDIGSLYLVFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIF 68

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N  VPL++GAPD+AFPR+NNI F              +VE GAGTG T
Sbjct: 69  FLVMPTMIGGFGNWFVPLMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWT 128

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
           VYPPL+S  AH G SVD+AIFSLHLAG+SS                   +  ++PLFV +
Sbjct: 129 VYPPLASIQAHSGGSVDMAIFSLHLAGLSSILGAMNFITTVMNMRTPGMTMSRIPLFVWS 188

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V ITA           GAIT+LLTDR  NT+F
Sbjct: 189 VLITAILLLLSLPVLAGAITMLLTDRYFNTTF 220


>UniRef50_Q0H8Y3 Cluster: Probable intron-encoded endonuclease aI8
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI8 (EC
           3.1.-.-)]; n=103; Eukaryota|Rep: Probable intron-encoded
           endonuclease aI8 precursor [Contains: Truncated
           non-functional cytochrome oxidase 1; Intron-encoded
           endonuclease aI8 (EC 3.1.-.-)] - Ustilago maydis (Smut
           fungus)
          Length = 645

 Score =  165 bits (400), Expect = 1e-39
 Identities = 95/215 (44%), Positives = 110/215 (51%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDIGTLY                    EL  PG   L GD Q+YN I+TAHA  
Sbjct: 5   LYSTNAKDIGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFV 64

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVP+++GAPD+AFPR+NNI F               VE GAGT
Sbjct: 65  MIFFMVMPAMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSLILLLASAFVEQGAGT 124

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLS   +H G SVDLAIFSLHL+GISS                   +  +LPLF
Sbjct: 125 GWTVYPPLSGLQSHSGGSVDLAIFSLHLSGISSMLGAMNFITTVLNMRNPGMTLHKLPLF 184

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V A+ +TA           GAIT+LLTDRN NTSF
Sbjct: 185 VWAIFVTAILLLLSLPVLAGAITMLLTDRNFNTSF 219


>UniRef50_Q0H8Y1 Cluster: Probable intron-encoded endonuclease aI5
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI5 (EC
           3.1.-.-)]; n=2; Ustilago maydis|Rep: Probable
           intron-encoded endonuclease aI5 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI5 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 536

 Score =  165 bits (400), Expect = 1e-39
 Identities = 95/215 (44%), Positives = 110/215 (51%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDIGTLY                    EL  PG   L GD Q+YN I+TAHA  
Sbjct: 5   LYSTNAKDIGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFV 64

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVP+++GAPD+AFPR+NNI F               VE GAGT
Sbjct: 65  MIFFMVMPAMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSLILLLASAFVEQGAGT 124

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLS   +H G SVDLAIFSLHL+GISS                   +  +LPLF
Sbjct: 125 GWTVYPPLSGLQSHSGGSVDLAIFSLHLSGISSMLGAMNFITTVLNMRNPGMTLHKLPLF 184

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V A+ +TA           GAIT+LLTDRN NTSF
Sbjct: 185 VWAIFVTAILLLLSLPVLAGAITMLLTDRNFNTSF 219


>UniRef50_Q58PB7 Cluster: Cytochrome c oxidase subunit I; n=106;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Homalopoma maculosa
          Length = 219

 Score =  162 bits (393), Expect = 8e-39
 Identities = 88/180 (48%), Positives = 101/180 (56%)
 Frame = +1

Query: 112 ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINN 291
           ELG PGS IG+DQ+YN +VTAHA                 N LVPL+LGAPD+AFPR+NN
Sbjct: 23  ELGQPGSFIGNDQLYNVVVTAHAFVMIFFLVMPMMIGGFGNWLVPLMLGAPDMAFPRLNN 82

Query: 292 IRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXX 471
           + F               VE+GAGTG TVYPPLS N AH G SVDLAIFSLHLAG+SS  
Sbjct: 83  MSFWFLPPSLSLLLMSAAVESGAGTGWTVYPPLSGNTAHAGPSVDLAIFSLHLAGVSSIL 142

Query: 472 XXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                              + + LFV +V ITA           GAIT+LLTDRN NTSF
Sbjct: 143 GAVNFITTVINMRWGAMKIELVSLFVWSVKITAILLLLSLPVLAGAITMLLTDRNFNTSF 202


>UniRef50_P60620 Cluster: Cytochrome c oxidase subunit 1; n=2931;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 527

 Score =  162 bits (393), Expect = 8e-39
 Identities = 89/215 (41%), Positives = 112/215 (52%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYNTIVTAHAXX 186
           ++STNHKDIGTLY                    EL  PG  I  G+ Q+YN ++TAHA  
Sbjct: 8   LFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFL 67

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N  VP+++GAPD+AFPR+NNI F              +VE G+GT
Sbjct: 68  MIFFMVMPAMIGGFGNWFVPILIGAPDMAFPRLNNISFWLLPPSLLLLLSSALVEVGSGT 127

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLS   +H G +VDLAIFSLHL+G+SS                   +  +LPLF
Sbjct: 128 GWTVYPPLSGITSHSGGAVDLAIFSLHLSGVSSILGSINFITTIFNMRGPGMTMHRLPLF 187

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +V +TAF          GAIT+LLTDRN NT+F
Sbjct: 188 VWSVLVTAFLLLLSLPVLAGAITMLLTDRNFNTTF 222


>UniRef50_P48866 Cluster: Cytochrome c oxidase subunit 1; n=179;
           cellular organisms|Rep: Cytochrome c oxidase subunit 1 -
           Chondrus crispus (Carragheen)
          Length = 532

 Score =  160 bits (389), Expect = 2e-38
 Identities = 90/215 (41%), Positives = 113/215 (52%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           I+STNHKDIGTLY                    EL  P +  L+G+ QIYN ++TAHA  
Sbjct: 13  IFSTNHKDIGTLYLIFGAFSGVLGGCMSMLIRMELAQPSNHLLLGNHQIYNVLITAHAFL 72

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVP+++G+PD+AFPR+NNI F              +VE G GT
Sbjct: 73  MIFFMVMPVMIGGFGNWLVPIMIGSPDMAFPRLNNISFWLLPPSLCLLLMSALVEVGVGT 132

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLSS  +H G +VDLAIFSLH++G SS                   S  ++PLF
Sbjct: 133 GWTVYPPLSSIQSHSGGAVDLAIFSLHISGASSILGAVNFISTILNMRSPGQSMYRIPLF 192

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V ++ +TAF          GAIT+LLTDRN NTSF
Sbjct: 193 VWSILVTAFLLLLAVPVLAGAITMLLTDRNFNTSF 227


>UniRef50_Q5GGF4 Cluster: Cytochrome c oxidase subunit I; n=2742;
           Bilateria|Rep: Cytochrome c oxidase subunit I - Cotesia
           melitaearum (Parasitoid wasp)
          Length = 499

 Score =  148 bits (359), Expect = 1e-34
 Identities = 81/180 (45%), Positives = 99/180 (55%)
 Frame = +1

Query: 112 ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINN 291
           ELG PGSLIG+DQIYN+IVT+HA                 N L+PL+LG+PD++FPR+NN
Sbjct: 24  ELGMPGSLIGNDQIYNSIVTSHAFIMIFFMVMPVMIGGFGNWLIPLMLGSPDMSFPRMNN 83

Query: 292 IRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXX 471
           + F               +  G GTG TVYPPLS  + H G SVDL IFSLHLAG SS  
Sbjct: 84  MSFWLLIPSLLLLILSMFINVGVGTGWTVYPPLSLILGHGGMSVDLGIFSLHLAGASSIM 143

Query: 472 XXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                            + D++ LF  +V ITA           GAIT+LLTDRN+NTSF
Sbjct: 144 GAVNFITTILNMRSNLFNMDKMSLFSWSVFITAILLLLSLPVLAGAITMLLTDRNMNTSF 203


>UniRef50_Q9ZZX1 Cluster: Intron-encoded DNA endonuclease aI5 alpha
           precursor (DNA endonuclease I-SceIV) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI5 alpha (EC 3.1.-.-) (Intron-encoded
           endonuclease I- SceIV)]; n=2; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI5 alpha precursor (DNA
           endonuclease I-SceIV) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI5 alpha (EC 3.1.-.-) (Intron-encoded endonuclease I-
           SceIV)] - Saccharomyces cerevisiae (Baker's yeast)
          Length = 630

 Score =  148 bits (358), Expect = 1e-34
 Identities = 88/215 (40%), Positives = 104/215 (48%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDI  LY                    EL  PGS  L G+ Q++N +V  HA  
Sbjct: 6   LYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVL 65

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N L+PL++GA D AFPRINNI F              +VE+GAGT
Sbjct: 66  MIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGT 125

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLSS  AH G SVDLAIF+LHL  ISS                   +  +LPLF
Sbjct: 126 GWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLF 185

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V ++ ITAF            IT+LL DRN NTSF
Sbjct: 186 VWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSF 220


>UniRef50_P03878 Cluster: Intron-encoded DNA endonuclease aI4
           precursor (DNA endonuclease I- SceII) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI4 (EC 3.1.-.-) (Intron-encoded
           endonuclease I-SceII)]; n=4; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI4 precursor (DNA
           endonuclease I- SceII) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI4 (EC 3.1.-.-) (Intron-encoded endonuclease I-SceII)]
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 556

 Score =  148 bits (358), Expect = 1e-34
 Identities = 88/215 (40%), Positives = 104/215 (48%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDI  LY                    EL  PGS  L G+ Q++N +V  HA  
Sbjct: 6   LYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVL 65

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N L+PL++GA D AFPRINNI F              +VE+GAGT
Sbjct: 66  MIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGT 125

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLSS  AH G SVDLAIF+LHL  ISS                   +  +LPLF
Sbjct: 126 GWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLF 185

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V ++ ITAF            IT+LL DRN NTSF
Sbjct: 186 VWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSF 220


>UniRef50_Q7YEU6 Cluster: Endonuclease; n=4; Fungi/Metazoa
           group|Rep: Endonuclease - Saccharomyces servazzii
           (Yeast)
          Length = 675

 Score =  146 bits (354), Expect = 4e-34
 Identities = 86/215 (40%), Positives = 105/215 (48%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDI  +Y                    EL  PGS  L G+ Q++N +V  HA  
Sbjct: 6   LYSTNAKDISIMYFMLALFSGMAGSAMSMIIRMELAAPGSQYLHGNSQLFNVLVVGHAVL 65

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N ++PL++GA D++FPRIN+I F              +VE+GAGT
Sbjct: 66  MIFFLAMPALIGGFGNYMLPLMIGATDMSFPRINSIGFWLLPMGLVCLVTSTLVESGAGT 125

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLSS  AH G SVDLAIFSLHL  ISS                   S  ++PLF
Sbjct: 126 GWTVYPPLSSIQAHSGPSVDLAIFSLHLTSISSLLGAINFIVTTLNMRTNGMSMHKMPLF 185

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V A+ ITAF            IT+LL DRN NTSF
Sbjct: 186 VWAIFITAFLLLLSLPVLSAGITMLLMDRNFNTSF 220


>UniRef50_A7UG06 Cluster: Cytochrome oxidase subunits 1 and 2
           polyprotein; n=1; Phaeosphaeria nodorum SN15|Rep:
           Cytochrome oxidase subunits 1 and 2 polyprotein -
           Phaeosphaeria nodorum SN15
          Length = 789

 Score =  141 bits (342), Expect = 1e-32
 Identities = 84/212 (39%), Positives = 100/212 (47%), Gaps = 1/212 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-SLIGDDQIYNTIVTAHAXXXXX 195
           S+N KDIG LY                    EL  PG   I D+Q+YN+I+TAHA     
Sbjct: 9   SSNAKDIGVLYLIYALFAGLIGTAFSVLIRLELSGPGVQYIADNQLYNSIITAHAIIMIF 68

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N L+PL LG PD+ FPR+NNI +               +ENG GTG T
Sbjct: 69  FMVMPALIGGFGNFLLPLGLGGPDMGFPRLNNISYLLLIPSIVLFLFAGGIENGVGTGWT 128

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
           +YPPLS   +H G SVDLAIF LHL+GISS                      +L LF  A
Sbjct: 129 LYPPLSGIQSHSGPSVDLAIFGLHLSGISSLLGAMNFMTTTFNMRSPGIRLHKLILFAWA 188

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V ITA           G IT++LTDRN NTSF
Sbjct: 189 VVITAVLLLLSLPVLAGGITMVLTDRNFNTSF 220


>UniRef50_Q8M352 Cluster: I-SceII DNA endonuclease-like protein;
           n=1; Saccharomyces castellii|Rep: I-SceII DNA
           endonuclease-like protein - Saccharomyces castellii
           (Yeast)
          Length = 598

 Score =  141 bits (341), Expect = 2e-32
 Identities = 83/215 (38%), Positives = 103/215 (47%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDI  LY                    EL  PG   L G++Q++N +V  HA  
Sbjct: 6   LYSTNAKDIAVLYFLLALFSGMAGTAMSLIIRLELAAPGQQYLHGNNQLFNVLVVGHAIL 65

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N ++PL++GA D AFPRINNI F              +VE+GAGT
Sbjct: 66  MIFFMVMPALIGGFGNYMLPLMIGATDTAFPRINNIGFWLLPMGLVCLVTSTLVESGAGT 125

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPL+S  AH G SVDLAIF+LH+  ISS                   +  +LPLF
Sbjct: 126 GWTVYPPLASIQAHSGPSVDLAIFALHMTSISSLLGAINFIVTTLNMRTNGMTMHKLPLF 185

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V A+ ITA             +T+LL DRN NTSF
Sbjct: 186 VWAILITAVLLLLTLPVLSAGVTMLLLDRNFNTSF 220


>UniRef50_Q0H8Y0 Cluster: Probable intron-encoded endonuclease aI4
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI4 (EC
           3.1.-.-)]; n=3; Basidiomycota|Rep: Probable
           intron-encoded endonuclease aI4 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI4 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 530

 Score =  140 bits (338), Expect = 4e-32
 Identities = 81/188 (43%), Positives = 95/188 (50%), Gaps = 2/188 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDIGTLY                    EL  PG   L GD Q+YN I+TAHA  
Sbjct: 5   LYSTNAKDIGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFV 64

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVP+++GAPD+AFPR+NNI F               VE GAGT
Sbjct: 65  MIFFMVMPAMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSLILLLASAFVEQGAGT 124

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLS   +H G SVDLAIFSLHL+GISS                   +  +LPLF
Sbjct: 125 GWTVYPPLSGLQSHSGGSVDLAIFSLHLSGISSMLGAMNFITTVLNMRNPGMTLHKLPLF 184

Query: 547 V*AVGITA 570
           V A+ +TA
Sbjct: 185 VWAIFVTA 192


>UniRef50_Q1XA94 Cluster: Cytochrome c oxidase subunit I; n=825;
           Eukaryota|Rep: Cytochrome c oxidase subunit I -
           Paracoccidioides brasiliensis
          Length = 710

 Score =  136 bits (330), Expect = 3e-31
 Identities = 79/212 (37%), Positives = 99/212 (46%), Gaps = 1/212 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-SLIGDDQIYNTIVTAHAXXXXX 195
           S+N KDI  LY                    EL  PG   I D+Q+YN+I+T+H      
Sbjct: 35  SSNAKDIAILYLIFALFSGLLGTAFSVLIRLELSGPGIQYIEDNQLYNSIITSHGVIMIF 94

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N L+P+++G PD+AFPR+NN+ +              I+ENG GTG T
Sbjct: 95  FMVMPALIGGFGNFLLPILIGGPDMAFPRLNNVSYWLLIPSLFLFVFAAIIENGVGTGWT 154

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
           +YPPLS   +H    VDL IF LHL+GISS                      +L LF  A
Sbjct: 155 LYPPLSGIQSHSSMGVDLGIFGLHLSGISSLLGAINFIATLLNMRSPGIKLHKLALFGWA 214

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V ITA            AIT+LLTDRNLNTSF
Sbjct: 215 VVITAVLLLLSLPVLAAAITMLLTDRNLNTSF 246


>UniRef50_Q9G8S1 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Naegleria gruberi|Rep: Cytochrome c oxidase subunit 1 -
           Naegleria gruberi
          Length = 633

 Score =  133 bits (322), Expect = 3e-30
 Identities = 80/215 (37%), Positives = 94/215 (43%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           I++TNHK IG LY                    EL  PG   L G+   YN I T H   
Sbjct: 9   IFTTNHKRIGILYLFFGVFNGFLAVLLSMLMRLELAFPGDQILFGEYHFYNMITTVHGVL 68

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N  VP+++GAPD++FPR+NN  F                E G GT
Sbjct: 69  MLFVVVMPILFGGFGNYFVPILIGAPDMSFPRLNNFSFWLLPGAILLAVLATYSEGGPGT 128

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVYPPLSS  +H G SVDL IFS HL GI S                       LPLF
Sbjct: 129 GWTVYPPLSSLQSHSGASVDLMIFSFHLVGIGSIVAAINFICTIFYYKNEAMFNKDLPLF 188

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +V +T+F           AIT+LL DRN NTSF
Sbjct: 189 VWSVAVTSFLVIVAIPVLAAAITLLLFDRNFNTSF 223


>UniRef50_Q9B6E6 Cluster: COX1-i5 protein; n=3; Fungi/Metazoa
           group|Rep: COX1-i5 protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 608

 Score =  129 bits (311), Expect = 7e-29
 Identities = 78/215 (36%), Positives = 99/215 (46%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           ++STN KDI  LY                    EL N GS  L G+ Q +N ++TAHA  
Sbjct: 11  LFSTNAKDIAVLYFIFALFSAMIGTGLSAIIRLELANTGSPFLHGNTQAFNVVITAHAIL 70

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N L+PL+LGA D+AF R+NNI F              +VE GAGT
Sbjct: 71  MIFFFVMPALVGGFGNYLMPLMLGASDMAFARLNNISFWLLVPSLILILTSALVEAGAGT 130

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G TVY PL+   +H G +VDLAIFSLHL+G SS                    ++ +PLF
Sbjct: 131 GWTVYFPLAGIQSHSGPAVDLAIFSLHLSGFSSLLGAINFITTFINMRTIGMKYENVPLF 190

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
             AV  TA             +T+ + DRN NTSF
Sbjct: 191 AWAVLFTAILLLLSLPVLAAGLTMGIFDRNFNTSF 225


>UniRef50_Q6ED53 Cluster: Cox1-i5 protein; n=2; Candida
           stellata|Rep: Cox1-i5 protein - Candida stellata (Yeast)
          Length = 763

 Score =  127 bits (306), Expect = 3e-28
 Identities = 73/215 (33%), Positives = 103/215 (47%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELG--NPGSLIGDDQIYNTIVTAHAXX 186
           ++STN ++I  LY                    EL   NP  L+ + Q++N ++TAHA  
Sbjct: 23  LFSTNCQNISILYGIFSLFSGLVGLSLSVLMRIELSSPNPQILMHNGQLWNVLITAHALF 82

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVPL +G+ D AFPRINN+ F              +++ G G+
Sbjct: 83  MVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAFVVLLPSMLFAVLSCLIDEGPGS 142

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G T+YPPL+S  +H G S+D+AIF+LHL+G+SS                    + +LPLF
Sbjct: 143 GWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAINLMVTIINMRANGMDYSKLPLF 202

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +V ITA             +T+LL DRN NTSF
Sbjct: 203 VWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSF 237


>UniRef50_Q6ED52 Cluster: Cox1-i4 protein; n=1; Candida
           stellata|Rep: Cox1-i4 protein - Candida stellata (Yeast)
          Length = 676

 Score =  127 bits (306), Expect = 3e-28
 Identities = 73/215 (33%), Positives = 103/215 (47%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELG--NPGSLIGDDQIYNTIVTAHAXX 186
           ++STN ++I  LY                    EL   NP  L+ + Q++N ++TAHA  
Sbjct: 23  LFSTNCQNISILYGIFSLFSGLVGLSLSVLMRIELSSPNPQILMHNGQLWNVLITAHALF 82

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVPL +G+ D AFPRINN+ F              +++ G G+
Sbjct: 83  MVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAFVVLLPSMLFAVLSCLIDEGPGS 142

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G T+YPPL+S  +H G S+D+AIF+LHL+G+SS                    + +LPLF
Sbjct: 143 GWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAINLMVTIINMRANGMDYSKLPLF 202

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +V ITA             +T+LL DRN NTSF
Sbjct: 203 VWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSF 237


>UniRef50_Q6ED51 Cluster: Cox-i3 protein; n=1; Candida stellata|Rep:
           Cox-i3 protein - Candida stellata (Yeast)
          Length = 588

 Score =  127 bits (306), Expect = 3e-28
 Identities = 73/215 (33%), Positives = 103/215 (47%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELG--NPGSLIGDDQIYNTIVTAHAXX 186
           ++STN ++I  LY                    EL   NP  L+ + Q++N ++TAHA  
Sbjct: 23  LFSTNCQNISILYGIFSLFSGLVGLSLSVLMRIELSSPNPQILMHNGQLWNVLITAHALF 82

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVPL +G+ D AFPRINN+ F              +++ G G+
Sbjct: 83  MVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAFVVLLPSMLFAVLSCLIDEGPGS 142

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G T+YPPL+S  +H G S+D+AIF+LHL+G+SS                    + +LPLF
Sbjct: 143 GWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAINLMVTIINMRANGMDYSKLPLF 202

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +V ITA             +T+LL DRN NTSF
Sbjct: 203 VWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSF 237


>UniRef50_Q6ED50 Cluster: Cox-i2 protein; n=1; Candida stellata|Rep:
           Cox-i2 protein - Candida stellata (Yeast)
          Length = 586

 Score =  127 bits (306), Expect = 3e-28
 Identities = 73/215 (33%), Positives = 103/215 (47%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELG--NPGSLIGDDQIYNTIVTAHAXX 186
           ++STN ++I  LY                    EL   NP  L+ + Q++N ++TAHA  
Sbjct: 23  LFSTNCQNISILYGIFSLFSGLVGLSLSVLMRIELSSPNPQILMHNGQLWNVLITAHALF 82

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVPL +G+ D AFPRINN+ F              +++ G G+
Sbjct: 83  MVFYLVMPITMGALANYLVPLQIGSNDTAFPRINNLAFVVLLPSMLFAVLSCLIDEGPGS 142

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
           G T+YPPL+S  +H G S+D+AIF+LHL+G+SS                    + +LPLF
Sbjct: 143 GWTLYPPLTSLQSHSGSSIDMAIFALHLSGLSSIFGAINLMVTIINMRANGMDYSKLPLF 202

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V +V ITA             +T+LL DRN NTSF
Sbjct: 203 VWSVLITAVLIILALPVLAAGLTMLLMDRNFNTSF 237


>UniRef50_Q8SHP5 Cluster: Cytochrome c oxidase subunit I; n=15;
           Fungi/Metazoa group|Rep: Cytochrome c oxidase subunit I
           - Trichoderma reesei (Hypocrea jecorina)
          Length = 635

 Score =  125 bits (302), Expect = 8e-28
 Identities = 79/216 (36%), Positives = 99/216 (45%), Gaps = 5/216 (2%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-SLIGDDQIYNTIVTAHAXXXXX 195
           STN KDIGTLY                    EL  PG   I ++Q+YN+I+TAHA     
Sbjct: 37  STNAKDIGTLYLIFALFSGLLGTAFSVLIRLELSGPGVQFIANNQLYNSIITAHAILMIF 96

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N L+PL++G PD+AFPR+NNI F              I+E G GTG T
Sbjct: 97  FMVMPALIGGFGNFLMPLMIGGPDMAFPRLNNISFWLLPPSLLLLVFSAIIEGGVGTGWT 156

Query: 376 V----YPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPL 543
           +    YPPLS   +H G SVDLAIF+LHL+G+SS                      +L L
Sbjct: 157 LLKDKYPPLSGLQSHSGPSVDLAIFALHLSGVSSLLGSINFITTVANMRTPGIKLHKLAL 216

Query: 544 FV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           F        +            IT++LTDRN NTSF
Sbjct: 217 F-------GWATWSSRSRYFLGITMVLTDRNFNTSF 245


>UniRef50_Q1NET5 Cluster: Cytochrome-c oxidase; n=3;
           Alphaproteobacteria|Rep: Cytochrome-c oxidase -
           Sphingomonas sp. SKA58
          Length = 556

 Score =  118 bits (283), Expect = 2e-25
 Identities = 83/231 (35%), Positives = 103/231 (44%), Gaps = 20/231 (8%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-------SLIGD------DQIY- 156
           STNHKDIGTLY                   AEL  PG       +   D      DQ Y 
Sbjct: 33  STNHKDIGTLYLIFAIIAGIIGGAISGLMRAELAEPGIQYLQTWARFSDGPSATLDQAYH 92

Query: 157 --NTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXX 330
             N ++TAH                  N  VP+++GAPD+AFPR+NNI F          
Sbjct: 93  LWNVLITAHGLIMVFFMVMPAMIGGFGNWFVPIMIGAPDMAFPRMNNISFWLLIPAFALL 152

Query: 331 XXXXIVE----NGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXX 498
                V     NGAGTG TVY PLS++    G +VD+AI SLH+AG SS           
Sbjct: 153 LGSTFVPGGTGNGAGTGWTVYAPLSTS-GSAGPAVDMAILSLHIAGASSILGAINFITTI 211

Query: 499 XXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                   +  ++PLFV +V +TAF           AIT+LLTDRN  T+F
Sbjct: 212 LNMRAPGMTLHKMPLFVWSVLVTAFLLLLALPVLAAAITMLLTDRNFGTTF 262


>UniRef50_Q9MLW1 Cluster: Cytochrome c oxidase subunit I; n=5;
           Naupactini|Rep: Cytochrome c oxidase subunit I -
           Galapaganus collaris
          Length = 406

 Score =  116 bits (279), Expect = 5e-25
 Identities = 67/135 (49%), Positives = 76/135 (56%)
 Frame = +1

Query: 247 LILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVD 426
           L LGAPD  FPR  N+ F               VE GAGTG TV PPLS+NIAH G SVD
Sbjct: 4   LXLGAPDXXFPRXINMSFWFLPPXLSFFLXSSXVEKGAGTGWTVSPPLSANIAHEGSSVD 63

Query: 427 LAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXG 606
           LAIFSLH+AG+ S                   +  ++PLFV AV ITA           G
Sbjct: 64  LAIFSLHMAGVXSILGAINFISTVLNMRPSGMTPXRMPLFVWAVEITAILLLLSLPVLAG 123

Query: 607 AITILLTDRNLNTSF 651
           AIT+LLTDRN+NTSF
Sbjct: 124 AITMLLTDRNINTSF 138


>UniRef50_Q28SZ5 Cluster: Cytochrome-c oxidase; n=50; cellular
           organisms|Rep: Cytochrome-c oxidase - Jannaschia sp.
           (strain CCS1)
          Length = 628

 Score =  107 bits (258), Expect = 2e-22
 Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 2/183 (1%)
 Frame = +1

Query: 109 AELGNPGSLIG--DDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPR 282
           A LG    L G  D  ++N ++T H                  N  +PL++GAPD+AFPR
Sbjct: 143 ALLGTMDQLDGNPDGHLWNVLITGHGVLMMFFVVIPALFGGFGNYFMPLMIGAPDMAFPR 202

Query: 283 INNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGIS 462
           +NN+ +              +++ GAG G T YPP+S+      R+VD AIF++H++G S
Sbjct: 203 LNNLSYWMYVAGTCLAFCSVMIDGGAGPGWTFYPPISAQGVETSRAVDFAIFAVHVSGAS 262

Query: 463 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLN 642
           S                   +  ++PLF  +V +TA+          GAIT+LLTDRN  
Sbjct: 263 SILGSINFITTFLNMRAPGMTLHKVPLFAWSVFVTAWLLLLSLPVLAGAITMLLTDRNFG 322

Query: 643 TSF 651
           T+F
Sbjct: 323 TTF 325


>UniRef50_Q951H1 Cluster: Cytochrome c oxidase subunit I; n=388;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Picoides
           borealis
          Length = 513

 Score =  104 bits (250), Expect = 2e-21
 Identities = 59/127 (46%), Positives = 68/127 (53%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           + STNHKD GTL                    AELG PG+L+GDDQ  N IVTAHA    
Sbjct: 8   LXSTNHKDXGTLXXIFGAWAGMIGTALSLLIRAELGQPGTLLGDDQXXNVIVTAHAFVMI 67

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N LVPL++GAPD+AFPR+NN+ F               VE GAGTG 
Sbjct: 68  FXMXMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGW 127

Query: 373 TVYPPLS 393
           TVYPPL+
Sbjct: 128 TVYPPLA 134


>UniRef50_O47573 Cluster: Cytochrome c oxidase subunit I; n=42;
           Nematoda|Rep: Cytochrome c oxidase subunit I -
           Onchocerca volvulus
          Length = 548

 Score =  102 bits (245), Expect = 7e-21
 Identities = 63/215 (29%), Positives = 86/215 (40%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           I + NHK IGT Y                    EL +PG     G  Q+YN+++T H   
Sbjct: 16  INTVNHKTIGTYYIVLGYWAGLGGSVLSMLIRFELSSPGGHLFFGSGQVYNSVLTMHGVL 75

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N ++PL+LGAP++AFPR+N + F               +  G G+
Sbjct: 76  MIFFLVMPILIGGFGNWMLPLMLGAPEMAFPRVNALSFWFTFVALLMVYQSFFIGGGPGS 135

Query: 367 G*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
             T YPPLS        S+D  I  LH  GI S                   + DQ+ +F
Sbjct: 136 SWTFYPPLSVE-GQPELSLDTMILGLHTVGIGSLLGAINFMVTTQNMRSTAVTLDQISMF 194

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V    +T+F          G++  LL DRN NTSF
Sbjct: 195 VWTSYLTSFLLVLSVPVLAGSLLFLLLDRNFNTSF 229


>UniRef50_P14544 Cluster: Cytochrome c oxidase subunit 1; n=7;
           Eukaryota|Rep: Cytochrome c oxidase subunit 1 -
           Leishmania tarentolae (Sauroleishmania tarentolae)
          Length = 549

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 63/213 (29%), Positives = 83/213 (38%), Gaps = 2/213 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELG--NPGSLIGDDQIYNTIVTAHAXXXX 192
           S +HK IG  Y                    EL     G L GD Q YN ++T+H     
Sbjct: 10  SVSHKMIGLCYLLVAILSGFVGYVYSLFIRLELSLIGCGILFGDYQFYNVLITSHGLIMV 69

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N  +P++ G PD+ FPR+NN+ F              + E G G G 
Sbjct: 70  FAFIMPVMMGGLVNYFIPVMAGFPDMVFPRLNNMSFWMYLAGFGCVVNGFLTEEGMGVGW 129

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           T+YP L     H   + D  +F++HL GISS                   SF    LF+ 
Sbjct: 130 TLYPTLICIDFHSSLACDFVMFAVHLLGISSILNSINLLGTLFCCRRKFFSFLSWSLFIW 189

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           A  ITA           G +T++L DRN NTSF
Sbjct: 190 AALITAILLIITLPVLAGGVTLILCDRNFNTSF 222


>UniRef50_Q5W914 Cluster: Cytochrome c oxidase subunit I; n=9;
           Coelomata|Rep: Cytochrome c oxidase subunit I - Lingula
           unguis
          Length = 573

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 59/212 (27%), Positives = 89/212 (41%), Gaps = 1/212 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           S NHKDIGT+Y                    EL +PG  +    +Y++I+T HA      
Sbjct: 11  SVNHKDIGTIYLYMGLWSGVFGLSLSHCMRIELSHPGEWLQVGYMYHSIMTMHAFMMIFF 70

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                      N  +PL++   D++ PR+NN+                +   G G G T+
Sbjct: 71  FVMPTSIGGLGNWFIPLMIKIKDLSMPRLNNLSVWLALGSLFLMCMAFLSSGGLGCGWTM 130

Query: 379 YPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQL-PLFV*A 555
           YPPLS++    G  +DLA+FSLH+AG+SS                    F  L P+ +  
Sbjct: 131 YPPLSNSEFMDGLPIDLAVFSLHMAGMSSIAGSINFLVTIFNMRMGALFFMSLNPMLIWT 190

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +  T+             +T+LL DR+ +TSF
Sbjct: 191 LFGTSILLVTSVPVLAAGLTLLLLDRHFSTSF 222


>UniRef50_Q0H8X8 Cluster: Probable intron-encoded endonuclease aI2
           precursor [Contains: Truncated non-functional cytochrome
           oxidase 1; Intron-encoded endonuclease aI2 (EC
           3.1.-.-)]; n=2; Ustilago maydis|Rep: Probable
           intron-encoded endonuclease aI2 precursor [Contains:
           Truncated non-functional cytochrome oxidase 1;
           Intron-encoded endonuclease aI2 (EC 3.1.-.-)] - Ustilago
           maydis (Smut fungus)
          Length = 533

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 54/132 (40%), Positives = 62/132 (46%), Gaps = 2/132 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDIGTLY                    EL  PG   L GD Q+YN I+TAHA  
Sbjct: 5   LYSTNAKDIGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFV 64

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N LVP+++GAPD+AFPR+NNI F               VE GAGT
Sbjct: 65  MIFFMVMPAMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSLILLLASAFVEQGAGT 124

Query: 367 G*TVYPPLSSNI 402
           G TV   LS  I
Sbjct: 125 GWTVKCKLSQII 136


>UniRef50_Q59IQ0 Cluster: Cytochrome c oxidase subunit I; n=1;
           Watasenia scintillans|Rep: Cytochrome c oxidase subunit
           I - Watasenia scintillans (Sparkling enope)
          Length = 217

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 51/118 (43%), Positives = 61/118 (51%)
 Frame = +1

Query: 112 ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINN 291
           ELG PGSL+ DDQ+YN +VTAH                  N LVPL+LGAPD+AFPR+NN
Sbjct: 24  ELGQPGSLLNDDQLYNVVVTAHGFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNN 83

Query: 292 IRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 465
           + F              +   G      +  PL       G SVDLAIF LHLAG+SS
Sbjct: 84  MSFGFFPLHWHYYSFFTV--KGGLARDELSTPLYLVTISAGPSVDLAIFPLHLAGVSS 139


>UniRef50_Q35061 Cluster: CoxI intron4 ORF; n=3; Marchantia
           polymorpha|Rep: CoxI intron4 ORF - Marchantia polymorpha
           (Liverwort)
          Length = 434

 Score = 84.2 bits (199), Expect = 2e-15
 Identities = 45/124 (36%), Positives = 60/124 (48%), Gaps = 2/124 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYNTIVTAHAXX 186
           ++STNHKDIGTLY                    EL  PG+ I  G+ Q+YN ++TAHA  
Sbjct: 9   LFSTNHKDIGTLYLIFGAIAGVMGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFL 68

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N  VP+++G+PD+AFPR+NNI F              +VE G G+
Sbjct: 69  MIFFMVMPAMIGGFGNWFVPILIGSPDMAFPRLNNISFWLLPPSLLLLLSSALVEVGCGS 128

Query: 367 G*TV 378
           G TV
Sbjct: 129 GWTV 132


>UniRef50_Q3L2S5 Cluster: Cytochrome c oxidase subunit I; n=1; Aedes
           cretinus|Rep: Cytochrome c oxidase subunit I - Aedes
           cretinus
          Length = 153

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 39/65 (60%), Positives = 45/65 (69%)
 Frame = +1

Query: 247 LILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVD 426
           L+LGAPD+AFPR+NN+ F              +VENGAGTG TVYPPLSS  AH G SVD
Sbjct: 1   LMLGAPDMAFPRMNNMSFWMLPPSLTLLLSSSMVENGAGTGWTVYPPLSSGTAHAGASVD 60

Query: 427 LAIFS 441
           LAI+S
Sbjct: 61  LAIYS 65



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 18/41 (43%), Positives = 20/41 (48%)
 Frame = +3

Query: 531 SITLICMSCRDYSXXXXXXXXXXXWSYYNIINRSKLKYIIF 653
           SIT ICM C +Y             S+Y IIN  K KY IF
Sbjct: 92  SITFICMICCNYCYFITSFFTCFSSSHYYIINWPKSKYFIF 132


>UniRef50_Q8HCX2 Cluster: Cytochrome c oxidase subunit I; n=1;
           Aplidium nordmanni|Rep: Cytochrome c oxidase subunit I -
           Aplidium nordmanni
          Length = 227

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 77/209 (36%), Positives = 89/209 (42%), Gaps = 1/209 (0%)
 Frame = +1

Query: 28  HKDIGTL-YXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXXXX 204
           HKD GTL +                     L   G +IG  QI    VTA A        
Sbjct: 1   HKDXGTLXFXFXXWSAXFXGXXFXLXXRXXLSXXGQVIGXGQIXXVGVTAXALVMIFFFV 60

Query: 205 XXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYP 384
                      L PL +GAP +A PR+ N+ F               +  G G    VYP
Sbjct: 61  MPTLXGGFGXXLXPLXVGAPXMAXPRLXNMSFWLLPPSLXXLCLSVFIGXGVGXXWXVYP 120

Query: 385 PLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGI 564
           P SS +AH   +VDL IF LHLAGISS                   ++    LF      
Sbjct: 121 PXSSGLAHSSGAVDLGIFXLHLAGISSXLGSMNFLVTLGNMKXKGLNYGNFSLFCWXXVX 180

Query: 565 TAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                         AIT+L   R  N SF
Sbjct: 181 XXXXLILSXPVLAAAITMLXXXRXXNXSF 209


>UniRef50_Q18JR5 Cluster: Cytochrome-c-like terminal oxidase,
           subunit I; n=2; Halobacteriaceae|Rep: Cytochrome-c-like
           terminal oxidase, subunit I - Haloquadratum walsbyi
           (strain DSM 16790)
          Length = 634

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 64/219 (29%), Positives = 88/219 (40%), Gaps = 8/219 (3%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           + +HKDIG LY                    EL +PG  +  +  YN+++T+H       
Sbjct: 91  TVDHKDIGLLYGAFGLTAFAVGGLMVVLMRIELADPGMTVISNTFYNSLLTSHGITMLFL 150

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXX--XXXXXXXXXXXIVE-NGAGTG 369
                      N L+PL++GA D+AFPRIN I F                I E   A TG
Sbjct: 151 FATPIIAAFS-NYLIPLLIGADDMAFPRINAIAFWLLPPAALLIWAGFFPIPEVIPAQTG 209

Query: 370 *TVYPPLS-----SNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQ 534
            T+Y PLS      N A+ G  VDL +  LHL+G+S+                   S+  
Sbjct: 210 WTMYTPLSVGEGMGNQANAG--VDLMLLGLHLSGVSATMGSINFIATIFTERGKNVSWAN 267

Query: 535 LPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           L +F   +   +            AI +LL DRN  TSF
Sbjct: 268 LDIFSWTILTQSGLILFAFPLLGSAIMMLLFDRNFGTSF 306


>UniRef50_Q9B6E4 Cluster: COX1-i3 protein; n=2; Yarrowia
           lipolytica|Rep: COX1-i3 protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 457

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 47/132 (35%), Positives = 59/132 (44%), Gaps = 2/132 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           ++STN KDI  LY                    EL N GS  L G+ Q +N ++TAHA  
Sbjct: 11  LFSTNAKDIAVLYFIFALFSAMIGTGLSAIIRLELANTGSPFLHGNTQAFNVVITAHAIL 70

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N L+PL+LGA D+AF R+NNI F              +VE GAGT
Sbjct: 71  MIFFFVMPALVGGFGNYLMPLMLGASDMAFARLNNISFWLLVPSLILILTSALVEAGAGT 130

Query: 367 G*TVYPPLSSNI 402
           G TV    SS +
Sbjct: 131 GWTVKKICSSKM 142


>UniRef50_Q9XKD7 Cluster: Cytochrome c oxidase subunit I; n=1;
           Dicyema misakiense|Rep: Cytochrome c oxidase subunit I -
           Dicyema misakiense
          Length = 473

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 57/213 (26%), Positives = 80/213 (37%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           I S NH D+  LY                    +L  P  L  D  +YN  VT H     
Sbjct: 4   IMSVNHIDVSLLYFSLGIFSALLGMSFSLLFRLQLAFPSILTSD--VYNAFVTLHGLVMV 61

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N L+P     PD+ FPR+N + F              ++ + A  G 
Sbjct: 62  FFAAMPTAIGFFANLLIPYHCNLPDLLFPRMNALSF-----WLMPFSLSLLLFSMASAGW 116

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           T YPPLSS       SV+ ++FSLHLAGI+S                    +  L LF  
Sbjct: 117 TFYPPLSS----LSPSVEFSVFSLHLAGIASLISSCNFLVTMLATRTSL--WYSLSLFCW 170

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           ++ + +             IT++LTD++L T F
Sbjct: 171 SIVLVSLLLVLSLPVLAVGITLILTDKHLGTCF 203


>UniRef50_Q36097 Cluster: Cytochrome c oxidase subunit 1; n=3;
           Theileria|Rep: Cytochrome c oxidase subunit 1 -
           Theileria parva
          Length = 481

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 54/214 (25%), Positives = 81/214 (37%), Gaps = 3/214 (1%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-SLIGDD--QIYNTIVTAHAXXX 189
           S NHK IG  Y                    EL   G  +I  D  +IYN + T H    
Sbjct: 14  SGNHKIIGISYLWLAYWFGMIGFYMSVLIRTELSMSGLKIITMDTLEIYNLLFTLHGLIM 73

Query: 190 XXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG 369
                         N L P++LG  D+ +PR+N                   +E G+GTG
Sbjct: 74  VFFNIMTGLFGGIGNYLYPVLLGYCDVVYPRVNLYSLLFQPIGFVLVVSSIYLEIGSGTG 133

Query: 370 *TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 549
            T+YPPLS+++++ G  +D  IF L  AGI+S                     D++    
Sbjct: 134 WTLYPPLSTSLSNVG--IDFIIFGLLAAGIASTLSSVNFITTFTSVKTIGFVIDRISPAA 191

Query: 550 *AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            ++ +T+F              ++  DR+ NT F
Sbjct: 192 WSIVLTSFLLLLSLPVVTAVFLMVFLDRHYNTMF 225


>UniRef50_A6XEV4 Cluster: Cytochrome c oxidase subunit 1; n=1;
           Munidopsis verrucosus|Rep: Cytochrome c oxidase subunit
           1 - Munidopsis verrucosus
          Length = 154

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 38/83 (45%), Positives = 47/83 (56%)
 Frame = +1

Query: 385 PLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGI 564
           PL+S+IAH G SVD+AIFSLHLAG+SS                   + D++PLF+ AV I
Sbjct: 72  PLASSIAHAGASVDMAIFSLHLAGVSSILGSVNFMTTVINMRAKGMTLDRVPLFIWAVFI 131

Query: 565 TAFXXXXXXXXXXGAITILLTDR 633
           T            GAIT+LLTDR
Sbjct: 132 TTVLLLLSLPVLAGAITMLLTDR 154



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 18/42 (42%), Positives = 19/42 (45%)
 Frame = +3

Query: 219 WRIWKLXXXXXXXXXXXXXPTNK*YKILTPTPLPYIINFKKN 344
           W IWKL             P NK YKILT  PL Y    K+N
Sbjct: 28  WWIWKLINSANVSGPWYGFPANKQYKILTSAPLTYTPINKRN 69


>UniRef50_Q9YDX6 Cluster: Heme-copper oxidase subunit I+III; n=1;
           Aeropyrum pernix|Rep: Heme-copper oxidase subunit I+III
           - Aeropyrum pernix
          Length = 815

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 54/214 (25%), Positives = 78/214 (36%), Gaps = 1/214 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           I +T+HKDIG LY                    +L  P S       Y   VT H     
Sbjct: 16  ITTTDHKDIGLLYLVTSIAFLLIAGSLALLFRVQLAIPKSNFLTGDAYYEAVTVHGLIML 75

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA-GTG 369
                        N +VPL +GA D+AFPR+N + +                E+GA   G
Sbjct: 76  LWFASPFAFGLA-NYIVPLQIGARDLAFPRLNALSYWLYLLSGLVLLASFFTESGAPNVG 134

Query: 370 *TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 549
            T+Y PL++ I   G  +DLA  ++ L  +S                     + ++P+F 
Sbjct: 135 WTLYAPLTARIYTPGIGLDLAALAIFLFSLSVTLGTINFLVTIAAMRAPGIGWFKMPMFT 194

Query: 550 *AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            ++  T                +LL DRNL T F
Sbjct: 195 WSILFTVILMLWAFPPLMVGGALLLLDRNLGTEF 228


>UniRef50_Q02766 Cluster: Cytochrome c oxidase subunit 1; n=107;
           Alveolata|Rep: Cytochrome c oxidase subunit 1 -
           Plasmodium falciparum
          Length = 476

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 52/217 (23%), Positives = 85/217 (39%), Gaps = 4/217 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG-SLIGDDQI--YNTIVTAHAX 183
           I + NHK +G  Y                    EL +    +I  + +  YN I T H  
Sbjct: 9   ITNCNHKTLGLYYLWFSFLFGSYGFLLSVILRTELYSSSLRIIAQENVNLYNMIFTIHGI 68

Query: 184 XXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAG 363
                           N  +P++ G+P++A+PRIN+I                  E G G
Sbjct: 69  IMIFFNIMPGLFGGFGNYFLPILCGSPELAYPRINSISLLLQPIAFVLVILSTAAEFGGG 128

Query: 364 TG*TVYPPLSSNIAHRGR-SVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
           TG T+YPPLS+++      +VD+ IF L ++G++S                   +   L 
Sbjct: 129 TGWTLYPPLSTSLMSLSPVAVDVIIFGLLVSGVASIMSSLNFITTVMHLRAKGLTLGILS 188

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +   ++ IT+           G + +LL+D + NT F
Sbjct: 189 VSTWSLIITSGMLLLTLPVLTGGVLMLLSDLHFNTLF 225


>UniRef50_Q5K464 Cluster: Putative DNA endonuclease; n=1;
           Kluyveromyces thermotolerans|Rep: Putative DNA
           endonuclease - Kluyveromyces thermotolerans (Yeast)
          Length = 542

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 42/124 (33%), Positives = 56/124 (45%), Gaps = 2/124 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHAXX 186
           +YSTN KDI  LY                    EL  PG+  L G+ Q++N +V  HA  
Sbjct: 6   LYSTNAKDIAILYFIFAIFCGMAGTAMSVIIRLELAAPGNQYLGGNHQLFNVLVVGHAVL 65

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT 366
                          N L+PL++GA D++F R+NNI F              +VE+GAGT
Sbjct: 66  MIFFLVMPALIGGFGNYLLPLMIGASDMSFARLNNISFWLLPPALVCLVTSTLVESGAGT 125

Query: 367 G*TV 378
           G TV
Sbjct: 126 GWTV 129


>UniRef50_A7HEB5 Cluster: Cytochrome-c oxidase; n=2;
           Cystobacterineae|Rep: Cytochrome-c oxidase -
           Anaeromyxobacter sp. Fw109-5
          Length = 596

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 44/167 (26%), Positives = 64/167 (38%), Gaps = 1/167 (0%)
 Frame = +1

Query: 154 YNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXX 333
           Y  I T H                  N L+PL++GA D+AFPR+N   F           
Sbjct: 86  YQQIFTTHGLVMIFFAVTPVLIGTFGNLLIPLMIGARDMAFPRLNMYSFWTFLLSQLLVL 145

Query: 334 XXXIVENG-AGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXX 510
                  G AG G T Y PLS+N+   G    L + ++ + G+SS               
Sbjct: 146 ASFFAPLGSAGAGWTTYTPLSTNVGMPGMGQTLVVAAIFVTGVSSTMGAVNYITTVIRLR 205

Query: 511 XXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
               ++ +LPL +  + +TA            A  +LL DR+  T F
Sbjct: 206 APGMTYMRLPLTIWGLWLTAILNALFVPVLGSAALLLLLDRSFGTEF 252


>UniRef50_Q34463 Cluster: Cytochrome oxidase subunit I; n=3; Euglena
           gracilis|Rep: Cytochrome oxidase subunit I - Euglena
           gracilis
          Length = 495

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 52/216 (24%), Positives = 86/216 (39%), Gaps = 6/216 (2%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI----GDDQIYNTIVTAHAXX 186
           +T+HK IG LY                    EL   G  I     +  IYN  +T H   
Sbjct: 15  TTSHKIIGILYGYMGYIAGILGYIISMLIRMELNTQGLAIVRKVKEVTIYNNWITIHGLI 74

Query: 187 XXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF-XXXXXXXXXXXXXXIVENGAG 363
                          N L+P+++G  +++ PR+N I F               ++     
Sbjct: 75  MLFVFIMPVGIGFYGNYLIPMLIGTSELSMPRMNGISFWMLIVGVVIFVISNVLMSKPIS 134

Query: 364 TG*TVYPPLSSNIAHR-GRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
           +G T+YPPLS+  A   G ++DL++  +H+ GISS                   +F  + 
Sbjct: 135 SGWTLYPPLSTRDADNIGVNIDLSLLVVHVLGISSTIGSVNYITTNKYNRHVGLTFMNIN 194

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTS 648
           ++  ++ +T+            AIT LL DRN+N++
Sbjct: 195 IYNFSIIVTSILLIGSLPILGVAITGLLLDRNINST 230


>UniRef50_P34956 Cluster: Quinol oxidase subunit 1 (EC 1.10.3.-)
           (Quinol oxidase polypeptide I) (Quinol oxidase aa3-600,
           subunit qoxB) (Oxidase aa(3)-600 subunit 1); n=45;
           Bacillales|Rep: Quinol oxidase subunit 1 (EC 1.10.3.-)
           (Quinol oxidase polypeptide I) (Quinol oxidase aa3-600,
           subunit qoxB) (Oxidase aa(3)-600 subunit 1) - Bacillus
           subtilis
          Length = 649

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 49/217 (22%), Positives = 74/217 (34%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHA 180
           W + I + +HK +G +Y                   A+L  P +   D   YN I T H 
Sbjct: 44  WSEWITTVDHKKLGIMYIISAVIMLFRGGVDGLMMRAQLALPNNSFLDSNHYNEIFTTHG 103

Query: 181 XXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA 360
                            N +VPL +GA D+AFP +NN+ F              ++    
Sbjct: 104 TIMIIFMAMPFLIGLI-NVVVPLQIGARDVAFPYLNNLSFWTFFVGAMLFNISFVIGGSP 162

Query: 361 GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
             G T Y PL+SN    G   +  +  L +AGI +                   +  ++P
Sbjct: 163 NAGWTSYMPLASNDMSPGPGENYYLLGLQIAGIGTLMTGINFMVTILKMRTKGMTLMRMP 222

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +F     IT             A+ +L  DR     F
Sbjct: 223 MFTWTTLITMVIIVFAFPVLTVALALLSFDRLFGAHF 259


>UniRef50_O67935 Cluster: Cytochrome c oxidase subunit I; n=1;
           Aquifex aeolicus|Rep: Cytochrome c oxidase subunit I -
           Aquifex aeolicus
          Length = 485

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 47/176 (26%), Positives = 68/176 (38%)
 Frame = +1

Query: 124 PGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFX 303
           PG  + D + YN ++T H                  N L+PL++GA D+AFPR+N + + 
Sbjct: 2   PGMQVVDFKTYNYLLTGHGVGMLFWWAIAAHIGGFGNFLLPLMIGAKDVAFPRLNALSWW 61

Query: 304 XXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXX 483
                        I  N   T  T YPP S N  +      L +F +HL G SS      
Sbjct: 62  AFFAANVLFLMTLIPGNHIMTMWTGYPPFSLN--NDAGVTALYVFVMHLLGASSIATAVN 119

Query: 484 XXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                        +F +  LFV  +               GA+T+L  D+ L T+F
Sbjct: 120 FLVTYITMRAPGYTFFKTNLFVHTLIAANVIQLVGVPSLAGAVTMLFLDKYLGTNF 175


>UniRef50_A6C5X9 Cluster: Cytochrome caa3 oxidase; n=3;
           Bacteria|Rep: Cytochrome caa3 oxidase - Planctomyces
           maris DSM 8797
          Length = 754

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 49/213 (23%), Positives = 76/213 (35%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           + + +HK IG +Y                    +L  P +     +++N + T H     
Sbjct: 27  VSTLDHKRIGIMYILTAVFYLAVGGFEALLMRIQLAFPNNTFLSPEMFNQLFTMHGTTMV 86

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N  VPL++GA D+AFPR+N+  F              +  +    G 
Sbjct: 87  FLVGMPVLTGFA-NYFVPLMIGARDVAFPRLNSFGFWMFFFGAALLHFSFLTGSAPNAGW 145

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
             Y PLSS      + VD  I  L + GI S                   S  ++PLFV 
Sbjct: 146 FSYVPLSSKAYSSLQGVDYWIIGLLIMGIGSVSGAINIFATIINLRAPGMSLQRVPLFVW 205

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            + + A            A+ +LL DR L ++F
Sbjct: 206 MMLMQAILIILALPALNSALAMLLIDRWLGSAF 238


>UniRef50_P33518 Cluster: Cytochrome c oxidase polypeptide 1; n=4;
           Halobacteriaceae|Rep: Cytochrome c oxidase polypeptide 1
           - Halobacterium salinarium (Halobacterium halobium)
          Length = 593

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 50/213 (23%), Positives = 78/213 (36%), Gaps = 2/213 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           + +HKDIG LY                    EL      +    +YN ++T+H       
Sbjct: 65  TVDHKDIGILYGVYGTIAFAWGGVSVLLMRTELATSSETLISPSLYNGLLTSHGITMLFL 124

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVEN--GAGTG* 372
                      N  +PL++ A D+AFPRIN I F              ++     A T  
Sbjct: 125 FGTPMIAAFG-NYFIPLLIDADDMAFPRINAIAFWLLPPGAILIWSGFLIPGIATAQTSW 183

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           T+Y PLS  ++    +VD+ +  LHL G+S+                    +  L +F  
Sbjct: 184 TMYTPLSLQMS--SPAVDMMMLGLHLTGVSATMGAINFIATIFTERGEDVGWPDLDIFSW 241

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            +   +            A+ +LL DRN  T+F
Sbjct: 242 TMLTQSGLILFAFPLFGSALIMLLLDRNFGTTF 274


>UniRef50_A7BSH8 Cluster: Cytochrome c oxidase aa3, subunit 1; n=1;
           Beggiatoa sp. PS|Rep: Cytochrome c oxidase aa3, subunit
           1 - Beggiatoa sp. PS
          Length = 525

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 53/215 (24%), Positives = 79/215 (36%), Gaps = 2/215 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDD-QIYNTIVTAHAXXX 189
           I++T+HK +G LY                    EL   G  I DD  +YNT +  H    
Sbjct: 9   IFTTDHKRVGILYLIGSIAAFAVAGIMAMLIRLELSQIGPTITDDPSVYNTWLYFHGAAM 68

Query: 190 XXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG 369
                         N  +PL++GA D+AFPR+N +                 + +     
Sbjct: 69  ILAFQIPALTGFFANYFIPLMIGAKDVAFPRVNALSVWLFYAGVLVALTTFFIPDPPDIM 128

Query: 370 *TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 549
            T YPP S  I H   +     FS+ L G +S                    +++L +FV
Sbjct: 129 WTGYPPYSI-ITHGNTA--FYTFSVLLLGFASILGGVNFLTTVTFMRAPGIGWNKLNIFV 185

Query: 550 *AVGITAFXXXXXXXXXXG-AITILLTDRNLNTSF 651
            A  + AF          G A+T+L  D+ + T F
Sbjct: 186 WAT-LAAFVLQLIFVPVLGTAVTMLTFDKYIGTHF 219


>UniRef50_A7H8L4 Cluster: Cytochrome c oxidase subunit I type; n=38;
           Bacteria|Rep: Cytochrome c oxidase subunit I type -
           Anaeromyxobacter sp. Fw109-5
          Length = 555

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 47/186 (25%), Positives = 70/186 (37%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           + + +HK IG ++                    EL  PG  I D   YN + T H     
Sbjct: 30  LLTQDHKRIGVMFLVATTISFALGGFFALLIRLELLTPGPTIMDAMTYNRMFTLHGVVMI 89

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N L+P+++GA D+AFP++N + F              +V+ GA TG 
Sbjct: 90  FLFMIPAIPSGFGNFLLPIMIGAKDVAFPKLNLLSF-YVYLAGAVVALFGMVQGGADTGW 148

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           T Y P S+    +   V L  F L   G SS                    + +LPLFV 
Sbjct: 149 TFYTPYSTTTITKVVPVLLGAFIL---GFSSILTGLNFIVTTHTMRAPGMGWTRLPLFVW 205

Query: 553 AVGITA 570
           ++  T+
Sbjct: 206 SIYATS 211


>UniRef50_A5UVJ0 Cluster: Cytochrome-c oxidase; n=2;
           Roseiflexus|Rep: Cytochrome-c oxidase - Roseiflexus sp.
           RS-1
          Length = 641

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 50/217 (23%), Positives = 74/217 (34%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHA 180
           W   + +T+HK IG +Y                    +LG P +      +YN + T H 
Sbjct: 22  WAGWLSTTDHKRIGIMYLVSAFVFFLIGGIEALLMRIQLGVPDNTFLTPDVYNQMFTMHG 81

Query: 181 XXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA 360
                            N +VPL++GA D+AFPR+N +                 V    
Sbjct: 82  TTMIFLGLMPLNVGLG-NYMVPLMIGARDMAFPRLNALSIWLFIFGGLMLYVSFFVGGAP 140

Query: 361 GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
             G   Y PL+         VD  I  + L G++S                   + +++P
Sbjct: 141 NVGWFAYAPLTQKQFAPTAGVDYWIVGIGLTGVASIAGALNFIVTILNMRAPGMTLNRMP 200

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           LFV    + AF           A   LL DR+  T F
Sbjct: 201 LFVWMQLVVAFILIFAFPVLTVATIQLLFDRHFGTRF 237


>UniRef50_Q1CZF1 Cluster: Cytochrome c oxidase, subunit I; n=1;
           Myxococcus xanthus DK 1622|Rep: Cytochrome c oxidase,
           subunit I - Myxococcus xanthus (strain DK 1622)
          Length = 556

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 51/209 (24%), Positives = 76/209 (36%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           + + +HK IG ++                    EL  PG  I D   YN   T H     
Sbjct: 37  LLTVDHKRIGLMFLFWVLLFFLVGGIFALLIRVELLTPGPTIMDAMTYNRTFTLHGLVMI 96

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N ++PL+LGA D+AFPR+N +                ++  G  TG 
Sbjct: 97  FLFMIPAIPAVFGNFMLPLMLGAKDVAFPRLNLLSL-YIYLAGAVLALWGMLNGGLDTGW 155

Query: 373 TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           T Y P S   AH   +V   +F   + G SS                   ++ ++PLFV 
Sbjct: 156 TFYTPYS---AHTTTTVAPVLFGAFIIGFSSIVTGINFIVTCHTMRAPGITWFKMPLFVW 212

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNL 639
           A+  T+           G + +L+T  NL
Sbjct: 213 AIYATS-CIQVLATPVIGLLLVLVTVENL 240


>UniRef50_Q79VD7 Cluster: Cytochrome c oxidase subunit 1; n=93;
           Actinobacteria (class)|Rep: Cytochrome c oxidase subunit
           1 - Corynebacterium glutamicum (Brevibacterium flavum)
          Length = 584

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 48/208 (23%), Positives = 73/208 (35%), Gaps = 1/208 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           +T+HK +G +Y                   AEL  PG     ++ +N + T H       
Sbjct: 35  TTDHKQLGIMYIIMSFSFFFLGGLMALLIRAELFTPGLQFLSNEQFNQLFTMHGTVMLLL 94

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGT-G*T 375
                      N ++PL +GAPD+AFPR+N   F              +   GA   G T
Sbjct: 95  YGTPIVWGFA-NYVLPLQIGAPDVAFPRLNAFGFWITTVGGVAMLTGFLTPGGAADFGWT 153

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
           +Y PLS  I   G   D+ I  +   GI S                   +  ++P+F   
Sbjct: 154 MYSPLSDAIHSPGLGSDMWIVGVGATGIGSVASAINMLTTILCLRAPGMTMFRMPIFTWN 213

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNL 639
           + + +            A   +L DR L
Sbjct: 214 IFVVSVLALLIFPLLLAAALGVLYDRKL 241


>UniRef50_A1XI88 Cluster: Cytochrome c oxidase subunit I; n=1;
           Myrmarachne sp. G FSC-2006|Rep: Cytochrome c oxidase
           subunit I - Myrmarachne sp. G FSC-2006
          Length = 129

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 28/41 (68%), Positives = 31/41 (75%)
 Frame = +1

Query: 343 IVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 465
           +VE G G G TVYPPL+S + H G SVD AIFSLHLAG SS
Sbjct: 12  MVEMGVGAGWTVYPPLASVVGHGGSSVDFAIFSLHLAGASS 52


>UniRef50_Q9B8X8 Cluster: Cytochrome c oxidase subunit I; n=517;
           Bilateria|Rep: Cytochrome c oxidase subunit I -
           Schistosoma mansoni (Blood fluke)
          Length = 609

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 56/211 (26%), Positives = 75/211 (35%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           S +HK IG LY                     L +P   +    +YN +VT H       
Sbjct: 107 SLDHKRIGLLYFVFGLWGGFIGLGLSLLIRLNLCDPYYNLVSVDVYNYLVTNHGVAMIFF 166

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                      N  +P+ L   D+  PR+N++                    G G G T+
Sbjct: 167 FLMPILIGGFGNYFLPIFLCLDDLLLPRLNSLSLWLMVPSIFYMELSLYY--GCGIGWTL 224

Query: 379 YPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AV 558
           YPPLS      G  VD  +FSLHLAG+SS                   SF+   + V A 
Sbjct: 225 YPPLSI-WEGSGFGVDYLMFSLHLAGVSS----LIGSVNFISTIFSRLSFN-CSIIVWAY 278

Query: 559 GITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
             T+             IT+LL DRN  T+F
Sbjct: 279 LFTSVLLLLSLPVLASGITMLLFDRNFGTAF 309


>UniRef50_P98005 Cluster: Cytochrome c oxidase polypeptide I+III (EC
           1.9.3.1) (Cytochrome c aa(3) subunit 1); n=2; Thermus
           thermophilus|Rep: Cytochrome c oxidase polypeptide I+III
           (EC 1.9.3.1) (Cytochrome c aa(3) subunit 1) - Thermus
           thermophilus (strain HB8 / ATCC 27634 / DSM 579)
          Length = 791

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 46/212 (21%), Positives = 72/212 (33%), Gaps = 1/212 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           + +HK IG +Y                    +L  P +     + YN I+T H       
Sbjct: 21  TVDHKKIGLMYTATAFFAFALAGVFSLLIRTQLAVPNNQFLTGEQYNQILTLHGATMLFF 80

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA-GTG*T 375
                      N +VPL+LGA D+A PR+N   +                  GA   G T
Sbjct: 81  FIIQAGLTGFGNFVVPLMLGARDVALPRVNAFSYWAFLGAIVLALMSYFFPGGAPSVGWT 140

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
            Y P S   A     VD  + ++ L G SS                   S  ++P++V +
Sbjct: 141 FYYPFS---AQSESGVDFYLAAILLLGFSSLLGNANFVATIYNLRAQGMSLWKMPIYVWS 197

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V   +            A  ++L +R +  S+
Sbjct: 198 VFAASVLNLFSLAGLTAATLLVLLERKIGLSW 229


>UniRef50_Q98P35 Cluster: Cytochrome C oxidase subunit I; n=16;
           cellular organisms|Rep: Cytochrome C oxidase subunit I -
           Rhizobium loti (Mesorhizobium loti)
          Length = 623

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 51/212 (24%), Positives = 74/212 (34%), Gaps = 1/212 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS-LIGDDQIYNTIVTAHAXXXXX 195
           + +HK IG  Y                    +L  P +  IG D+ YN I T H      
Sbjct: 26  TVDHKIIGRRYTVTAFVFLALGGVLALLMRLQLAQPEARFIGPDR-YNQIFTMHGSNMMF 84

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                         LVPL++G   IAFPR+N   +               V+ G   G  
Sbjct: 85  LFAVPVMQAMAIY-LVPLMVGTRHIAFPRLNAFSYWMYLAGGLLLWIAFAVDTGPDIGWF 143

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
            Y PLS      G+  D+    +    +S+                   S D++PLFV +
Sbjct: 144 AYVPLSGPQYAAGKRADIWAQMITFTEVSALAIAVEIVVTVFKQRAPGMSLDRIPLFVWS 203

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           + +T+F           A T L+ DR + T F
Sbjct: 204 MLVTSFLVILAMPAIMIASTSLILDRLVGTHF 235


>UniRef50_Q0I8U1 Cluster: Cytochrome c oxidase subunit I; n=16;
           Bacteria|Rep: Cytochrome c oxidase subunit I -
           Synechococcus sp. (strain CC9311)
          Length = 564

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 51/215 (23%), Positives = 76/215 (35%), Gaps = 3/215 (1%)
 Frame = +1

Query: 16  YSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXX 195
           ++T+ K IG  Y                    EL  P + + D  +YN + T H      
Sbjct: 32  FNTDAKVIGIQYIATAMLFLLVGGLLAMIVRGELITPPADLVDPSVYNGLYTMHGTVMLF 91

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENG-AGTG* 372
                       N L+P ++GAPD+AFP++N   F                  G A +G 
Sbjct: 92  LFLFPILNGFN-NLLIPTMIGAPDMAFPKLNAAAFWLVPVFSIVLMGSFFAPGGPASSGW 150

Query: 373 TVYPPLS--SNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLF 546
             YPP+S  + + H      L I ++ L+GISS                    F ++P+F
Sbjct: 151 WSYPPMSLQNPLGHFINGEFLWILAVALSGISSIMGAINFVTTIIRMRAPGMGFFRMPVF 210

Query: 547 V*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           V                  G   +LL D +  TSF
Sbjct: 211 VWTAWAAQTIQLIGLPALTGGAVMLLFDLSFGTSF 245


>UniRef50_A3ZTG1 Cluster: Cytochrome c oxidase subunit I; n=1;
           Blastopirellula marina DSM 3645|Rep: Cytochrome c
           oxidase subunit I - Blastopirellula marina DSM 3645
          Length = 595

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 43/172 (25%), Positives = 67/172 (38%), Gaps = 4/172 (2%)
 Frame = +1

Query: 148 QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXX 327
           + Y  +VT HA                 N L+PL++GA D+AFP +N + +         
Sbjct: 86  EFYTVLVTMHATVMIFLVIIPILAGAFGNFLIPLMIGADDMAFPTLNMLSYWFMWPAFFF 145

Query: 328 XXXXXIVE-NGAGTG*TVYPPLS---SNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXX 495
                  + +GA  G T YPPLS   ++    G +  L +  +   G+SS          
Sbjct: 146 FGGAFFCDGHGAAAGWTSYPPLSDMTTSAPSSGAAQTLWLLGVTTVGVSSMLGSVNYMTT 205

Query: 496 XXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                    +  +LPL + A+ ITA            A  ++L DR + T F
Sbjct: 206 IIQMRAPGMTMFRLPLTIWAMFITALLQAFALPVLTAAGFMMLADRLIGTGF 257


>UniRef50_Q06473 Cluster: Cytochrome c oxidase subunit 1 (EC
           1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Oxidase aa(3) subunit 1);
           n=59; Cyanobacteria|Rep: Cytochrome c oxidase subunit 1
           (EC 1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Oxidase aa(3) subunit 1) -
           Synechocystis sp. (strain PCC 6803)
          Length = 551

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 52/212 (24%), Positives = 70/212 (33%)
 Frame = +1

Query: 16  YSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXX 195
           +  +HK IG  Y                    EL  P       ++YN ++T H      
Sbjct: 23  FCVDHKVIGIQYLVTSFLFFFIGGSFAEAMRTELATPSPDFVQPEMYNQLMTLHGTIMIF 82

Query: 196 XXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*T 375
                       N L+PL++G  D+AFPR+N + F               V      G T
Sbjct: 83  LWIVPAGAAFA-NYLIPLMVGTEDMAFPRLNAVAFWLTPPGGILLISSFFV-GAPQAGWT 140

Query: 376 VYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*A 555
            YPPLS      G   +L I SL L G SS                       +PLF  A
Sbjct: 141 SYPPLSLLSGKWGE--ELWILSLLLVGTSSILGAINFVTTILKMRIKDMDLHSMPLFCWA 198

Query: 556 VGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +  T+            A+ +L  D    TSF
Sbjct: 199 MLATSSLILLSTPVLASALILLSFDLIAGTSF 230


>UniRef50_Q7NQZ0 Cluster: Cytochrome o ubiquinol oxidase, subunit I;
           n=22; Bacteria|Rep: Cytochrome o ubiquinol oxidase,
           subunit I - Chromobacterium violaceum
          Length = 680

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 51/220 (23%), Positives = 76/220 (34%), Gaps = 3/220 (1%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNP-GSLIG--DDQIYNTIVT 171
           W++ + S +HK IG +Y                    +L    G   G    + Y+ I T
Sbjct: 46  WKEWLTSVDHKKIGVMYIIVAMIMLLRGFADALMMRTQLAMATGGAHGVFPPEHYDQIFT 105

Query: 172 AHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVE 351
           AH                  N +VPL +GA D+AFP +N++ F               V 
Sbjct: 106 AHGVIMIIFMAMPFMTGLM-NIVVPLQIGARDVAFPFLNSLSFWLLVSAVILVNLSLGVG 164

Query: 352 NGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFD 531
           N A TG   YPPL+         VD  I++L ++GI +                      
Sbjct: 165 NFARTGWVAYPPLAELGFSPDVGVDYYIWALQISGIGTTLTAINFLVTVIKMRAPGMKLM 224

Query: 532 QLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            +P+F                   GA+ +L  DR L+  F
Sbjct: 225 DMPIFTWTCTWANVLIATSFPILTGALAMLALDRYLDFHF 264


>UniRef50_Q5V018 Cluster: Cytochrome c oxidase subunit I; n=3;
           Halobacteriaceae|Rep: Cytochrome c oxidase subunit I -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 854

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 46/213 (21%), Positives = 73/213 (34%), Gaps = 2/213 (0%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           +TNHKDIG LY                    EL + G+ +     YN  V+ H       
Sbjct: 19  TTNHKDIGVLYLITALFFLVFGGVLALLFRLELISSGADLLGSMGYNQAVSTHGLLMVFW 78

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                      N LVPL +GA D+AFPR+N + +                      G T+
Sbjct: 79  FISPFAFGFA-NYLVPLQIGADDLAFPRLNALSYWLYLFSGILMGVSFFQGTTFAGGWTM 137

Query: 379 YPPLS--SNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV* 552
           Y PL+  + I   G      + +L +   +                        +P+F  
Sbjct: 138 YAPLNTPAYIPGEGLGATSVVLALIMFTAAVTLGSVNFLTTMYRMRAEGLRMRDIPIFSL 197

Query: 553 AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           ++ +T +           A+ IL +D  L T++
Sbjct: 198 SINLTVWMMLFAFAALLAALMILASDHILGTTY 230


>UniRef50_A1ZL77 Cluster: Alternative Cytochrome c oxidase
           polypeptide I (Cytochrome BB3 subunit 1) (Oxidase BB(3)
           subunit 1); n=20; cellular organisms|Rep: Alternative
           Cytochrome c oxidase polypeptide I (Cytochrome BB3
           subunit 1) (Oxidase BB(3) subunit 1) - Microscilla
           marina ATCC 23134
          Length = 635

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 43/174 (24%), Positives = 67/174 (38%), Gaps = 4/174 (2%)
 Frame = +1

Query: 142 DDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXX 321
           + + Y  +VT H                  N L+PL +GA D+A   +N + +       
Sbjct: 98  EPEFYLALVTMHGTIMVFFVLTAGLSGTFSNFLIPLQIGARDMASGFMNMLSYWFFFGSS 157

Query: 322 XXXXXXXIVENGAGTG*-TVYPPLSS---NIAHRGRSVDLAIFSLHLAGISSXXXXXXXX 489
                   +E G  +G   +YPPLS+    ++  G  + + + S+ L  IS         
Sbjct: 158 VIMFASIFLETGPASGSWVIYPPLSALPQAMSGSGAGMTMWLISMALFIISVLLGGINYI 217

Query: 490 XXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                      SF +LPL + A  ITA            A  +L+ DR+L TSF
Sbjct: 218 TTVINLRVKGMSFTRLPLTIWAFFITAIIGLLSFPVLFSAALLLIFDRSLGTSF 271


>UniRef50_A0RZ19 Cluster: Heme/copper-type cytochrome/quinol
           oxidase, subunit 1; n=2; Thermoprotei|Rep:
           Heme/copper-type cytochrome/quinol oxidase, subunit 1 -
           Cenarchaeum symbiosum
          Length = 508

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 50/208 (24%), Positives = 75/208 (36%), Gaps = 1/208 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS-LIGDDQIYNTIVTAHAXXX 189
           ++ST+H D+G LY                   AEL  PG+  I D   +N + T H    
Sbjct: 15  MFSTHHTDVGLLYLISSLGFLFLGGALALLIRAELFFPGTQFIADSMTFNRMFTVHG-TT 73

Query: 190 XXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG 369
                         N  VP+++   D+A+P++N I F                 +   T 
Sbjct: 74  LIFLFILPFASAVGNYFVPIMVRYKDMAYPKLNAIAFWMIPPAGALVWLGFADFSWYAT- 132

Query: 370 *TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 549
               PP S  I+  G + D+ IF L + GISS                   S  Q+PL  
Sbjct: 133 ----PPYSV-ISAPGPAADMWIFGLKILGISSILGSINFIVTILKCKHPDMSLGQVPLLA 187

Query: 550 *AVGITAFXXXXXXXXXXGAITILLTDR 633
            +   ++            A+ +LLTDR
Sbjct: 188 WSYLSSSLIVLVALPTFAAALLMLLTDR 215


>UniRef50_A3SJL2 Cluster: QoxA, Quinol oxidase subunit I; n=2;
           Rhodobacteraceae|Rep: QoxA, Quinol oxidase subunit I -
           Roseovarius nubinhibens ISM
          Length = 818

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 39/190 (20%), Positives = 64/190 (33%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHA 180
           W+    + NH D+G ++                   A+L  P S     + YN + T H 
Sbjct: 20  WKGWFTTVNHTDLGRMFLTVAVFFFVVGGVLAMLIRAQLATPRSAFLGPEHYNQVFTMHG 79

Query: 181 XXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA 360
                              L+P +LG+ D+AFPR+    F              +     
Sbjct: 80  TIMMFLFAIPVFEGFAVY-LLPKLLGSRDLAFPRLTAYGFWCYVFGGSMMIFSLLWGIAP 138

Query: 361 GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
            +G  +YPPLSS +   G + D  +  +    IS+                   S  ++P
Sbjct: 139 DSGWFMYPPLSSTLGAPGINSDFWLIGITFVEISAIAAAVEITVTVLRYRAPGMSLSKMP 198

Query: 541 LFV*AVGITA 570
           +F     +TA
Sbjct: 199 IFAWYALVTA 208


>UniRef50_P24010 Cluster: Cytochrome c oxidase subunit 1 (EC
           1.9.3.1) (Cytochrome c oxidase polypeptide I)
           (Cytochrome aa3 subunit 1) (Caa-3605 subunit 1) (Oxidase
           aa(3) subunit 1); n=13; Bacillaceae|Rep: Cytochrome c
           oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c oxidase
           polypeptide I) (Cytochrome aa3 subunit 1) (Caa-3605
           subunit 1) (Oxidase aa(3) subunit 1) - Bacillus subtilis
          Length = 622

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 40/211 (18%), Positives = 71/211 (33%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           + +HK I  LY                    +L  P +     Q YN ++T H       
Sbjct: 21  TVDHKKIAILYLVAGGFFFLVGGIEAMFIRIQLAKPENAFLSAQAYNEVMTMHGTTMIFL 80

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                      N +VPL +GA D++FP +N + F               +      G T 
Sbjct: 81  AAMPLLFALM-NAVVPLQIGARDVSFPFLNALGFWLFFFGHIFLNLSWFLGGAPDAGWTS 139

Query: 379 YPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AV 558
           Y  LS  +  +G  +D  +  L ++G+ +                   ++ +LPLF    
Sbjct: 140 YASLS--LHSKGHGIDFFVLGLQISGLGTLIAGINFLATIINMRAPGMTYMRLPLFTWTT 197

Query: 559 GITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            + +             + +++ DR   T+F
Sbjct: 198 FVASALILFAFPPLTVGLALMMLDRLFGTNF 228


>UniRef50_A0TRU9 Cluster: Cytochrome-c oxidase; n=30;
           Proteobacteria|Rep: Cytochrome-c oxidase - Burkholderia
           cenocepacia MC0-3
          Length = 1004

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 46/217 (21%), Positives = 71/217 (32%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHA 180
           WR  + + +HK IG  Y                    +L  P + +     Y+++ T H 
Sbjct: 40  WRGWLGTVDHKRIGLRYIVTAFVFLLLGGVEALVMRIQLARPNATVLTPAQYDSLFTMHG 99

Query: 181 XXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA 360
                            N L PL+LG+ D+AFPR+    +               +    
Sbjct: 100 VTMIFLYALPVLSGFA-NYLWPLMLGSRDMAFPRLTAFSYWSFLFAGLFLYASFPLGAVP 158

Query: 361 GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
             G   Y PL+S     G ++D+    + L GIS+                   S D+LP
Sbjct: 159 DGGWFNYVPLTSLDYSAGANIDIYGLGMILLGISTTGGAANFVVTLLRMRAHGMSIDRLP 218

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           + V      +            A  +L  DRN  T F
Sbjct: 219 IIVWGTLTASVSNLVAVPSVSLAFLLLWLDRNAGTHF 255


>UniRef50_Q9WWR2 Cluster: Ubiquinol oxidase subunit 1 (EC 1.10.3.-)
           (Ubiquinol oxidase polypeptide I) (Cytochrome o subunit
           1) (Oxidase BO(3) subunit 1); n=240; Bacteria|Rep:
           Ubiquinol oxidase subunit 1 (EC 1.10.3.-) (Ubiquinol
           oxidase polypeptide I) (Cytochrome o subunit 1) (Oxidase
           BO(3) subunit 1) - Pseudomonas putida
          Length = 672

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 49/219 (22%), Positives = 74/219 (33%), Gaps = 5/219 (2%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAEL-----GNPGSLIGDDQIYNTI 165
           W + + + +HK IG +Y                    +L     G+ G L    + Y+ I
Sbjct: 45  WSEWLTTVDHKKIGVMYIIVAMVMLLRGFADAIMMRTQLAAATGGSEGYL--PPEHYDQI 102

Query: 166 VTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXI 345
            TAH                  N  VPL +GA D+AFP +N++ F               
Sbjct: 103 FTAHGVIMIIFMAMPFFTGLM-NLAVPLQIGARDVAFPFLNSLSFYLLLAGVLLVNISLG 161

Query: 346 VENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXS 525
           V   A TG   YPPL+      G  VD  I++L L+G+ +                    
Sbjct: 162 VGEFAKTGWVAYPPLAGIQYSPGVGVDYYIWALQLSGLGTTLTGVNFLVTVMKMRAPGMK 221

Query: 526 FDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLN 642
              +P+F                    A+ +L  DR L+
Sbjct: 222 LMDMPIFTWTCTWANVLIVASFPILTAALALLTVDRYLD 260


>UniRef50_P98000 Cluster: Alternative cytochrome c oxidase subunit 1
           (EC 1.9.3.1) (Alternative cytochrome c oxidase
           polypeptide I) (Cytochrome BB3 subunit 1) (Oxidase BB(3)
           subunit 1); n=25; Bacteria|Rep: Alternative cytochrome c
           oxidase subunit 1 (EC 1.9.3.1) (Alternative cytochrome c
           oxidase polypeptide I) (Cytochrome BB3 subunit 1)
           (Oxidase BB(3) subunit 1) - Bradyrhizobium japonicum
          Length = 591

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 51/222 (22%), Positives = 76/222 (34%), Gaps = 5/222 (2%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSL-IGDDQIYNTIVTAH 177
           W + ++S + K I   Y                    +LG PG+    D   Y   +T H
Sbjct: 29  WTRYVFSQDAKVIAIQYSLTASAIGLVALVLSWLMRLQLGFPGTFSFIDANQYLQFITMH 88

Query: 178 AXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENG 357
                             N L+PL++GA D+ FP +N + +               V  G
Sbjct: 89  GMIMVIYLLTALFLGGFGNYLIPLMVGARDMVFPYVNMLSYWVYLLAVLVLASAFFVPGG 148

Query: 358 -AGTG*TVYPP--LSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSF 528
             G G T+YPP  + S    +   + L + SL L  I                     + 
Sbjct: 149 PTGAGWTLYPPQAILSGTPGQDWGIVLMLSSLILFIIGFTMGGLNYVVTVLQARTRGMTL 208

Query: 529 DQLPLFV*AV-GITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
            +LPL V  +   T            G++ +LL DR L TSF
Sbjct: 209 MRLPLTVWGIFTATVMALLAFPALFVGSVMLLL-DRLLGTSF 249


>UniRef50_Q9Z605 Cluster: Quinol oxidase subunit I; n=15;
           Proteobacteria|Rep: Quinol oxidase subunit I -
           Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)
          Length = 825

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 35/182 (19%), Positives = 63/182 (34%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHA 180
           WR    + NH D+G ++                   A+L +P S     + Y  + T H 
Sbjct: 20  WRGWFTTVNHTDLGRMFLGASVVFFLIGGILAMLIRAQLASPRSAFVGAETYAQLFTMHG 79

Query: 181 XXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGA 360
                              L+P +LG+ D+A+PR++   F              +     
Sbjct: 80  TIMMFLFAIPMFEGLTIY-LLPKMLGSRDLAYPRLSAYGFWCYVLGGSMLIVALLAGIAP 138

Query: 361 GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
            +G  +YPPL+S +   G + D  +  +    IS+                   S D++P
Sbjct: 139 DSGWFMYPPLASTLGSPGINSDFWLLGITFVEISAIAAAVEIVVTVLRFRAPGMSLDRMP 198

Query: 541 LF 546
           ++
Sbjct: 199 IY 200


>UniRef50_Q8ZXD1 Cluster: Cytochrome C oxidase subunit I /III; n=4;
           cellular organisms|Rep: Cytochrome C oxidase subunit I
           /III - Pyrobaculum aerophilum
          Length = 800

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 49/217 (22%), Positives = 76/217 (35%), Gaps = 6/217 (2%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGN--PGSLIGD---DQIYNTIVTAHAX 183
           +TN   IG LY                     + N  PGS + D   + +Y   ++ H  
Sbjct: 11  TTNAHYIGILYILLSIINFVLAGIAAMYMRLTIANTPPGSPVQDPFNELLYTWFMSLHGL 70

Query: 184 XXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIV-ENGA 360
                           N LVP ++GAPD+ +PRIN + F              +  ++G 
Sbjct: 71  GMLLLFAMQAVAGAA-NILVPKLIGAPDMYWPRINALSFWMQVPATVFMWSSLLFWQHGD 129

Query: 361 GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
             G T+YPPLS+    +   VDL +  + +AG SS                       + 
Sbjct: 130 SIGWTLYPPLST--ISKSIGVDLILLGIIIAGFSSTLTGINFILTITRLRRPDIKMLDMS 187

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           LF  +V   +               +LL +R+L   F
Sbjct: 188 LFAWSVLAASMLMVTALPPLAAGAIMLLLERHLGMHF 224


>UniRef50_Q0AI64 Cluster: Cytochrome-c oxidase; n=3;
           Proteobacteria|Rep: Cytochrome-c oxidase - Nitrosomonas
           eutropha (strain C71)
          Length = 703

 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 49/219 (22%), Positives = 72/219 (32%), Gaps = 2/219 (0%)
 Frame = +1

Query: 1   WRK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAE--LGNPGSLIGDDQIYNTIVTA 174
           W   + ST+HK IG +Y                   A+  +G  G  +  D  +  + + 
Sbjct: 67  WFDWLTSTDHKKIGIMYVVLALVMLTRAIAEAVLMRAQGAVGLGGGFLSSDH-FAQLFST 125

Query: 175 HAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVEN 354
           H                  N +VPL +GA D+AFP +N+I                +V  
Sbjct: 126 HGTIMIFFMAMPFLTGLI-NYVVPLQIGARDVAFPILNSISLWLTAAGAALVMISLVVGA 184

Query: 355 GAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQ 534
            +  G   YPP +  + + G  VD  I+SL LA + S                       
Sbjct: 185 FSTGGWFGYPPYTETLYNPGIGVDYWIWSLTLASLGSTLTGINIAVTIYKKRAPGMKLYY 244

Query: 535 LPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +PLF      TA                L  DR L+  F
Sbjct: 245 MPLFTWTALCTAIMMIFAMPPLTVVTLQLALDRYLDFHF 283


>UniRef50_P11947 Cluster: Cytochrome c oxidase subunit 1; n=48;
           Oligohymenophorea|Rep: Cytochrome c oxidase subunit 1 -
           Tetrahymena pyriformis
          Length = 698

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 2/101 (1%)
 Frame = +1

Query: 4   RK*IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYNTIVTAH 177
           +K +Y+ NHK I   Y                    EL +P S    GD   Y  +VTAH
Sbjct: 52  KKYVYTINHKRIAINYLYFSMVTGLSGAALATMIRMELAHPESPFFKGDSLRYLQVVTAH 111

Query: 178 AXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRF 300
                             N L+P  +G+ D+A+PR+N+I F
Sbjct: 112 GLIMVFFVVVPILFGGFANFLIPYHVGSKDVAYPRLNSIGF 152


>UniRef50_Q6KZG3 Cluster: Cytochrome c oxidase polypeptide I/III;
           n=2; Thermoplasmatales|Rep: Cytochrome c oxidase
           polypeptide I/III - Picrophilus torridus
          Length = 841

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 53/224 (23%), Positives = 74/224 (33%), Gaps = 11/224 (4%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPG------SLIG----DDQIYNT 162
           I++TNHK IG LY                    +L  P       S+      D   YN 
Sbjct: 27  IFTTNHKQIGLLYILTSLFFFIGGGVMALLMRVQLAIPRYDLVKYSIFSGRFLDALQYNQ 86

Query: 163 IVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXX 342
           +VT H                    L+PL +G+ D+ +PR+N + +              
Sbjct: 87  LVTIHGLTMLIWFLGPLGTGFGIY-LIPLAIGSRDMIYPRMNALGYWLFLFSGIMLWSGF 145

Query: 343 IVENG-AGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXX 519
            +  G   TG TVY PLSS         D A  ++ L GI +                  
Sbjct: 146 FLPGGNLDTGWTVYEPLSSFKFTPYLGADTAAAAVVLRGIGTIIASTEILATIFKARAKG 205

Query: 520 XSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                LPLFV AV   A           G   +LL    ++ S+
Sbjct: 206 YRMMNLPLFVWAVFWVAAISWFVFPEITGLFFLLLVGNLMHASY 249


>UniRef50_Q67ML1 Cluster: Cytochrome C oxidase subunit I; n=17;
           Bacteria|Rep: Cytochrome C oxidase subunit I -
           Symbiobacterium thermophilum
          Length = 628

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 43/217 (19%), Positives = 72/217 (33%), Gaps = 4/217 (1%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           + + +HK IG +Y                    +L  PG  +   + +N + T HA    
Sbjct: 24  VATVDHKRIGIMYGVTGFFFFLVGGLEAWIMRLQLARPGLEVVTARTFNALFTMHATTMI 83

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAG--- 363
                        N  +PL++GA D+AFPR+N   +              ++    G   
Sbjct: 84  FLGVMPLLSAFM-NYFLPLMIGARDVAFPRLNAFSYWIYLFGALFINAGWLMGTAGGHVP 142

Query: 364 -TG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLP 540
             G   Y  L+S     G   D     L L GI +                   +  ++P
Sbjct: 143 DIGWFGYANLTSVQFTSGLGPDFWTLGLLLLGIGTLVSGFNFIVTILNMRAPGMTLMKMP 202

Query: 541 LFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
           +FV    +T+            A+ +L+ DR    +F
Sbjct: 203 VFVWTTLVTSAIIIFAFPSVTVALIMLMFDRTFAANF 239


>UniRef50_Q05FH1 Cluster: Cytochrome O ubiquinol oxidase subunit I;
           n=1; Candidatus Carsonella ruddii PV|Rep: Cytochrome O
           ubiquinol oxidase subunit I - Carsonella ruddii (strain
           PV)
          Length = 606

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/106 (24%), Positives = 44/106 (41%)
 Frame = +1

Query: 232 N*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHR 411
           N ++PL +G+ D+AFP +N + F              I+   A TG   YPPLS      
Sbjct: 119 NIIIPLQIGSKDVAFPSLNLLSFWLTFFSVLLINISLIIGEFAKTGWLGYPPLSEKTFSP 178

Query: 412 GRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 549
              VD   +S+ ++GI +                    F+++ +F+
Sbjct: 179 WVGVDYWNWSIQISGIGTIISSINFITTILKLRKKKLFFNKISIFM 224


>UniRef50_Q9RR77 Cluster: Cytochrome c oxidase, subunit I; n=2;
           Deinococcus|Rep: Cytochrome c oxidase, subunit I -
           Deinococcus radiodurans
          Length = 820

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 34/146 (23%), Positives = 47/146 (32%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           +T+HK IG LY                    +L  P   +     YN ++T HA      
Sbjct: 29  TTDHKKIGLLYIIVSILGFCLGGLLALAIRVQLALPEQTLLVGTTYNQVLTMHAAIMLFF 88

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                      N  +PL LG  D+A PR+N                          G T 
Sbjct: 89  FLIPLGLFGFGNYFLPLQLGVRDVALPRLNTFAVWLFIASLILVVLGLFNGGAPSVGWTF 148

Query: 379 YPPLSSNIAHRGRSVDLAIFSLHLAG 456
           Y PL+ +    G SV +    L+  G
Sbjct: 149 YYPLTMDGNQTGVSVFMVAVILNGLG 174


>UniRef50_A0VUI8 Cluster: Cytochrome-c oxidase; n=1; Dinoroseobacter
           shibae DFL 12|Rep: Cytochrome-c oxidase -
           Dinoroseobacter shibae DFL 12
          Length = 853

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 34/185 (18%), Positives = 62/185 (33%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           + +H+ +G  +                    +L  P +     + YN + T H       
Sbjct: 52  AVSHRAVGKRFLITGFIFFLIAGVFALLVRLQLMVPENTFLSSETYNQLFTMHGTIMMFL 111

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                        L+PL++GA D+ FPR+    +              + +     G  +
Sbjct: 112 FAIPMLEGFAVY-LIPLMIGARDLVFPRLGAFGYYCYLFGGIIVLSSFLFDAAPDGGWFM 170

Query: 379 YPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AV 558
           Y PLS++    G S D  +  + LA I+S                   S  ++P+ +  +
Sbjct: 171 YVPLSTSAYTEGLSADFWLIGITLAEIASVTAAVEIIAAILCSRAPGMSLTKMPILMWYL 230

Query: 559 GITAF 573
             TAF
Sbjct: 231 LATAF 235


>UniRef50_Q94WV3 Cluster: Cytochrome oxidase subunit I; n=1;
           Pachymerium ferrugineum|Rep: Cytochrome oxidase subunit
           I - Pachymerium ferrugineum
          Length = 219

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 37/140 (26%), Positives = 45/140 (32%)
 Frame = +3

Query: 225 IWKLXXXXXXXXXXXXXPTNK*YKILTPTPLPYIINFKKNCRKWCRNRMNSLPPTFI*YR 404
           I KL             P NK +KIL  TPL Y  N    C K C + +NSLP     Y 
Sbjct: 62  IRKLNTPSNIGSTSHGFPPNKQFKILIITPLTYTTNSIYGCSKRCSHSVNSLPAPCCKYL 121

Query: 405 T*RKIRRSCYFFTTFSXXXXXXXXXXXXXXXXXXTIX*YII*SITLICMSCRDYSXXXXX 584
           T    R   +F  T                            +   +CM   +YS     
Sbjct: 122 TLGPFRSYNHFCPTSCSSVFNSSLNQLYYNNHQYARYSNNPWTNPSVCMKSNNYSCTSTS 181

Query: 585 XXXXXXWSYYNIINRSKLKY 644
                  S+YNI    K KY
Sbjct: 182 FSPSIGSSHYNITYWPKPKY 201


>UniRef50_Q7YI87 Cluster: Cytochrome oxidase subunit I; n=1;
           Celatoblatta vulgaris|Rep: Cytochrome oxidase subunit I
           - Celatoblatta vulgaris
          Length = 134

 Score = 41.1 bits (92), Expect = 0.023
 Identities = 18/35 (51%), Positives = 20/35 (57%)
 Frame = +3

Query: 549 MSCRDYSXXXXXXXXXXXWSYYNIINRSKLKYIIF 653
           M C +YS           WSYYN IN SKLKYI+F
Sbjct: 84  MICSNYSFTIIIVSTCSCWSYYNTINWSKLKYILF 118


>UniRef50_A6C0L1 Cluster: Cytochrome c oxidase subunit I; n=1;
           Planctomyces maris DSM 8797|Rep: Cytochrome c oxidase
           subunit I - Planctomyces maris DSM 8797
          Length = 606

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 35/171 (20%), Positives = 56/171 (32%), Gaps = 3/171 (1%)
 Frame = +1

Query: 148 QIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXX 327
           + Y  + T HA                 N L+PL++GA D+AFP++N + +         
Sbjct: 90  EFYTMLFTMHATVMIFLVIIPILAGMFGNFLIPLMIGADDMAFPKLNMLSYWFMWPAIAC 149

Query: 328 XXXXXIVENGAGTG*TVYP---PLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXX 498
                    G   G T YP    L+      G +    +  +   G SS           
Sbjct: 150 FGMSFKYAGGPAAGWTSYPVLADLAQAAPGSGTAQTYWLLGVTFVGFSSMMGSINYMTTI 209

Query: 499 XXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                   +F +LP+ +  + ITA               + + DR   T F
Sbjct: 210 INMRAPGMTFFRLPMTIWGLFITAILQAFALPVLTAGGFMQVADRLFGTCF 260


>UniRef50_Q1H1C1 Cluster: Cytochrome-c oxidase; n=1; Methylobacillus
           flagellatus KT|Rep: Cytochrome-c oxidase -
           Methylobacillus flagellatus (strain KT / ATCC 51484 /
           DSM 6875)
          Length = 631

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 36/180 (20%), Positives = 60/180 (33%)
 Frame = +1

Query: 112 ELGNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINN 291
           +L  P +   D + YN + + H                    ++PL+LG  D+ FPR+N 
Sbjct: 64  QLAVPENDFMDPETYNQVFSMHGITMMFLFAIPVMEGFAVY-IIPLMLGTRDMTFPRLNA 122

Query: 292 IRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXX 471
             +              ++      G   YPPL+      G  +D     +    IS+  
Sbjct: 123 FGYYIYLIAGVMMYAALLLRIAPDAGWFSYPPLAGASFSPGLGLDFYTTVVTFMEISALV 182

Query: 472 XXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLNTSF 651
                            S +++P+FV AV + +F           A  +L  DR     F
Sbjct: 183 AAIELIATIFKCKVPGMSLNRMPIFVWAVLVMSFMIVFALPPLVIASLMLALDRMAGMHF 242


>UniRef50_Q9B6E2 Cluster: Cytochrome c oxidase subunit I; n=2;
           Yarrowia lipolytica|Rep: Cytochrome c oxidase subunit I
           - Yarrowia lipolytica (Candida lipolytica)
          Length = 399

 Score = 39.5 bits (88), Expect = 0.069
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 2/58 (3%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHA 180
           ++STN KDI  LY                    EL N GS  L G+ Q +N ++TAHA
Sbjct: 11  LFSTNAKDIAVLYFIFALFSAMIGTGLSAIIRLELANTGSPFLHGNTQAFNVVITAHA 68


>UniRef50_Q1IUK7 Cluster: Cytochrome-c oxidase; n=2;
           Acidobacteria|Rep: Cytochrome-c oxidase - Acidobacteria
           bacterium (strain Ellin345)
          Length = 595

 Score = 39.1 bits (87), Expect = 0.091
 Identities = 40/183 (21%), Positives = 66/183 (36%), Gaps = 5/183 (2%)
 Frame = +1

Query: 118 GNPGSLIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIR 297
           G PG ++   + Y +++T H                  N  +P+ +GA D+AFPR N + 
Sbjct: 75  GAPGDVM-TPEYYLSLLTMHGTLMVFFVLTNAPFAAFGNYFLPIQIGAEDMAFPRFNMMS 133

Query: 298 FXXXXXXXXXXXXXXIVENGAG-TG*TVYPPLSS--NIAHRGRSVDLAIFSLHLA--GIS 462
           F               + +G   +G T Y  LS+    A  G +    ++ + +A   I+
Sbjct: 134 FWTTFAAFCVLIAAFFIPDGPPISGWTAYATLSAVGGDAGPGMAYGQTLWGISIAIFCIA 193

Query: 463 SXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXXGAITILLTDRNLN 642
           S                   S  ++P+   A  IT+            A  +L  DR   
Sbjct: 194 SLLGSLNFIATTLDLRTKGMSLMRMPICTWAWFITSCIALLAFAVLLPACILLCLDRVAG 253

Query: 643 TSF 651
           TSF
Sbjct: 254 TSF 256


>UniRef50_P03876 Cluster: Putative COX1/OXI3 intron 2 protein; n=2;
           Saccharomycetaceae|Rep: Putative COX1/OXI3 intron 2
           protein - Saccharomyces cerevisiae (Baker's yeast)
          Length = 854

 Score = 39.1 bits (87), Expect = 0.091
 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIVTAHA 180
           +YSTN KDI  LY                    EL  PGS  L G+ Q++N +V  HA
Sbjct: 6   LYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHA 63


>UniRef50_Q35062 Cluster: CoxI intron2 ORF; n=2; Marchantia
           polymorpha|Rep: CoxI intron2 ORF - Marchantia polymorpha
           (Liverwort)
          Length = 802

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYN 159
           ++STNHKDIGTLY                    EL  PG+ I  G+ Q+YN
Sbjct: 9   LFSTNHKDIGTLYLIFGAIAGVMGTCFSVLIRMELAQPGNQILGGNHQLYN 59


>UniRef50_Q2N1P8 Cluster: Cytochrome c oxidase subunit I; n=2;
           Eutetramorium sp. BLF m1|Rep: Cytochrome c oxidase
           subunit I - Eutetramorium sp. BLF m1
          Length = 201

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 26/78 (33%), Positives = 34/78 (43%)
 Frame = +1

Query: 412 GRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXX 591
           G    L IFSL +   S                    + D++ L   ++ ITA       
Sbjct: 124 GSXXXLXIFSLXIXXXSXIFSAXNFISXIINMRHTMLTMDKISLLSWSILITAVLLLLSL 183

Query: 592 XXXXGAITILLTDRNLNT 645
               GAIT+LLTDRN+NT
Sbjct: 184 PVLAGAITMLLTDRNMNT 201


>UniRef50_Q11EK8 Cluster: Cytochrome c oxidase, subunit I; n=5;
           Proteobacteria|Rep: Cytochrome c oxidase, subunit I -
           Mesorhizobium sp. (strain BNC1)
          Length = 845

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 39/187 (20%), Positives = 60/187 (32%), Gaps = 1/187 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNP-GSLIGDDQIYNTIVTAHAXXX 189
           I + N++ IG LY                    +L  P   L+G D  YN I T H    
Sbjct: 34  ISAVNNQVIGILYVGAAFLFFILAGILGLIMRTQLAVPENDLVGQD-FYNQIFTVHGTTM 92

Query: 190 XXXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG 369
                           L+P +L A D+ FPR++                    +     G
Sbjct: 93  MFLFAVPVVEALGVM-LLPQMLAARDLPFPRLSAFAIWAYIVGGLVFFSTVFYDLAPKGG 151

Query: 370 *TVYPPLSSNIAHRGRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV 549
             +YPPL+      G + D  +  +    IS+                   S  ++P+F 
Sbjct: 152 WFMYPPLTLKEYSPGDNADFWLLGIGFIEISAIAGAIEIIVGTLRTRPPGMSLTRMPIFA 211

Query: 550 *AVGITA 570
            A+ I A
Sbjct: 212 WAMLIFA 218


>UniRef50_Q0R4Y4 Cluster: Maturase-like protein; n=2; Eukaryota|Rep:
           Maturase-like protein - Pellia epiphylla
          Length = 843

 Score = 35.9 bits (79), Expect = 0.85
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLI--GDDQIYN 159
           ++STNHKDIGT Y                    EL  PG+ I  G+ Q+YN
Sbjct: 9   LFSTNHKDIGTPYLIFGAIAGVMGTCFSVLIRMELAQPGNQILGGNHQLYN 59


>UniRef50_Q2ABI9 Cluster: NADH-ubiquinone oxidoreductase chain 2;
           n=21; Neocoleoidea|Rep: NADH-ubiquinone oxidoreductase
           chain 2 - Sepia officinalis (Common cuttlefish)
          Length = 375

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +3

Query: 9   MNLFYKS*RYWNIIFYFWYLIRNNWNIFKTFNS 107
           M +  KS  YWNI+F+FWYLI    ++ K  NS
Sbjct: 339 MIILNKSQSYWNIMFHFWYLISFISHLAKINNS 371


>UniRef50_P03877 Cluster: Intron-encoded DNA endonuclease aI3
           precursor (DNA endonuclease I- SceIII) [Contains:
           Truncated non-functional cytochrome oxidase 1; DNA
           endonuclease aI3 (EC 3.1.-.-) (Intron-encoded
           endonuclease I-SceIII)]; n=5; Saccharomycetales|Rep:
           Intron-encoded DNA endonuclease aI3 precursor (DNA
           endonuclease I- SceIII) [Contains: Truncated
           non-functional cytochrome oxidase 1; DNA endonuclease
           aI3 (EC 3.1.-.-) (Intron-encoded endonuclease I-SceIII)]
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 403

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 2/54 (3%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGS--LIGDDQIYNTIV 168
           +YSTN KDI  LY                    EL  PGS  L G+ Q++N +V
Sbjct: 6   LYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLV 59


>UniRef50_P39481 Cluster: Quinol oxidase subunit 1/3; n=5;
           Sulfolobaceae|Rep: Quinol oxidase subunit 1/3 -
           Sulfolobus acidocaldarius
          Length = 788

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 36/152 (23%), Positives = 56/152 (36%), Gaps = 1/152 (0%)
 Frame = +1

Query: 13  IYSTNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXX 192
           +Y+TN  D+G +Y                    +L    +L   D  Y   VT H     
Sbjct: 11  LYTTNASDVGQMYIVLGIVALIIGSVNAALIRDQLSF-NNLNAVD--YYDAVTLHGIFMI 67

Query: 193 XXXXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG* 372
                        N LVP ++GA D+ +P+IN + F              ++      G 
Sbjct: 68  FFVVMPLSTGFA-NYLVPRMIGAHDLYWPKINALSFWMLVPAVILAAISPLL-GAVDLGW 125

Query: 373 TVYPPLS-SNIAHRGRSVDLAIFSLHLAGISS 465
            +Y PLS     + G   +L   +L L+G+SS
Sbjct: 126 YMYAPLSVETTVNYGLGTNLIQIALILSGLSS 157


>UniRef50_A5FXH8 Cluster: Cytochrome-c oxidase; n=1; Acidiphilium
           cryptum JF-5|Rep: Cytochrome-c oxidase - Acidiphilium
           cryptum (strain JF-5)
          Length = 689

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 29/140 (20%), Positives = 49/140 (35%)
 Frame = +1

Query: 232 N*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHR 411
           N +VPL +GA D+AFP +N +                 V + +  G     PL+      
Sbjct: 143 NIIVPLQIGARDMAFPYLNAVGLWLTAVAAALVMLSLFVGDFSHDGWIGLIPLTELPYSP 202

Query: 412 GRSVDLAIFSLHLAGISSXXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXX 591
           G  VD  ++++ +  + +                   ++ +LP  V     T        
Sbjct: 203 GVGVDYWMWAIQIGSVGTTLNAINMIATIVKLRAPGMTWSRLPFVVWTSLTTNIIALTAF 262

Query: 592 XXXXGAITILLTDRNLNTSF 651
                A+ +L  DR L T F
Sbjct: 263 PILGVALAMLGADRYLGTHF 282


>UniRef50_A4WT83 Cluster: Cytochrome c, monohaem; n=3;
           Rhodobacteraceae|Rep: Cytochrome c, monohaem -
           Rhodobacter sphaeroides ATCC 17025
          Length = 878

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 27/149 (18%), Positives = 50/149 (33%)
 Frame = +1

Query: 19  STNHKDIGTLYXXXXXXXXXXXXXXXXXXXAELGNPGSLIGDDQIYNTIVTAHAXXXXXX 198
           + N+ ++G  Y                    +L  PG+       +N   T H       
Sbjct: 54  AVNNSEVGVWYALTALAFMLCAGVLAVLMRVQLAVPGNDFLSADRFNQFFTMHGSAMMFL 113

Query: 199 XXXXXXXXXXXN*LVPLILGAPDIAFPRINNIRFXXXXXXXXXXXXXXIVENGAGTG*TV 378
                        L+P +LGA D+ FPR++   +              + +    +G  +
Sbjct: 114 FAVPMFEAISII-LLPALLGARDLPFPRLSAYGYWCFLIGGVFVMGSILFDAAPKSGWFM 172

Query: 379 YPPLSSNIAHRGRSVDLAIFSLHLAGISS 465
           YPPL++     G   D+ +  L    ++S
Sbjct: 173 YPPLATQ--DEGLGSDIWLLGLSFIEVAS 199


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 467,343,947
Number of Sequences: 1657284
Number of extensions: 7702782
Number of successful extensions: 17261
Number of sequences better than 10.0: 101
Number of HSP's better than 10.0 without gapping: 15854
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17071
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -