SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q71DI3 Cluster: Histone H3.2; n=3155; Eukaryota|Rep: Hi...   104   2e-21
UniRef50_P61830 Cluster: Histone H3; n=877; Eukaryota|Rep: Histo...   103   5e-21
UniRef50_A7TAM8 Cluster: Predicted protein; n=12; Nematostella v...    96   7e-19
UniRef50_UPI0000D9D497 Cluster: PREDICTED: similar to H3 histone...    91   3e-17
UniRef50_Q27490 Cluster: Histone H3.3-like type 1; n=263; Eukary...    85   2e-15
UniRef50_P69110 Cluster: Histone H3.2; n=28; Intramacronucleata|...    81   2e-14
UniRef50_P36012 Cluster: Histone H3-like centromeric protein CSE...    81   3e-14
UniRef50_A3LP50 Cluster: Predicted protein; n=1; Pichia stipitis...    74   3e-12
UniRef50_UPI0000E4A58B Cluster: PREDICTED: similar to histone H3...    74   3e-12
UniRef50_Q7XV46 Cluster: Histone H3; n=2; Embryophyta|Rep: Histo...    74   3e-12
UniRef50_Q59LN9 Cluster: Histone H3-like centromeric protein CSE...    74   3e-12
UniRef50_UPI000155CE53 Cluster: PREDICTED: similar to histone pr...    73   5e-12
UniRef50_Q4CZH3 Cluster: Histone H3, putative; n=6; Trypanosomat...    73   5e-12
UniRef50_Q27880 Cluster: Histone H3; n=1; Trypanosoma cruzi|Rep:...    73   5e-12
UniRef50_Q19649 Cluster: Putative uncharacterized protein F20D6....    73   5e-12
UniRef50_UPI0000D9B3BF Cluster: PREDICTED: similar to H3 histone...    72   1e-11
UniRef50_Q75DE4 Cluster: Histone H3-like centromeric protein CSE...    72   1e-11
UniRef50_Q4QDF8 Cluster: Histone H3 variant, putative; n=7; Tryp...    70   4e-11
UniRef50_Q2U9D1 Cluster: Histones H3 and H4; n=3; Fungi/Metazoa ...    70   4e-11
UniRef50_Q7R2F2 Cluster: Histone H3; n=3; Giardia intestinalis|R...    69   7e-11
UniRef50_Q2Z2F6 Cluster: Histone H3-like 3; n=1; Lilium longiflo...    68   2e-10
UniRef50_A6R6B1 Cluster: Histone H3; n=2; Pezizomycotina|Rep: Hi...    67   3e-10
UniRef50_Q0MXD0 Cluster: Histone H3-like centromeric protein CSE...    65   1e-09
UniRef50_A4RRH7 Cluster: Histone H3; n=1; Ostreococcus lucimarin...    64   2e-09
UniRef50_Q803H4 Cluster: Histone H3-like centromeric protein A; ...    64   2e-09
UniRef50_A2DW69 Cluster: Histone H3.2, putative; n=1; Trichomona...    64   3e-09
UniRef50_Q2Z2G0 Cluster: Histone gcH3; n=2; Lilium longiflorum|R...    63   6e-09
UniRef50_Q9GRH3 Cluster: Histone H3-like protein; n=1; Stylonych...    63   6e-09
UniRef50_P34470 Cluster: Histone H3-like centromeric protein hcp...    63   6e-09
UniRef50_Q17DZ3 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_A2I887 Cluster: Histone H3; n=2; Aedes aegypti|Rep: His...    62   1e-08
UniRef50_P49450 Cluster: Histone H3-like centromeric protein A; ...    62   1e-08
UniRef50_Q7XYY4 Cluster: Histone H3; n=1; Pyrocystis lunula|Rep:...    62   1e-08
UniRef50_A2D8I4 Cluster: Histone H3, embryonic, putative; n=1; T...    62   1e-08
UniRef50_Q61IX5 Cluster: Putative uncharacterized protein CBG100...    60   5e-08
UniRef50_Q98SC6 Cluster: Histone H3; n=36; Eukaryota|Rep: Histon...    60   6e-08
UniRef50_UPI000065E2E1 Cluster: Homolog of Homo sapiens "histone...    58   1e-07
UniRef50_Q4R1I8 Cluster: Centromere specific histone H3 variant;...    57   3e-07
UniRef50_Q3LHK2 Cluster: Histone; n=6; Conocephalum conicum|Rep:...    57   4e-07
UniRef50_UPI0000D9F397 Cluster: PREDICTED: hypothetical protein;...    56   7e-07
UniRef50_Q8LK76 Cluster: Centromeric histone H3-like protein; n=...    56   7e-07
UniRef50_O35216 Cluster: Histone H3-like centromeric protein A; ...    56   7e-07
UniRef50_P49449 Cluster: Histone H3-like centromeric protein A; ...    56   1e-06
UniRef50_Q0DED5 Cluster: Os06g0159700 protein; n=2; Oryza sativa...    55   1e-06
UniRef50_Q4RJ89 Cluster: Chromosome 18 SCAF15038, whole genome s...    55   2e-06
UniRef50_Q8IDZ1 Cluster: Histone h3, putative; n=5; Plasmodium|R...    54   2e-06
UniRef50_UPI0000D57081 Cluster: PREDICTED: similar to CG31613-PA...    54   4e-06
UniRef50_UPI0000DA19D6 Cluster: PREDICTED: similar to airway try...    53   5e-06
UniRef50_Q16W94 Cluster: Centromere protein-A, putative; n=1; Ae...    53   5e-06
UniRef50_UPI0000E49A7E Cluster: PREDICTED: similar to formin bin...    53   7e-06
UniRef50_Q16W92 Cluster: Histone H3, putative; n=1; Aedes aegypt...    52   9e-06
UniRef50_Q9MBF6 Cluster: Histone H3-like 1; n=1; Lilium longiflo...    52   1e-05
UniRef50_Q0DED7 Cluster: Os06g0159500 protein; n=4; Oryza sativa...    52   2e-05
UniRef50_Q2N2K6 Cluster: Centromeric histone protein; n=1; Tetra...    51   2e-05
UniRef50_A4RNU2 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_UPI0000DB6E47 Cluster: PREDICTED: similar to Myd88 CG20...    50   5e-05
UniRef50_UPI00005A53B5 Cluster: PREDICTED: similar to H3 histone...    50   5e-05
UniRef50_Q8RVQ9 Cluster: Histone H3-like centromeric protein HTR...    50   6e-05
UniRef50_Q1DVE3 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_P49450-2 Cluster: Isoform 2 of P49450 ; n=5; Eutheria|R...    48   2e-04
UniRef50_Q96FF4 Cluster: CENPA protein; n=2; Homo sapiens|Rep: C...    48   2e-04
UniRef50_UPI0000F34658 Cluster: UPI0000F34658 related cluster; n...    47   3e-04
UniRef50_Q7R295 Cluster: Histone H3; n=1; Giardia lamblia ATCC 5...    46   8e-04
UniRef50_Q4N693 Cluster: Histone H3; n=2; Theileria|Rep: Histone...    45   0.002
UniRef50_Q3LVW5 Cluster: Histone H3; n=1; Bigelowiella natans|Re...    44   0.002
UniRef50_UPI0000498E51 Cluster: histone H3; n=1; Entamoeba histo...    44   0.003
UniRef50_Q170W9 Cluster: Centromere protein-A, putative; n=1; Ae...    44   0.003
UniRef50_A0DDL5 Cluster: Chromosome undetermined scaffold_466, w...    44   0.003
UniRef50_Q9V6Q2 Cluster: Histone H3-like centromeric protein cid...    44   0.004
UniRef50_A7AQ16 Cluster: Core histone H2A/H2B/H3/H4 family prote...    43   0.006
UniRef50_Q2KHH9 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_Q8T9Z4 Cluster: Centromeric histone Cid; n=1; Drosophil...    42   0.010
UniRef50_Q54F38 Cluster: Histone H3 domain-containing protein; n...    42   0.010
UniRef50_Q8T9Y3 Cluster: Histone H3; n=2; Drosophila pseudoobscu...    41   0.023
UniRef50_Q7QQF2 Cluster: GLP_91_10664_11143; n=1; Giardia lambli...    41   0.023
UniRef50_Q8T9Y7 Cluster: Histone H3; n=5; ananassae subgroup|Rep...    40   0.039
UniRef50_A3B8L7 Cluster: Putative uncharacterized protein; n=3; ...    40   0.052
UniRef50_Q8T9Z1 Cluster: Histone H3; n=8; melanogaster group|Rep...    40   0.069
UniRef50_UPI00004988EF Cluster: histone H3; n=1; Entamoeba histo...    39   0.091
UniRef50_Q5TWZ6 Cluster: ENSANGP00000026831; n=1; Anopheles gamb...    38   0.21 
UniRef50_Q4V252 Cluster: Transposase, N-terminal region; n=1; Ba...    37   0.37 
UniRef50_A0CJ31 Cluster: Chromosome undetermined scaffold_19, wh...    37   0.37 
UniRef50_UPI0000E20DF7 Cluster: PREDICTED: similar to histone H3...    36   0.64 
UniRef50_UPI000023ED7C Cluster: hypothetical protein FG07553.1; ...    36   0.85 
UniRef50_Q22NG1 Cluster: Von Willebrand factor type A domain con...    36   0.85 
UniRef50_P61180 Cluster: 50S ribosomal protein L22; n=40; Bacter...    36   0.85 
UniRef50_A7E525 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_P19375 Cluster: Histone H1, early embryonic; n=9; Deute...    34   3.4  
UniRef50_P20783 Cluster: Neurotrophin-3 precursor; n=96; Gnathos...    33   4.5  
UniRef50_UPI0000DD7E58 Cluster: PREDICTED: hypothetical protein;...    33   6.0  
UniRef50_UPI0000DD7C46 Cluster: PREDICTED: hypothetical protein;...    33   6.0  
UniRef50_A6RJV3 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_P49643 Cluster: DNA primase large subunit; n=33; Eutele...    33   6.0  
UniRef50_O75037 Cluster: Kinesin-like protein KIF21B; n=21; Eute...    33   6.0  
UniRef50_Q9EN29 Cluster: AMV019; n=1; Amsacta moorei entomopoxvi...    33   7.9  
UniRef50_Q5DBK9 Cluster: SJCHGC08043 protein; n=1; Schistosoma j...    33   7.9  

>UniRef50_Q71DI3 Cluster: Histone H3.2; n=3155; Eukaryota|Rep:
           Histone H3.2 - Homo sapiens (Human)
          Length = 136

 Score =  104 bits (250), Expect = 2e-21
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>UniRef50_P61830 Cluster: Histone H3; n=877; Eukaryota|Rep: Histone
           H3 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 136

 Score =  103 bits (246), Expect = 5e-21
 Identities = 51/56 (91%), Positives = 54/56 (96%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIRR+QKSTELLIRKLPFQRLVREIAQDFKTDL FQS+AIGALQE+ EAYL
Sbjct: 46  TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYL 101



 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLA+KAARKSAPSTGGVKKPHRY+PG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG 45



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 30/41 (73%), Positives = 35/41 (85%)
 Frame = +2

Query: 410 QARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           +A L+S  LFEDTNL AIHAKRVTI  KDI+LARR+RGER+
Sbjct: 98  EAYLVS--LFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS 136


>UniRef50_A7TAM8 Cluster: Predicted protein; n=12; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 235

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 92.3 bits (219), Expect = 9e-18
 Identities = 46/51 (90%), Positives = 48/51 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEA 411
           TVALREIRRYQ STELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA
Sbjct: 46  TVALREIRRYQXSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA 96


>UniRef50_UPI0000D9D497 Cluster: PREDICTED: similar to H3 histone,
           family 3B; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to H3 histone, family 3B - Macaca mulatta
          Length = 228

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 46/61 (75%), Positives = 52/61 (85%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           T+AL E+R YQKST+LLIRKLPFQRLVREIAQDFK DL FQS AI ALQEA++AYL  L 
Sbjct: 138 TLALPEMRPYQKSTQLLIRKLPFQRLVREIAQDFKIDLRFQSPAIRALQEANKAYLVGLF 197

Query: 439 R 441
           +
Sbjct: 198 K 198



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 32/41 (78%), Positives = 35/41 (85%)
 Frame = +3

Query: 132 TKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           ++Q+ARKST GK P KQL TKAARKSAPSTG VKKPH YRP
Sbjct: 96  SQQSARKSTSGKVPGKQLDTKAARKSAPSTGRVKKPHCYRP 136



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 29/33 (87%), Positives = 30/33 (90%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           GLF+DTNLC IHAK VTIMPKDIQLARRI GER
Sbjct: 195 GLFKDTNLCVIHAKGVTIMPKDIQLARRIWGER 227


>UniRef50_Q27490 Cluster: Histone H3.3-like type 1; n=263;
           Eukaryota|Rep: Histone H3.3-like type 1 - Caenorhabditis
           elegans
          Length = 126

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/57 (71%), Positives = 49/57 (85%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           AL+EIR+YQKSTELL+RKLPFQRLVRE+AQ+   ++ FQSAAI AL EA+EAYL  L
Sbjct: 46  ALKEIRKYQKSTELLVRKLPFQRLVREVAQEIMPNVRFQSAAIQALHEAAEAYLIGL 102



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 34/44 (77%), Positives = 34/44 (77%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           MARTK TARKS GGKAPRK LATKAARK  P  G VKK  RYRP
Sbjct: 1   MARTKHTARKSFGGKAPRKSLATKAARKVFPVDGQVKK--RYRP 42



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQL 505
           GLFEDTNLCAIHAKRVTIMPKD+Q+
Sbjct: 101 GLFEDTNLCAIHAKRVTIMPKDMQV 125


>UniRef50_P69110 Cluster: Histone H3.2; n=28;
           Intramacronucleata|Rep: Histone H3.2 - Tetrahymena
           americanus
          Length = 41

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/41 (90%), Positives = 40/41 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHR 245
           MARTKQTARKSTG KAPRKQLA+KAARKSAP+TGG+KKPHR
Sbjct: 1   MARTKQTARKSTGAKAPRKQLASKAARKSAPATGGIKKPHR 41


>UniRef50_P36012 Cluster: Histone H3-like centromeric protein CSE4;
           n=4; Saccharomycetales|Rep: Histone H3-like centromeric
           protein CSE4 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 229

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = +1

Query: 190 QKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT- 366
           QKRRE QR+  ++ R         +AL EIR+YQ+ST+LLI K+PF RLV+E+  +F T 
Sbjct: 114 QKRREKQRKQSLK-RVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTK 172

Query: 367 --DLXFQSAAIGALQEASEAYLXWLVRRHQLV 456
             DL +QS AI ALQEASEAYL  L+    L+
Sbjct: 173 DQDLRWQSMAIMALQEASEAYLVGLLEHTNLL 204



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/32 (75%), Positives = 28/32 (87%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GL E TNL A+HAKR+TIM KD+QLARRIRG+
Sbjct: 196 GLLEHTNLLALHAKRITIMKKDMQLARRIRGQ 227


>UniRef50_A3LP50 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 171

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 39/63 (61%), Positives = 50/63 (79%), Gaps = 3/63 (4%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDF---KTDLXFQSAAIGALQEASEAYLX 429
           TVALREIR+YQK+T+LLIRKLPF RLV+E+A+D+      + +QS A+ ALQEA EAYL 
Sbjct: 79  TVALREIRQYQKNTDLLIRKLPFARLVKEVAEDYIGADYGIRWQSNAVLALQEACEAYLV 138

Query: 430 WLV 438
            L+
Sbjct: 139 HLL 141



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 28/30 (93%), Positives = 28/30 (93%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           L EDTNLCAIHAKRVTIM KDIQLARRIRG
Sbjct: 140 LLEDTNLCAIHAKRVTIMQKDIQLARRIRG 169


>UniRef50_UPI0000E4A58B Cluster: PREDICTED: similar to histone H3;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to histone H3 - Strongylocentrotus purpuratus
          Length = 104

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 71  GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 104


>UniRef50_Q7XV46 Cluster: Histone H3; n=2; Embryophyta|Rep: Histone
           H3 - Oryza sativa subsp. japonica (Rice)
          Length = 294

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 261 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 294



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/24 (79%), Positives = 20/24 (83%)
 Frame = +3

Query: 183 LATKAARKSAPSTGGVKKPHRYRP 254
           L   AARKSAP+TGGVKKPHRY P
Sbjct: 209 LIMSAARKSAPTTGGVKKPHRYPP 232



 Score = 35.1 bits (77), Expect = 1.5
 Identities = 38/111 (34%), Positives = 55/111 (49%), Gaps = 6/111 (5%)
 Frame = +1

Query: 121 QWLVLNKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIAL------XTVALREIR 282
           +WLVL+KL  + LE +L  +NL   R   +   L  S + ++I L       +V +    
Sbjct: 156 RWLVLSKLLASQLEERLPGSNL-PPRYVFRHDTLHISIAKVLILLNCAKLTASVLIMSAA 214

Query: 283 RYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           R    T   ++K P +    +      TDL FQS A+ ALQEA+EAYL  L
Sbjct: 215 RKSAPTTGGVKK-PHRYPPWKRCSS--TDLRFQSHAVLALQEAAEAYLVGL 262


>UniRef50_Q59LN9 Cluster: Histone H3-like centromeric protein CSE4;
           n=4; Saccharomycetales|Rep: Histone H3-like centromeric
           protein CSE4 - Candida albicans (Yeast)
          Length = 211

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 42/63 (66%), Positives = 49/63 (77%), Gaps = 3/63 (4%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDF---KTDLXFQSAAIGALQEASEAYLX 429
           T ALREIR+YQKST+LLIRKLPF RLVREI+ DF      L +QS AI ALQEASE++L 
Sbjct: 116 TKALREIRQYQKSTDLLIRKLPFARLVREISLDFVGPSYGLRWQSNAILALQEASESFLI 175

Query: 430 WLV 438
            L+
Sbjct: 176 HLL 178



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           L EDTNLCAIHAKRVTIM KDIQLARRIRG+
Sbjct: 177 LLEDTNLCAIHAKRVTIMQKDIQLARRIRGQ 207


>UniRef50_UPI000155CE53 Cluster: PREDICTED: similar to histone
           protein Hist2h3c1; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to histone protein Hist2h3c1 -
           Ornithorhynchus anatinus
          Length = 254

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 41/55 (74%), Positives = 43/55 (78%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           VALREI RYQK    LI KLPF  LV EIAQDFKTDL FQS+AI ALQE +EAYL
Sbjct: 167 VALREIWRYQKFG--LIHKLPFHGLVSEIAQDFKTDLHFQSSAIMALQEVNEAYL 219



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 32/44 (72%), Positives = 34/44 (77%)
 Frame = +3

Query: 126 ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           A  KQTA K TGGKA  KQLA KAARK+ P+TGG KKPH YRPG
Sbjct: 122 AHDKQTAHKITGGKASHKQLANKAARKNPPATGGEKKPHCYRPG 165



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 30/33 (90%), Positives = 30/33 (90%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           LFEDTN CAIHAKRVTIMPKDIQLA  IRGERA
Sbjct: 222 LFEDTNQCAIHAKRVTIMPKDIQLACHIRGERA 254


>UniRef50_Q4CZH3 Cluster: Histone H3, putative; n=6;
           Trypanosomatidae|Rep: Histone H3, putative - Trypanosoma
           cruzi
          Length = 198

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 37/67 (55%), Positives = 50/67 (74%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIR++Q+ST+LL++K PFQRLVRE++   K  L FQS+AI A QEA+E+Y+  L+
Sbjct: 108 TVALREIRQFQRSTDLLLQKAPFQRLVREVSGAQKEGLRFQSSAILAAQEATESYVVSLL 167

Query: 439 RRHQLVC 459
                 C
Sbjct: 168 ADTNRAC 174



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/33 (63%), Positives = 23/33 (69%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           L  DTN   IH+ RVTI PKDI LA  +RGERA
Sbjct: 166 LLADTNRACIHSGRVTIQPKDIHLALCLRGERA 198


>UniRef50_Q27880 Cluster: Histone H3; n=1; Trypanosoma cruzi|Rep:
           Histone H3 - Trypanosoma cruzi
          Length = 132

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 37/67 (55%), Positives = 50/67 (74%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIR++Q+ST+LL++K PFQRLVRE++   K  L FQS+AI A QEA+E+Y+  L+
Sbjct: 42  TVALREIRQFQRSTDLLLQKAPFQRLVREVSGAQKEGLRFQSSAILAAQEATESYVVSLL 101

Query: 439 RRHQLVC 459
                 C
Sbjct: 102 ADTNRAC 108



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/33 (63%), Positives = 23/33 (69%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           L  DTN   IH+ RVTI PKDI LA  +RGERA
Sbjct: 100 LLADTNRACIHSGRVTIQPKDIHLALCLRGERA 132


>UniRef50_Q19649 Cluster: Putative uncharacterized protein F20D6.9;
           n=1; Caenorhabditis elegans|Rep: Putative
           uncharacterized protein F20D6.9 - Caenorhabditis elegans
          Length = 118

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 39/61 (63%), Positives = 46/61 (75%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIR+ Q+STELLI +  F+RLV+E+AQDF TDL F+  AI ALQ A E YL  L 
Sbjct: 28  TVALREIRKQQQSTELLIPRSRFERLVKELAQDFVTDLIFRKDAIDALQAAVEDYLVELF 87

Query: 439 R 441
           R
Sbjct: 88  R 88



 Score = 39.1 bits (87), Expect = 0.091
 Identities = 19/31 (61%), Positives = 22/31 (70%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           LF   NLCAI  KRVTI   +++ ARRIRGE
Sbjct: 86  LFRLGNLCAIKCKRVTIEADNLKFARRIRGE 116


>UniRef50_UPI0000D9B3BF Cluster: PREDICTED: similar to H3 histone,
           family 3B; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to H3 histone, family 3B - Macaca mulatta
          Length = 187

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 39/73 (53%), Positives = 50/73 (68%)
 Frame = +1

Query: 253 LXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXW 432
           L T+AL +IR+YQKST+LL+RKLPF RLVREIAQ  + DL FQSAAIG  +    A   W
Sbjct: 44  LGTLALCKIRKYQKSTQLLLRKLPFHRLVREIAQAIQPDLSFQSAAIGDFR--GTARPTW 101

Query: 433 LVRRHQLVCYSRQ 471
               +  V ++R+
Sbjct: 102 FKHTNPCVNHARR 114



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 25/45 (55%), Positives = 33/45 (73%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MA +KQT  K++  +APRK LATKAA K   +T G++KPHR+R G
Sbjct: 1   MAHSKQTDGKASAWQAPRKPLATKAAGKRVLATRGIRKPHRHRLG 45



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/32 (59%), Positives = 24/32 (75%)
 Frame = +2

Query: 437 FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           F+ TN C  HA+R T+ P+DIQLARR+ GE A
Sbjct: 102 FKHTNPCVNHARRDTVTPRDIQLARRLLGECA 133


>UniRef50_Q75DE4 Cluster: Histone H3-like centromeric protein CSE4;
           n=5; Fungi/Metazoa group|Rep: Histone H3-like
           centromeric protein CSE4 - Ashbya gossypii (Yeast)
           (Eremothecium gossypii)
          Length = 204

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 38/68 (55%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLXFQSAAIGALQEASEAYLXW 432
           VAL+EIRRYQ+STELLI ++PF RLV+E+   F T    + +QS AI ALQEASEAY+  
Sbjct: 112 VALQEIRRYQRSTELLISRMPFARLVKEVTDQFTTVDQQMRWQSMAILALQEASEAYIVG 171

Query: 433 LVRRHQLV 456
           L+    L+
Sbjct: 172 LLEHTNLL 179



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 24/32 (75%), Positives = 28/32 (87%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GL E TNL A+HAKRVT+M KD+QLARRIRG+
Sbjct: 171 GLLEHTNLLALHAKRVTVMRKDMQLARRIRGQ 202


>UniRef50_Q4QDF8 Cluster: Histone H3 variant, putative; n=7;
           Trypanosomatidae|Rep: Histone H3 variant, putative -
           Leishmania major
          Length = 144

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 32/60 (53%), Positives = 47/60 (78%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALRE+R+YQ+STELLI + PF+RLV+EI   FK  +  + +A+ A+Q+A+E+YL  L+
Sbjct: 54  TVALREVRKYQRSTELLIARTPFRRLVKEIMSTFKDTMHMRHSALEAMQDATESYLVSLL 113



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 22/29 (75%), Positives = 25/29 (86%)
 Frame = +2

Query: 443 DTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           D NLC IHAKRVT+ PKD+QLA R+RGER
Sbjct: 115 DANLCTIHAKRVTLYPKDLQLALRLRGER 143


>UniRef50_Q2U9D1 Cluster: Histones H3 and H4; n=3; Fungi/Metazoa
           group|Rep: Histones H3 and H4 - Aspergillus oryzae
          Length = 175

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 39/64 (60%), Positives = 49/64 (76%), Gaps = 5/64 (7%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIA-----QDFKTDLXFQSAAIGALQEASEAY 423
           TVAL+EIR+YQ+S +LLIRKLPF RLVRE+A      D  ++L +QS AI ALQEA+EA+
Sbjct: 77  TVALKEIRKYQRSYDLLIRKLPFARLVREVALDLLPADVGSELRWQSQAIMALQEAAEAF 136

Query: 424 LXWL 435
           L  L
Sbjct: 137 LVHL 140



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 28/30 (93%), Positives = 29/30 (96%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFEDTNLCA+HAKRVTIM KDIQLARRIRG
Sbjct: 140 LFEDTNLCALHAKRVTIMQKDIQLARRIRG 169


>UniRef50_Q7R2F2 Cluster: Histone H3; n=3; Giardia intestinalis|Rep:
           Histone H3 - Giardia lamblia ATCC 50803
          Length = 189

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 36/66 (54%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQD--FKTDLXFQSAAIGALQEASEAYLXWL 435
           VA++EI++YQKST+LLIRKLPF +LVR+I      K+D+ FQ AA+ ALQE++E Y+  L
Sbjct: 91  VAVKEIKKYQKSTDLLIRKLPFSKLVRDIVTSGLSKSDIRFQGAAVEALQESAENYIISL 150

Query: 436 VRRHQL 453
               QL
Sbjct: 151 FVDTQL 156



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 1/46 (2%)
 Frame = +3

Query: 123 MARTKQTARKSTGG-KAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTK TARK+T   KAPRK +A KAARK+A ST G+KK  R + G
Sbjct: 44  MARTKHTARKTTSATKAPRKTIARKAARKTASSTSGIKKTGRKKQG 89



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/32 (68%), Positives = 25/32 (78%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           LF DT LCA HAKRVTIM  D++LA RI G+R
Sbjct: 150 LFVDTQLCAEHAKRVTIMKPDMELATRI-GKR 180


>UniRef50_Q2Z2F6 Cluster: Histone H3-like 3; n=1; Lilium
           longiflorum|Rep: Histone H3-like 3 - Lilium longiflorum
           (Trumpet lily)
          Length = 155

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 33/45 (73%), Positives = 35/45 (77%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MAR K  AR STGGKAPRKQLA KA RK+AP T GVK P+ YRPG
Sbjct: 1   MARMKLNARMSTGGKAPRKQLAYKAVRKAAPPTIGVKLPNSYRPG 45



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/55 (56%), Positives = 39/55 (70%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           + LREIR+Y+K+    I KLPF RLVR+I Q+ K  L FQS A+ A +E SEAYL
Sbjct: 70  MGLREIRKYKKNARFFISKLPFHRLVRKITQNLKAHLRFQSTAMPAPEEVSEAYL 124



 Score = 40.7 bits (91), Expect = 0.030
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED    AIHAKRVT++PKDIQLAR I G
Sbjct: 127 LFED----AIHAKRVTLVPKDIQLARCIGG 152


>UniRef50_A6R6B1 Cluster: Histone H3; n=2; Pezizomycotina|Rep:
           Histone H3 - Ajellomyces capsulatus NAm1
          Length = 181

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 5/64 (7%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDF-----KTDLXFQSAAIGALQEASEAY 423
           T+AL+EIRRYQKS +LL+ KLPF RLVRE+A D        +L +QS AI ALQEA+EA+
Sbjct: 83  TLALKEIRRYQKSWDLLLLKLPFARLVREVAVDLLPAGVGEELRWQSQAIQALQEAAEAF 142

Query: 424 LXWL 435
           L  L
Sbjct: 143 LVHL 146



 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 29/30 (96%), Positives = 29/30 (96%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFEDTNLCAIHAKRVTIM KDIQLARRIRG
Sbjct: 146 LFEDTNLCAIHAKRVTIMQKDIQLARRIRG 175


>UniRef50_Q0MXD0 Cluster: Histone H3-like centromeric protein CSE4;
           n=1; Saccharomyces servazzii|Rep: Histone H3-like
           centromeric protein CSE4 - Saccharomyces servazzii
           (Yeast)
          Length = 293

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDF---KTDLXFQSAAIGALQEASEAYLXW 432
           +AL EIR+YQ+ST+LLI K+PF RLV+E+  +F      L + S AI ALQEASEAYL  
Sbjct: 201 LALYEIRKYQQSTDLLISKIPFARLVKEVTDNFILENQHLQWHSMAILALQEASEAYLVG 260

Query: 433 LVRRHQLV 456
           L+    L+
Sbjct: 261 LLEHANLL 268



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/32 (68%), Positives = 27/32 (84%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GL E  NL A+HAKR+T+M KD+QLARRIRG+
Sbjct: 260 GLLEHANLLALHAKRITLMKKDVQLARRIRGQ 291


>UniRef50_A4RRH7 Cluster: Histone H3; n=1; Ostreococcus lucimarinus
           CCE9901|Rep: Histone H3 - Ostreococcus lucimarinus
           CCE9901
          Length = 135

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD-LXFQSAAIGALQEASEAYLXWL 435
           T+AL+EIRR+QK+T+LLIRK+PF RLVREI+ +   + L + + ++ ALQEA+E +L  L
Sbjct: 39  TLALKEIRRFQKTTDLLIRKMPFARLVREISNELSPEPLRYTAESLLALQEATEDFLVHL 98



 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 28/30 (93%), Positives = 29/30 (96%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED NLCAIHAKRVTIMPKD+QLARRIRG
Sbjct: 98  LFEDCNLCAIHAKRVTIMPKDLQLARRIRG 127


>UniRef50_Q803H4 Cluster: Histone H3-like centromeric protein A;
           n=15; Fungi/Metazoa group|Rep: Histone H3-like
           centromeric protein A - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 145

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 33/57 (57%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD-LXFQSAAIGALQEASEAYL 426
           T AL EIR+YQKST LL+RK PF RLVRE+ Q F  + + +Q  A+ ALQEA+EA++
Sbjct: 53  TRALMEIRKYQKSTGLLLRKAPFSRLVREVCQMFSREHMMWQGYALMALQEAAEAFM 109



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 25/30 (83%), Positives = 27/30 (90%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LF D NLCAIHAKRVT+ P+DIQLARRIRG
Sbjct: 112 LFSDANLCAIHAKRVTLFPRDIQLARRIRG 141


>UniRef50_A2DW69 Cluster: Histone H3.2, putative; n=1; Trichomonas
           vaginalis G3|Rep: Histone H3.2, putative - Trichomonas
           vaginalis G3
          Length = 154

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 33/53 (62%), Positives = 38/53 (71%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           L+EIR YQ S +LLI +L FQRLVREIA      + FQ  AI ALQEASEA+L
Sbjct: 65  LKEIRTYQNSVDLLIPRLSFQRLVREIAHQNNPTIKFQETAIQALQEASEAFL 117



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/32 (68%), Positives = 27/32 (84%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           G+ ED NLC IHA+RVTIM KD++LA RIRG+
Sbjct: 119 GMMEDGNLCTIHAQRVTIMKKDMKLAERIRGD 150


>UniRef50_Q2Z2G0 Cluster: Histone gcH3; n=2; Lilium longiflorum|Rep:
           Histone gcH3 - Lilium longiflorum (Trumpet lily)
          Length = 84

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKS-APSTGGVKKPHRY 248
           MAR K TAR STGGKAPRKQLA+KA RK+  P T GVK+PH Y
Sbjct: 1   MARMKHTARMSTGGKAPRKQLASKALRKAPPPPTKGVKQPHHY 43


>UniRef50_Q9GRH3 Cluster: Histone H3-like protein; n=1; Stylonychia
           lemnae|Rep: Histone H3-like protein - Stylonychia lemnae
          Length = 180

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLVR 441
           +AL++I++ Q ST+LL++KLPFQRLVREIA+    ++ F    + ALQEA+E +L  L  
Sbjct: 89  LALKQIKKLQSSTDLLVKKLPFQRLVREIARSSNPEIRFSIQGLLALQEAAECFLVGLFE 148

Query: 442 R-HQLVCYSRQ 471
             HQ   ++ +
Sbjct: 149 DCHQCAIHANR 159



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/33 (78%), Positives = 30/33 (90%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           GLFED + CAIHA RVT+MPKD+QLARR+RGER
Sbjct: 145 GLFEDCHQCAIHANRVTVMPKDMQLARRLRGER 177


>UniRef50_P34470 Cluster: Histone H3-like centromeric protein hcp-3;
           n=2; Caenorhabditis elegans|Rep: Histone H3-like
           centromeric protein hcp-3 - Caenorhabditis elegans
          Length = 288

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 3/67 (4%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQ---DFKTDLXFQSAAIGALQEASEAYLXWL 435
           AL EIR+YQK+ +LLI+K PF RLVREI Q    F  D   +S AI ALQEA+EA+L  +
Sbjct: 197 ALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPFGADCRIRSDAISALQEAAEAFLVEM 256

Query: 436 VRRHQLV 456
                L+
Sbjct: 257 FEGSSLI 263



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 16/28 (57%), Positives = 22/28 (78%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRI 517
           +FE ++L + HAKRVT+M  DIQL RR+
Sbjct: 256 MFEGSSLISTHAKRVTLMTTDIQLYRRL 283


>UniRef50_Q17DZ3 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 199

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 31/58 (53%), Positives = 42/58 (72%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           +A+R+IR+ Q +T LLI + PF+RLVREIAQ    +L F+  AI ALQE++E YL  L
Sbjct: 98  LAIRQIRQIQSTTTLLIPRQPFERLVREIAQPMGPELRFRGEAIDALQESAEPYLIHL 155



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIR 520
           LF+D+ L A+H KR+T M +D+QL  RIR
Sbjct: 155 LFQDSILSALHGKRLTTMLRDLQLVMRIR 183


>UniRef50_A2I887 Cluster: Histone H3; n=2; Aedes aegypti|Rep:
           Histone H3 - Aedes aegypti (Yellowfever mosquito)
          Length = 90

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/33 (84%), Positives = 31/33 (93%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           GLF+ TNLCAIHAKRV+I+PKDIQL RRIRGER
Sbjct: 34  GLFKITNLCAIHAKRVSIIPKDIQLTRRIRGER 66


>UniRef50_P49450 Cluster: Histone H3-like centromeric protein A;
           n=9; Theria|Rep: Histone H3-like centromeric protein A -
           Homo sapiens (Human)
          Length = 140

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EIR+ QKST LLIRKLPF RL REI   F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHL 105



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 105 LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 134


>UniRef50_Q7XYY4 Cluster: Histone H3; n=1; Pyrocystis lunula|Rep:
           Histone H3 - Pyrocystis lunula (Dinoflagellate)
          Length = 174

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/54 (59%), Positives = 38/54 (70%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           ALREIR YQ STELL+RK+ FQRLVR I    K    F+  A+ ALQEA+E +L
Sbjct: 67  ALREIREYQASTELLLRKICFQRLVRGICMSLKGAFRFEVQALLALQEAAEMFL 120



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 20/40 (50%), Positives = 28/40 (70%)
 Frame = +2

Query: 413 ARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           A +   G+FED ++CA+H +RVTIM +DIQL+R  R   A
Sbjct: 116 AEMFLVGIFEDASMCALHGRRVTIMRRDIQLSRSFRNGSA 155


>UniRef50_A2D8I4 Cluster: Histone H3, embryonic, putative; n=1;
           Trichomonas vaginalis G3|Rep: Histone H3, embryonic,
           putative - Trichomonas vaginalis G3
          Length = 134

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 36/65 (55%), Positives = 44/65 (67%), Gaps = 1/65 (1%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFKT-DLXFQSAAIGALQEASEAYLXWLVRR 444
           LREI  YQK+T LLIRKLPF RLV+EI Q     +  + + A+ ALQEASEA+L  L+  
Sbjct: 47  LREIHFYQKTTNLLIRKLPFCRLVKEITQSVSIGEFRYTTGAMEALQEASEAFLIKLLED 106

Query: 445 HQLVC 459
            Q VC
Sbjct: 107 GQ-VC 110



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 19/32 (59%), Positives = 28/32 (87%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           L ED  +CAIHA+R+T+M +D+QLA+R+RG+R
Sbjct: 103 LLEDGQVCAIHARRITLMNRDLQLAQRLRGDR 134


>UniRef50_Q61IX5 Cluster: Putative uncharacterized protein CBG10032;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG10032 - Caenorhabditis
           briggsae
          Length = 345

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREI--AQDFKT-DLXFQSAAIGALQEASEAYLXWL 435
           AL EIR+YQKST++LI+K PF RLV EI   Q +K+ D   ++ A+ ALQEA+EA++  +
Sbjct: 253 ALAEIRKYQKSTDMLIQKAPFVRLVHEIIREQTYKSQDYRIRADALMALQEAAEAFMVEM 312

Query: 436 VRRHQLVC 459
                L+C
Sbjct: 313 FEGSVLIC 320



 Score = 37.5 bits (83), Expect = 0.28
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRI 517
           +FE + L   HAKRVT+MP DIQL RR+
Sbjct: 312 MFEGSVLICNHAKRVTLMPTDIQLYRRL 339


>UniRef50_Q98SC6 Cluster: Histone H3; n=36; Eukaryota|Rep: Histone
           H3 - Guillardia theta (Cryptomonas phi)
          Length = 103

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 29/59 (49%), Positives = 43/59 (72%)
 Frame = +1

Query: 265 ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLVR 441
           +L +IR++QKST+LLI +LPF RLV+EI+  +   L +Q  A+ ALQ ASE Y+  L++
Sbjct: 16  SLVDIRKFQKSTDLLIHRLPFARLVKEISLKYHHSLNWQQVAVEALQFASEDYIIGLLQ 74



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 23/32 (71%), Positives = 28/32 (87%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GL +D NL AIHAKRVT+MPKD++LA+ IRGE
Sbjct: 71  GLLQDANLAAIHAKRVTVMPKDLKLAKIIRGE 102


>UniRef50_UPI000065E2E1 Cluster: Homolog of Homo sapiens "histone 2,
           H3c (HIST2H3C), mRNA; n=2; Takifugu rubripes|Rep:
           Homolog of Homo sapiens "histone 2, H3c (HIST2H3C), mRNA
           - Takifugu rubripes
          Length = 156

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = -3

Query: 426 EISLACLLESSDGGRLEXQISFEILSDFSHKTLERQLTDKQLSRLLITTNFTK 268
           +ISLA LL+S DG  LE Q+  E+L D SH+ LE QL D+QL   L+TT+ ++
Sbjct: 55  QISLAGLLQSHDGRALEAQVGLEVLGDLSHQALEGQLADQQLGGFLVTTDLSQ 107



 Score = 41.9 bits (94), Expect = 0.013
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -2

Query: 538 NLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQ 434
           +LS+ +TD+  +L++ RHDG   GV+  QVGV EQ
Sbjct: 18  SLSSLSTDTPGQLDVFRHDGDPLGVDGAQVGVLEQ 52


>UniRef50_Q4R1I8 Cluster: Centromere specific histone H3 variant;
           n=1; Luzula nivea|Rep: Centromere specific histone H3
           variant - Luzula nivea
          Length = 167

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (2%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIA-QDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIR+ QK+T+LL+ K  F RLV+EI  Q  K    +Q+ A+ ALQEASE +L  L
Sbjct: 79  TVALREIRKLQKTTDLLVPKASFARLVKEITFQSSKEVNRWQAEALIALQEASECFLVNL 138

Query: 436 VR-RHQLVCYSRQ 471
           +   + L  ++R+
Sbjct: 139 LESANMLAIHARR 151



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/28 (75%), Positives = 23/28 (82%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRI 517
           L E  N+ AIHA+RVTIM KDIQLARRI
Sbjct: 138 LLESANMLAIHARRVTIMKKDIQLARRI 165


>UniRef50_Q3LHK2 Cluster: Histone; n=6; Conocephalum conicum|Rep:
           Histone - Conocephalum conicum (Liverwort)
          Length = 105

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/53 (47%), Positives = 38/53 (71%)
 Frame = -3

Query: 426 EISLACLLESSDGGRLEXQISFEILSDFSHKTLERQLTDKQLSRLLITTNFTK 268
           ++S + LLES DG RLE Q+   +L + +++TLE +L D+QL   L+TTNFT+
Sbjct: 20  KVSFSGLLESEDGRRLEAQVGLVVLGNLTNETLEGELADEQLGGFLVTTNFTE 72


>UniRef50_UPI0000D9F397 Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 155

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = -3

Query: 435 KPXEISLACLLESSDGGRLEXQISFEILSDFSHKTLERQLTDKQLSRLLITTNFTKGH 262
           K  ++ L CLL+S+D   L  QI F++LS+FSH+ LE +  +++ S LLI ++FTK H
Sbjct: 14  KTNQLGLTCLLQSTDSCTLVPQICFKVLSNFSHQMLEVKFVNQKFSGLLIRSDFTKRH 71


>UniRef50_Q8LK76 Cluster: Centromeric histone H3-like protein; n=1;
           Zea mays|Rep: Centromeric histone H3-like protein - Zea
           mays (Maize)
          Length = 157

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 27/32 (84%), Positives = 27/32 (84%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           LFE  NLCAIHAKRVTIM KDIQLARRI G R
Sbjct: 124 LFEMANLCAIHAKRVTIMQKDIQLARRIGGRR 155



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD---LXFQSAAIGALQEASEAYL 426
           TVALREIR+YQKSTE LI   PF R+VRE+  +F T+     + + A+ ALQEA+E +L
Sbjct: 64  TVALREIRKYQKSTEPLIPFAPFVRVVRELT-NFVTNGKVERYTAEALLALQEAAEFHL 121


>UniRef50_O35216 Cluster: Histone H3-like centromeric protein A;
           n=2; Muroidea|Rep: Histone H3-like centromeric protein A
           - Mus musculus (Mouse)
          Length = 134

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EI+  QKST+LL RK PF  +VREI + F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 42  LKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHL 99



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L ++HA RVT+ PKDIQL RRIRG
Sbjct: 99  LFEDAYLLSLHAGRVTLFPKDIQLTRRIRG 128


>UniRef50_P49449 Cluster: Histone H3-like centromeric protein A;
           n=10; Bos taurus|Rep: Histone H3-like centromeric
           protein A - Bos taurus (Bovine)
          Length = 138

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EIR  QK+T LL+RK PF RL REI   F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 46  LKEIRTLQKTTHLLLRKSPFCRLAREICVQFTRGVDFNWQAQALLALQEAAEAFLVHL 103



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/30 (70%), Positives = 25/30 (83%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L ++HA RVT+ PKD+QLARRIRG
Sbjct: 103 LFEDAYLLSLHAGRVTLFPKDVQLARRIRG 132


>UniRef50_Q0DED5 Cluster: Os06g0159700 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os06g0159700 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 297

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/48 (64%), Positives = 34/48 (70%)
 Frame = -1

Query: 434 SQXR*ASLASWRAPMAADWKXKSVLKS*AISLTRRWKGSLRISNSVDF 291
           S  R AS AS  A  A  WK +SVLKS AIS TRRWKGSLR+S+SV F
Sbjct: 18  SPTRYASAASCSAATAELWKRRSVLKSWAISRTRRWKGSLRMSSSVLF 65



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 19/31 (61%), Positives = 20/31 (64%)
 Frame = -2

Query: 256 PGR*RCGFLTPPVLGADFRAAFVASCLRGAL 164
           PG  RCGF TPPV GAD   A VASC   +L
Sbjct: 77  PGLKRCGFFTPPVAGADLHVALVASCFLESL 107



 Score = 33.9 bits (74), Expect = 3.4
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = -3

Query: 486 MMVTRLA*IAHKLVSSNKPXEISLA 412
           MMVTRLA +AH+LVSSN P   + A
Sbjct: 1   MMVTRLAWMAHRLVSSNSPTRYASA 25


>UniRef50_Q4RJ89 Cluster: Chromosome 18 SCAF15038, whole genome
           shotgun sequence; n=3; Coelomata|Rep: Chromosome 18
           SCAF15038, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 199

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/100 (34%), Positives = 47/100 (47%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGYSGPS*NSSLSEXXX 302
           MARTKQTARKSTGGKAP +    +   +  P  G  ++       + GP+ + +L E   
Sbjct: 1   MARTKQTARKSTGGKAPPEAAGHQGGAQERPGHGRREEASPLPARHGGPAGDPALPEVHG 60

Query: 303 XXXXXXXXXXSCERNRSGFQN*FAFPVCRHRSSPGGKRGL 422
                       E +R+G Q+  A P        GG+RGL
Sbjct: 61  AAHPQAALPAPGEGDRAGLQDGPALPELGCDGPAGGERGL 100


>UniRef50_Q8IDZ1 Cluster: Histone h3, putative; n=5; Plasmodium|Rep:
           Histone h3, putative - Plasmodium falciparum (isolate
           3D7)
          Length = 170

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/38 (68%), Positives = 31/38 (81%)
 Frame = +2

Query: 410 QARLISXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           +A L+S  LFED  LC++HA RVT+MPKDI LARRIRG
Sbjct: 133 EAYLVS--LFEDAYLCSLHANRVTLMPKDIHLARRIRG 168



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 3/58 (5%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDFK---TDLXFQSAAIGALQEASEAYL 426
           +AL+EIR YQ ST+LLI K+PF R+V+EI + F+       +   A+ ALQ ASEAYL
Sbjct: 79  LALKEIRAYQASTQLLIPKIPFVRVVKEITRLFELPDEQFRYTPEALLALQTASEAYL 136


>UniRef50_UPI0000D57081 Cluster: PREDICTED: similar to CG31613-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG31613-PA - Tribolium castaneum
          Length = 125

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/59 (52%), Positives = 37/59 (62%), Gaps = 3/59 (5%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK---TDLXFQSAAIGALQEASEAYLXWL 435
           LR I++ Q STEL I KL F RL+RE+ Q       DL  Q +A+ AL EASEAYL  L
Sbjct: 33  LRMIKKLQMSTELCIPKLSFSRLIRELLQSHSRGTRDLRIQKSALQALHEASEAYLTAL 91



 Score = 37.1 bits (82), Expect = 0.37
 Identities = 18/32 (56%), Positives = 21/32 (65%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           LF D+NL A HA RVTI P D+ L   IR E+
Sbjct: 91  LFADSNLLAAHAHRVTIKPGDMALCMYIRREK 122


>UniRef50_UPI0000DA19D6 Cluster: PREDICTED: similar to airway
           trypsin-like 5; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to airway trypsin-like 5 - Rattus norvegicus
          Length = 214

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 25/50 (50%), Positives = 38/50 (76%)
 Frame = -3

Query: 417 LACLLESSDGGRLEXQISFEILSDFSHKTLERQLTDKQLSRLLITTNFTK 268
           L CLL+S++   LE QI FE LS+FSH+TL+ +L +++LS LL  ++FT+
Sbjct: 17  LTCLLQSTNSCTLEAQICFEDLSNFSHQTLKGELANQKLSGLLTVSDFTE 66


>UniRef50_Q16W94 Cluster: Centromere protein-A, putative; n=1; Aedes
           aegypti|Rep: Centromere protein-A, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 217

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query: 229 SRSHIVIALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK-TDLXFQSAAIGALQ 405
           S S +  +   +AL++I R Q +T+LLI KL F R++RE+  ++   D    +  + ALQ
Sbjct: 115 SESRLYRSRQQIALQDIYRLQSTTQLLIPKLSFSRVIREVLMEYMYRDFRITTECLNALQ 174

Query: 406 EASEAYLXWLVRRHQLVCYSR 468
           EASE YL  +       C  R
Sbjct: 175 EASEMYLVQVFEDSYRCCLHR 195


>UniRef50_UPI0000E49A7E Cluster: PREDICTED: similar to formin
           binding protein 1; n=3; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to formin binding
           protein 1 - Strongylocentrotus purpuratus
          Length = 292

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDI 499
           GLFEDTNLCAIHAKRVTIMPKDI
Sbjct: 269 GLFEDTNLCAIHAKRVTIMPKDI 291



 Score = 39.9 bits (89), Expect = 0.052
 Identities = 20/31 (64%), Positives = 24/31 (77%)
 Frame = +1

Query: 343 EIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           +I Q F T+L FQS+A+ ALQEASEAYL  L
Sbjct: 240 KIPQIFNTELRFQSSAVMALQEASEAYLVGL 270


>UniRef50_Q16W92 Cluster: Histone H3, putative; n=1; Aedes
           aegypti|Rep: Histone H3, putative - Aedes aegypti
           (Yellowfever mosquito)
          Length = 157

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK-TDLXFQSAAIGALQEASEAYLXWL 435
           T  L EIR  Q+ST LLI KLPF R++RE+  ++    L     A+ A+QEA+E YL  L
Sbjct: 69  TKVLNEIRHLQRSTGLLIPKLPFGRVIREVMLEYNGRHLRITYDALMAIQEAAEMYLVML 128

Query: 436 VRRHQLVCYSRQ 471
               Q +   RQ
Sbjct: 129 FEDCQKLALHRQ 140


>UniRef50_Q9MBF6 Cluster: Histone H3-like 1; n=1; Lilium
           longiflorum|Rep: Histone H3-like 1 - Lilium longiflorum
           (Trumpet lily)
          Length = 149

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/76 (42%), Positives = 40/76 (52%)
 Frame = +1

Query: 190 QKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD 369
           Q R++ Q+R     R        TVALREIRR Q+S   LI   PF RLVRE+A +F  D
Sbjct: 35  QGRQQQQQRPPAAPRRPRRFRPGTVALREIRRIQRSNVPLIPHSPFMRLVRELAAEFLDD 94

Query: 370 LXFQSAAIGALQEASE 417
             F +     L+E  E
Sbjct: 95  CRFAAETFIMLKEVVE 110



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +2

Query: 437 FEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           F +  +C+IHAKR+ I  KD +LA+ ++GE
Sbjct: 117 FGNVQICSIHAKRIIITVKDFKLAKLLKGE 146


>UniRef50_Q0DED7 Cluster: Os06g0159500 protein; n=4; Oryza
           sativa|Rep: Os06g0159500 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 172

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = -3

Query: 435 KPXEISLACLLESSDGGRLEXQISFEILSDFSHKTLERQLTDKQLSRLLITTNFTK 268
           +P E+ L  LL+  DGG LE ++  E+L D + + LE +L D+QL  LL+  + T+
Sbjct: 50  QPDEVRLGGLLQRGDGGALEAEVGLEVLGDLADEALEGELADEQLRALLVLADLTE 105



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 25/55 (45%), Positives = 31/55 (56%)
 Frame = -2

Query: 535 LSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQAXRDKPRLPPGELRWRQTGXA 371
           LS    D + +L++L HDG   GV+ TQVGV EQ   D+ RL  G L  R  G A
Sbjct: 17  LSALAADPARELDVLGHDGDALGVDGTQVGVLEQP--DEVRL--GGLLQRGDGGA 67


>UniRef50_Q2N2K6 Cluster: Centromeric histone protein; n=1;
           Tetrahymena thermophila|Rep: Centromeric histone protein
           - Tetrahymena thermophila
          Length = 187

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 21/31 (67%), Positives = 26/31 (83%)
 Frame = +2

Query: 437 FEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           FED N CA+HAKRVT+M KD+ LA RIRG++
Sbjct: 146 FEDANACALHAKRVTLMSKDLALAARIRGQK 176



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 4/83 (4%)
 Frame = +1

Query: 190 QKRRENQRRALVESRSHIVIALXTV--ALREIRRYQKSTELLIRKLPFQRLVREIAQDF- 360
           +K+RE+       +R  ++        AL+++R+Y ++  LLIRKLPFQRL+REI+    
Sbjct: 60  KKKRESSGEKYESARDKVIRRFRPGDNALKQLRQYNQTPSLLIRKLPFQRLIREISTRMT 119

Query: 361 -KTDLXFQSAAIGALQEASEAYL 426
            +  L + S A+  LQ   E Y+
Sbjct: 120 EEDSLRWTSFALVLLQTVVEDYM 142


>UniRef50_A4RNU2 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 85

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/31 (74%), Positives = 28/31 (90%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIA 351
           T+ALREIRRYQ++T L +RKLPF RLVRE+A
Sbjct: 47  TLALREIRRYQQNTGLCMRKLPFARLVREVA 77


>UniRef50_UPI0000DB6E47 Cluster: PREDICTED: similar to Myd88
           CG2078-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to Myd88 CG2078-PA - Apis mellifera
          Length = 379

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 35/80 (43%), Positives = 49/80 (61%), Gaps = 7/80 (8%)
 Frame = +1

Query: 208 QRRALVESRSHIV----IALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF--KTD 369
           QR   V+SR +I     +   T AL+EIR  +K+ +L+I K PF RLVR I  D    +D
Sbjct: 276 QRSPSVKSRPNISANRRVLRTTRALKEIRYLRKTVKLIIPKAPFARLVRYIIIDLFPNSD 335

Query: 370 L-XFQSAAIGALQEASEAYL 426
           +   Q++A+ ALQEA EAY+
Sbjct: 336 VDRIQASALEALQEAVEAYI 355


>UniRef50_UPI00005A53B5 Cluster: PREDICTED: similar to H3 histone,
           family 3B; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to H3 histone, family 3B - Canis familiaris
          Length = 138

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/28 (89%), Positives = 25/28 (89%)
 Frame = +1

Query: 343 EIAQDFKTDLXFQSAAIGALQEASEAYL 426
           EIAQDFKTDL F SAAI ALQEASEAYL
Sbjct: 76  EIAQDFKTDLRFWSAAIDALQEASEAYL 103



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/31 (67%), Positives = 23/31 (74%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           LFE  NLC +H KRVTI+ KDIQL  RI GE
Sbjct: 106 LFEGANLCPLHVKRVTIIQKDIQLESRIHGE 136


>UniRef50_Q8RVQ9 Cluster: Histone H3-like centromeric protein HTR12;
           n=64; Magnoliophyta|Rep: Histone H3-like centromeric
           protein HTR12 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 178

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 21/32 (65%), Positives = 27/32 (84%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GLF D+ LCAIHA+RVT+M KD +LARR+ G+
Sbjct: 143 GLFSDSMLCAIHARRVTLMRKDFELARRLGGK 174



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 28/61 (45%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL--XFQSAAIGALQEASEAYLXW 432
           TVAL+EIR +QK T LLI    F R VR I           + + A+ ALQEA+E YL  
Sbjct: 84  TVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVG 143

Query: 433 L 435
           L
Sbjct: 144 L 144


>UniRef50_Q1DVE3 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 492

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 2/56 (3%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT--DLXFQSAAIGALQEASEA 420
           T A++EIR +Q STEL+    PFQRLVREI        +  +Q  AI +LQEA+EA
Sbjct: 15  TGAIKEIRPFQSSTELIFPAAPFQRLVREITLSCYQGHEYRWQRTAIESLQEAAEA 70


>UniRef50_P49450-2 Cluster: Isoform 2 of P49450 ; n=5; Eutheria|Rep:
           Isoform 2 of P49450 - Homo sapiens (Human)
          Length = 114

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 79  LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 108



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVRE 345
           L+EIR+ QKST LLIRKLPF RL  E
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAAE 73


>UniRef50_Q96FF4 Cluster: CENPA protein; n=2; Homo sapiens|Rep:
           CENPA protein - Homo sapiens (Human)
          Length = 127

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 92  LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 121



 Score = 41.1 bits (92), Expect = 0.023
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVRE 345
           L+EIR+ QKST LLIRKLPF RL  E
Sbjct: 61  LKEIRKLQKSTHLLIRKLPFSRLAAE 86


>UniRef50_UPI0000F34658 Cluster: UPI0000F34658 related cluster; n=1;
           Bos taurus|Rep: UPI0000F34658 UniRef100 entry - Bos
           Taurus
          Length = 138

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYL 426
           L+ I+  QK T LL RK PF RL REI   F    D  +Q+ A+ ALQEA+E +L
Sbjct: 46  LQAIQALQKGTRLLPRKTPFSRLPREIRVKFTHGVDFSWQTQALLALQEATETFL 100



 Score = 40.7 bits (91), Expect = 0.030
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L ++HA R+T+  K+ QLA+RIRG
Sbjct: 103 LFEDAGLLSLHASRITLSSKESQLAQRIRG 132


>UniRef50_Q7R295 Cluster: Histone H3; n=1; Giardia lamblia ATCC
           50803|Rep: Histone H3 - Giardia lamblia ATCC 50803
          Length = 156

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 28/70 (40%), Positives = 37/70 (52%), Gaps = 6/70 (8%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDF------KTDLXFQSAAIGALQEASEAYLXW 432
           REI  YQ + + LI+KLPF RLV+E+ +        K    FQ  A+ ALQ A+E Y+  
Sbjct: 60  REIYHYQHNVDTLIQKLPFARLVQELVEQIAQRDGSKGPYRFQGMAMEALQSATEEYIVE 119

Query: 433 LVRRHQLVCY 462
           L     L  Y
Sbjct: 120 LFSTALLATY 129


>UniRef50_Q4N693 Cluster: Histone H3; n=2; Theileria|Rep: Histone H3
           - Theileria parva
          Length = 362

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDF---KTDLXFQSAAIGALQEASEAYLXWLVR 441
           REI  YQKST +LI +  F R+VREIAQ++      + F   A+ ALQ A+E  +  L+ 
Sbjct: 265 REIMAYQKSTHMLIPRAIFARIVREIAQNWWAGSGQIRFTVEALAALQVATEDEITKLLE 324

Query: 442 RHQLVCYSRQTCDHHAE 492
                      C HHA+
Sbjct: 325 -------ISTACSHHAK 334


>UniRef50_Q3LVW5 Cluster: Histone H3; n=1; Bigelowiella natans|Rep:
           Histone H3 - Bigelowiella natans (Pedinomonas
           minutissima) (Chlorarachnion sp.(strain CCMP 621))
          Length = 129

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 7/92 (7%)
 Frame = +1

Query: 262 VALREIRRYQKSTELLIRKLPFQRLVREIAQDF-KTDLXFQSAAIGALQEASEAY-LXWL 435
           + L EIR+YQ+ST L+++++PF RL+++I     K    + S ++  +QE +E Y L +L
Sbjct: 25  LTLLEIRKYQRSTYLIMQRIPFFRLLKKITNKITKQKFSWNSNSLFIMQEITEYYLLNFL 84

Query: 436 VRRHQLVCYSRQ-----TCDHHAEGYSTCSTN 516
              +    + ++     T  +  E Y TC  N
Sbjct: 85  SELNTCASHGKRLTVSITILNSVERYKTCKQN 116


>UniRef50_UPI0000498E51 Cluster: histone H3; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: histone H3 - Entamoeba
           histolytica HM-1:IMSS
          Length = 205

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 18/29 (62%), Positives = 25/29 (86%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIR 520
           LFED+NLCA+HAKRVT+  +DI+L  R++
Sbjct: 174 LFEDSNLCALHAKRVTVDLRDIRLVLRLK 202


>UniRef50_Q170W9 Cluster: Centromere protein-A, putative; n=1; Aedes
           aegypti|Rep: Centromere protein-A, putative - Aedes
           aegypti (Yellowfever mosquito)
          Length = 279

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDF-KTDLXFQSAAIGALQEASEAY 423
           L  I R+Q STE LI KLPF RL++E  Q +   +L      +  LQEA+E Y
Sbjct: 189 LHSIARHQTSTECLIPKLPFSRLIKETMQQYCGRNLRITPECLLCLQEAAEIY 241


>UniRef50_A0DDL5 Cluster: Chromosome undetermined scaffold_466,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_466,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 184

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/30 (63%), Positives = 22/30 (73%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED+  C  HAKRVT+M KD+ L  RIRG
Sbjct: 141 LFEDSVQCTFHAKRVTLMAKDLNLTARIRG 170



 Score = 33.1 bits (72), Expect = 6.0
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 5/58 (8%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQ-----SAAIGALQEASEAYL 426
           L+EIR+ Q S+ L+ R+  FQR VR+       +L F+     S ++  LQ  +E Y+
Sbjct: 81  LQEIRQLQASSVLVCRRAGFQRFVRQTGIKVSDELGFKEFRYSSKSLECLQTLTEQYM 138


>UniRef50_Q9V6Q2 Cluster: Histone H3-like centromeric protein cid;
           n=14; melanogaster subgroup|Rep: Histone H3-like
           centromeric protein cid - Drosophila melanogaster (Fruit
           fly)
          Length = 225

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>UniRef50_A7AQ16 Cluster: Core histone H2A/H2B/H3/H4 family protein;
           n=1; Babesia bovis|Rep: Core histone H2A/H2B/H3/H4
           family protein - Babesia bovis
          Length = 521

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 26/52 (50%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDF---KTDLXFQSAAIGALQEASE 417
           REI  YQKST LLI +  F R+VREIAQ +      + F   A+ ALQ A+E
Sbjct: 424 REIMAYQKSTHLLIPRAVFARVVREIAQHWWRGPEPVKFTVEALSALQAATE 475



 Score = 32.7 bits (71), Expect = 7.9
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 529
           L E +  C+ HAKR+T+   D++LAR  RG +
Sbjct: 481 LLEISTACSYHAKRITLRIDDMRLARFCRGRQ 512


>UniRef50_Q2KHH9 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea 70-15|Rep: Putative uncharacterized
           protein - Magnaporthe grisea 70-15
          Length = 121

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/28 (67%), Positives = 25/28 (89%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVR 342
           T+ALREIRRYQ++T L +RKLPF RL++
Sbjct: 39  TLALREIRRYQQNTGLCMRKLPFARLMQ 66


>UniRef50_Q8T9Z4 Cluster: Centromeric histone Cid; n=1; Drosophila
           orena|Rep: Centromeric histone Cid - Drosophila orena
           (Fruit fly)
          Length = 212

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +1

Query: 274 EIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYL 426
           EIRR Q  +  LI KLPF RLVRE    +     L    AA+ A+QE+ E Y+
Sbjct: 123 EIRRLQSHSRALIPKLPFSRLVREFIMKYSDGEPLKISVAALVAIQESCELYV 175


>UniRef50_Q54F38 Cluster: Histone H3 domain-containing protein; n=1;
           Dictyostelium discoideum AX4|Rep: Histone H3
           domain-containing protein - Dictyostelium discoideum AX4
          Length = 619

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +1

Query: 277 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           IRR + S + +I +LP  RLVREI   F   L     A+ A+Q  +EAYL  L+
Sbjct: 535 IRRLRNSVDFMIPRLPLSRLVREIMCLFDDGLRITPGALLAIQTTTEAYLTRLM 588


>UniRef50_Q8T9Y3 Cluster: Histone H3; n=2; Drosophila
           pseudoobscura|Rep: Histone H3 - Drosophila pseudoobscura
           (Fruit fly)
          Length = 257

 Score = 41.1 bits (92), Expect = 0.023
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 3/55 (5%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDF---KTDLXFQSAAIGALQEASEAYL 426
           +EI+R Q + +LLI +LPF RLVREI  +     +D      ++ ALQ A+E Y+
Sbjct: 166 QEIQRLQATPKLLIPRLPFSRLVREIIVNLTGSSSDFRVTQGSMEALQTAAEMYV 220


>UniRef50_Q7QQF2 Cluster: GLP_91_10664_11143; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_91_10664_11143 - Giardia lamblia
           ATCC 50803
          Length = 159

 Score = 41.1 bits (92), Expect = 0.023
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 3/65 (4%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLXFQSAAIGALQEASEAYLXWLVR 441
           +EI   Q+    +I    FQRLVR+I     +   ++ FQ+ AIGALQEASEA L  ++ 
Sbjct: 61  KEITNMQRRVTSVIPIACFQRLVRDITCSLPSGGNEIRFQAQAIGALQEASEAMLSQVLG 120

Query: 442 RHQLV 456
             Q++
Sbjct: 121 DCQIL 125


>UniRef50_Q8T9Y7 Cluster: Histone H3; n=5; ananassae subgroup|Rep:
           Histone H3 - Drosophila malerkotliana
          Length = 292

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 5/57 (8%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREI-----AQDFKTDLXFQSAAIGALQEASEAYL 426
           REI + Q+ T  LI KLPF RLVRE+     +Q FKT       A+ ALQ +SE YL
Sbjct: 203 REINKLQQFTGNLIPKLPFSRLVRELLYSQGSQMFKT----TRGALEALQSSSEIYL 255


>UniRef50_A3B8L7 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 407

 Score = 39.9 bits (89), Expect = 0.052
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = -3

Query: 435 KPXEISLACLLESSDGGRLEXQISFEILSDFSHKTLERQLTD 310
           +P E+ L  LL+  DGG LE ++  E+L D + + LE +L +
Sbjct: 366 QPDEVRLRGLLQGGDGGALEAEVGLEVLGDLADEALEGELAE 407



 Score = 39.5 bits (88), Expect = 0.069
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = -2

Query: 574 YRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQ 434
           Y  + NQ +    LS    D + +L++L HDG   GV+  QVGV EQ
Sbjct: 321 YESSKNQRWA-DGLSALAADPARELDVLGHDGDALGVDGAQVGVLEQ 366


>UniRef50_Q8T9Z1 Cluster: Histone H3; n=8; melanogaster group|Rep:
           Histone H3 - Drosophila lutescens (Fruit fly)
          Length = 254

 Score = 39.5 bits (88), Expect = 0.069
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQ--SAAIGALQEASEAYL 426
           REI+  QK    LI KLPF RLVRE    +     F+    A  ALQ +SE Y+
Sbjct: 165 REIQNLQKHPGTLIPKLPFSRLVREFIVKYSDGEPFRVTEGAFNALQVSSEMYV 218


>UniRef50_UPI00004988EF Cluster: histone H3; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: histone H3 - Entamoeba
           histolytica HM-1:IMSS
          Length = 119

 Score = 39.1 bits (87), Expect = 0.091
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL-XFQSAAIGALQEASEAYLXWLVRRH 447
           REIR  Q++T +LI    F + VRE+  ++ T L   +  A  ALQ+A+E++L  L +  
Sbjct: 34  REIRELQRTTNILIPSGVFNKCVREVINEYTTKLFRIEKDANLALQQAAESFLVSLFQEA 93

Query: 448 QLV 456
            ++
Sbjct: 94  DMM 96



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIR 520
           LF++ ++ A H KRVTI+ KD+ LA R++
Sbjct: 89  LFQEADMMARHCKRVTILEKDMLLAMRLK 117


>UniRef50_Q5TWZ6 Cluster: ENSANGP00000026831; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000026831 - Anopheles gambiae
           str. PEST
          Length = 236

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRI 517
           LFED   C +H  RVT+ PKDI+L  R+
Sbjct: 180 LFEDAYKCCLHRARVTLAPKDIELVSRV 207



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 25/67 (37%), Positives = 31/67 (46%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLVRRH 447
           L+E+ R Q S   LI K  F RLVRE+   F         A+ AL EA+E +L  L    
Sbjct: 128 LKEMLRLQLSWHHLIPKASFGRLVREL---FDHRYRITPQALEALHEATEVFLVQLFEDA 184

Query: 448 QLVCYSR 468
              C  R
Sbjct: 185 YKCCLHR 191


>UniRef50_Q4V252 Cluster: Transposase, N-terminal region; n=1;
           Bacillus cereus E33L|Rep: Transposase, N-terminal region
           - Bacillus cereus (strain ZK / E33L)
          Length = 536

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 6/106 (5%)
 Frame = +1

Query: 124 WLVLNKLPVNLLE----VKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQ 291
           WL+  K+PV LLE     K++      K  +  R + +E +    +A+  V+++  R   
Sbjct: 230 WLIHQKIPVYLLESFSSTKIQQMATEAKTLDAYRMSEIEKKKRYTLAISLVSVQTSRILD 289

Query: 292 KSTELLI-RKLPFQRLVREIAQDFKTDLXFQS-AAIGALQEASEAY 423
              E+LI R +   +  RE  QD+K     ++ + +  LQ    AY
Sbjct: 290 NIGEMLIKRMMSIHKKGREFLQDYKKQTQKRTDSLVATLQHVLMAY 335


>UniRef50_A0CJ31 Cluster: Chromosome undetermined scaffold_19, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_19,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 200

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 19/71 (26%), Positives = 38/71 (53%)
 Frame = +1

Query: 112 KSKQWLVLNKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQ 291
           K++++L+  KL +  +  K   + L Q+R   Q  +++ S++   + +    + EIR+ +
Sbjct: 9   KAREYLLGQKLSLKSITQKYNKDKLEQQRSFKQMSSILNSKTESSVIITDSLITEIRQQK 68

Query: 292 KSTELLIRKLP 324
           K    LIRK P
Sbjct: 69  KEKAFLIRKSP 79


>UniRef50_UPI0000E20DF7 Cluster: PREDICTED: similar to histone H3;
           n=1; Pan troglodytes|Rep: PREDICTED: similar to histone
           H3 - Pan troglodytes
          Length = 50

 Score = 36.3 bits (80), Expect = 0.64
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQD 357
           TVALR++RRYQ S ELLI KLP   L+RE+  D
Sbjct: 11  TVALRDVRRYQNS-ELLISKLP---LLRELGGD 39


>UniRef50_UPI000023ED7C Cluster: hypothetical protein FG07553.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07553.1 - Gibberella zeae PH-1
          Length = 984

 Score = 35.9 bits (79), Expect = 0.85
 Identities = 18/37 (48%), Positives = 21/37 (56%)
 Frame = +3

Query: 129 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKP 239
           R KQTARKSTGG AP  Q+A  A      S   ++ P
Sbjct: 417 RMKQTARKSTGGVAPHMQMAQMAQMSQRLSLQALRPP 453


>UniRef50_Q22NG1 Cluster: Von Willebrand factor type A domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Von Willebrand factor type A domain
           containing protein - Tetrahymena thermophila SB210
          Length = 821

 Score = 35.9 bits (79), Expect = 0.85
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = +3

Query: 132 TKQTARK--STGGKAPRKQLATKAARKSAPSTGGVKKP 239
           TK T R   S GG+  + +    +ARKSAP+TGGV KP
Sbjct: 667 TKSTYRSTGSAGGRHRKNRKKQGSARKSAPATGGVMKP 704


>UniRef50_P61180 Cluster: 50S ribosomal protein L22; n=40;
           Bacteria|Rep: 50S ribosomal protein L22 - Mycobacterium
           bovis
          Length = 197

 Score = 35.9 bits (79), Expect = 0.85
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +3

Query: 144 ARKSTGGKAPRKQLATKAARKSAPSTGGVKK-PHRYRPGYSGPS*NSSLS 290
           A    G  AP K+ A KA  K AP++ GVKK P +  P    P+  S  S
Sbjct: 141 AASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAKKAPAKASETS 190


>UniRef50_A7E525 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 648

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +3

Query: 174 RKQLATKAARKSAPSTGG-VKKPHRYRPGYSGPS*NSSLS 290
           R + ATKA +++   TG  V + HR+RP Y  PS  SS+S
Sbjct: 301 RLKKATKAYKEAKSRTGSSVPRSHRHRPSYPSPSDMSSIS 340


>UniRef50_P19375 Cluster: Histone H1, early embryonic; n=9;
           Deuterostomia|Rep: Histone H1, early embryonic -
           Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 205

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +3

Query: 132 TKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP 254
           T++  +K T  KAP+K  A K+  K  P     KKP   +P
Sbjct: 153 TEKKEKKKTPKKAPKKPAAKKSTPKKTPKKAAAKKPKTAKP 193


>UniRef50_P20783 Cluster: Neurotrophin-3 precursor; n=96;
           Gnathostomata|Rep: Neurotrophin-3 precursor - Homo
           sapiens (Human)
          Length = 257

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>UniRef50_UPI0000DD7E58 Cluster: PREDICTED: hypothetical protein;
           n=2; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 519

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +3

Query: 159 GGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGYSG 266
           GGK PR+Q A +A  KS P  GG +KP R  P + G
Sbjct: 263 GGKNPRRQKAPEARTKS-PGGGG-RKPRRQNPWWRG 296


>UniRef50_UPI0000DD7C46 Cluster: PREDICTED: hypothetical protein;
           n=2; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 427

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = +3

Query: 147 RKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYR-PGYSG 266
           +K+ GGK P+++ A K  R+      GVKKP R + PG  G
Sbjct: 323 QKAAGGKKPQRRGAGKKPRRQNSQRRGVKKPGRTKSPGAGG 363


>UniRef50_A6RJV3 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 601

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = +3

Query: 174 RKQLATKAARKSAPSTGG-VKKPHRYRPGYSGPS*NSSLS 290
           R + ATKA +++   +G    + HRYRP Y  PS  SS+S
Sbjct: 256 RLKKATKAFKEAKTRSGSNAPRSHRYRPSYPSPSDMSSIS 295


>UniRef50_P49643 Cluster: DNA primase large subunit; n=33;
           Euteleostomi|Rep: DNA primase large subunit - Homo
           sapiens (Human)
          Length = 509

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 24/86 (27%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  AI
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAI 154


>UniRef50_O75037 Cluster: Kinesin-like protein KIF21B; n=21;
           Euteleostomi|Rep: Kinesin-like protein KIF21B - Homo
           sapiens (Human)
          Length = 1637

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +1

Query: 133 LNKLPVNLLEVK-LRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELL 309
           L KL   + E+K  +V  + Q R E QRR LVE++ +  IA       ++++ Q+  E  
Sbjct: 745 LKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIA-------QLKKEQRRQEFQ 797

Query: 310 IRKLPFQRLVREIAQDFKT 366
           IR L  Q+  +E+    KT
Sbjct: 798 IRALESQKRQQEMVLRRKT 816


>UniRef50_Q9EN29 Cluster: AMV019; n=1; Amsacta moorei entomopoxvirus
           'L'|Rep: AMV019 - Amsacta moorei entomopoxvirus (AmEPV)
          Length = 524

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +1

Query: 112 KSKQWLVLNKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQ 291
           K+  + V+NKLP  L E K+ + N+L  +R N   A  E +  I+     V L  + + +
Sbjct: 143 KNNDFPVINKLPELLEEDKIELYNILMMKRLNNELA-TEEQGSIIQDYRKVLLENVNKLE 201

Query: 292 KSTEL 306
           K  ++
Sbjct: 202 KPKKI 206


>UniRef50_Q5DBK9 Cluster: SJCHGC08043 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08043 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 117

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = -2

Query: 235 FLTPPVLGADFRAAFVASCLRGALPPVDLRAVCLVRAIVYFFNVFHKLSY*FSIILEFID 56
           + T  +LG D    +   C    L P+  R   L   + ++F V H+L+Y    +L FID
Sbjct: 50  YFTKTMLGIDCALNYTTRCDTLGLEPLWKRRAKL--NLTFYFKVVHRLAYFREPVLRFID 107

Query: 55  QFH 47
            F+
Sbjct: 108 AFN 110


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 533,239,932
Number of Sequences: 1657284
Number of extensions: 9200670
Number of successful extensions: 25520
Number of sequences better than 10.0: 96
Number of HSP's better than 10.0 without gapping: 24602
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25476
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -