SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P39019 Cluster: 40S ribosomal protein S19; n=127; Eukar...   125   6e-28
UniRef50_Q5D941 Cluster: SJCHGC06232 protein; n=2; Schistosoma j...   110   2e-23
UniRef50_Q5KQL3 Cluster: Putative ribosomal protein S19; n=1; Or...   105   8e-22
UniRef50_P40978 Cluster: 40S ribosomal protein S19; n=201; cellu...   105   8e-22
UniRef50_P58234 Cluster: 40S ribosomal protein S19-A; n=19; Dika...    99   3e-20
UniRef50_Q6V579 Cluster: Ribosomal protein S19S; n=4; Ascaridida...    99   7e-20
UniRef50_O59041 Cluster: 30S ribosomal protein S19e; n=5; Archae...    94   2e-18
UniRef50_Q2M3Z3 Cluster: Ribosomal protein S19; n=1; Phytophthor...    92   8e-18
UniRef50_Q54X51 Cluster: 40S ribosomal protein S19; n=1; Dictyos...    89   6e-17
UniRef50_Q4WJN7 Cluster: 40S ribosomal protein S19; n=3; Ascomyc...    89   6e-17
UniRef50_O27653 Cluster: 30S ribosomal protein S19e; n=12; Eurya...    89   6e-17
UniRef50_O28210 Cluster: 30S ribosomal protein S19e; n=2; Euryar...    85   7e-16
UniRef50_A7DPW7 Cluster: Ribosomal protein S19e; n=1; Candidatus...    83   5e-15
UniRef50_Q8TUY1 Cluster: Ribosomal protein S19E; n=2; Archaea|Re...    82   9e-15
UniRef50_Q7XYZ1 Cluster: Putative 40S ribosomal protein S19; n=1...    81   2e-14
UniRef50_Q9YD22 Cluster: 30S ribosomal protein S19e; n=18; Archa...    81   2e-14
UniRef50_Q4MYX5 Cluster: 40S ribosomal protein S19, putative; n=...    79   5e-14
UniRef50_Q5CSY3 Cluster: 40S ribosomal protein S19; n=2; Cryptos...    78   1e-13
UniRef50_A0RYF9 Cluster: Ribosomal protein S19E; n=1; Cenarchaeu...    75   1e-12
UniRef50_A7AM94 Cluster: 40S ribosomal protein S19, putative; n=...    75   1e-12
UniRef50_O15631 Cluster: 40S ribosomal protein S19; n=3; Entamoe...    74   2e-12
UniRef50_A7I9J1 Cluster: Ribosomal protein S19e; n=1; Candidatus...    73   3e-12
UniRef50_Q4Q2R6 Cluster: 40S ribosomal protein S19 protein, puta...    72   9e-12
UniRef50_UPI0000DA3B01 Cluster: PREDICTED: similar to 40S riboso...    71   2e-11
UniRef50_A0CH22 Cluster: Chromosome undetermined scaffold_18, wh...    70   3e-11
UniRef50_UPI00006D00E1 Cluster: Ribosomal protein S19e containin...    65   8e-10
UniRef50_Q7RHC7 Cluster: Ribosomal protein S19e, putative; n=5; ...    64   1e-09
UniRef50_Q97CU4 Cluster: 30S ribosomal protein S19e; n=4; Thermo...    58   1e-07
UniRef50_A2EN51 Cluster: Ribosomal protein S19e, putative; n=4; ...    55   9e-07
UniRef50_A7D1C3 Cluster: Ribosomal protein S19e; n=1; Halorubrum...    47   3e-04
UniRef50_UPI00001CA3A8 Cluster: PREDICTED: similar to 40S riboso...    46   5e-04
UniRef50_Q9AW29 Cluster: 40S ribosomal protein S19; n=1; Guillar...    45   0.001
UniRef50_Q5H6B5 Cluster: Putative uncharacterized protein; n=1; ...    35   1.3  
UniRef50_Q4P756 Cluster: Putative uncharacterized protein; n=1; ...    34   1.8  
UniRef50_UPI0000E22B1D Cluster: PREDICTED: hypothetical protein ...    33   3.1  
UniRef50_Q66KP5 Cluster: LOC446927 protein; n=3; Xenopus|Rep: LO...    33   4.1  
UniRef50_Q874V5 Cluster: Putative uncharacterized protein Pa5D00...    32   9.4  

>UniRef50_P39019 Cluster: 40S ribosomal protein S19; n=127;
           Eukaryota|Rep: 40S ribosomal protein S19 - Homo sapiens
           (Human)
          Length = 145

 Score =  125 bits (302), Expect = 6e-28
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 52  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 112 MVEKDQDGGRKLTPQGQRDLDRIAGQV 138



 Score = 66.1 bits (154), Expect = 5e-10
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 1   MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 49


>UniRef50_Q5D941 Cluster: SJCHGC06232 protein; n=2; Schistosoma
           japonicum|Rep: SJCHGC06232 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 142

 Score =  110 bits (264), Expect = 2e-23
 Identities = 52/87 (59%), Positives = 65/87 (74%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCAAILRH+YIR P G+  + K F  +KRNGV PSH   + GS+ RKA+Q +EAL 
Sbjct: 52  WFYVRCAAILRHLYIR-PTGLTGLCKAFSRKKRNGVKPSHRSLAHGSVIRKAIQQMEALG 110

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           L +K + GGR LT+ GRRDLDR+A Q+
Sbjct: 111 LCQKREGGGRSLTSAGRRDLDRLAYQI 137



 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 25/50 (50%), Positives = 35/50 (70%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  V+VKDV+    VK +A  LKKTGKV++P+  D+VK +   +LAPY+P
Sbjct: 1   MAPVSVKDVDGHVFVKALAQFLKKTGKVRLPDWTDVVKLSSANQLAPYNP 50


>UniRef50_Q5KQL3 Cluster: Putative ribosomal protein S19; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: Putative ribosomal
           protein S19 - Oryza sativa subsp. japonica (Rice)
          Length = 166

 Score =  105 bits (251), Expect = 8e-22
 Identities = 44/87 (50%), Positives = 64/87 (73%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y R A+I R IY+R  +GV    KI+GGR+RNG  P HFC+SSG+I+R  LQ L+ + 
Sbjct: 75  WYYTRAASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMG 134

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +++    GGR++T+QGRRDLD++A +V
Sbjct: 135 IIDVDPKGGRLITSQGRRDLDQVAGRV 161



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 20/66 (30%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKV--------------------KVPEHMDLVKTARFKE 166
           TVKDV   + VK  +AHLK++GK+                    ++PE +D+VKTARFKE
Sbjct: 8   TVKDVNPHEFVKAYSAHLKRSGKLFVASQELLLLGNLRISFYQMELPEWVDIVKTARFKE 67

Query: 167 LAPYDP 184
           L PYDP
Sbjct: 68  LPPYDP 73


>UniRef50_P40978 Cluster: 40S ribosomal protein S19; n=201; cellular
           organisms|Rep: 40S ribosomal protein S19 - Oryza sativa
           subsp. japonica (Rice)
          Length = 146

 Score =  105 bits (251), Expect = 8e-22
 Identities = 44/87 (50%), Positives = 64/87 (73%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y R A+I R IY+R  +GV    KI+GGR+RNG  P HFC+SSG+I+R  LQ L+ + 
Sbjct: 55  WYYTRAASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMG 114

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +++    GGR++T+QGRRDLD++A +V
Sbjct: 115 IIDVDPKGGRLITSQGRRDLDQVAGRV 141



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TVKDV   + VK  +AHLK++GK+++PE +D+VKTARFKEL PYDP
Sbjct: 8   TVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDP 53


>UniRef50_P58234 Cluster: 40S ribosomal protein S19-A; n=19;
           Dikarya|Rep: 40S ribosomal protein S19-A -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 144

 Score =   99 bits (238), Expect = 3e-20
 Identities = 45/84 (53%), Positives = 60/84 (71%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+YVR AAI RHIY+R  VGV  + K++GG    G+ PSH    SGS+ RK +QSLE + 
Sbjct: 52  WYYVRAAAIARHIYLRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIG 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIA 440
           ++EK  +GGR ++ QG+RDLDRIA
Sbjct: 112 VLEKSDNGGRRISQQGQRDLDRIA 135



 Score = 59.7 bits (138), Expect = 4e-08
 Identities = 26/50 (52%), Positives = 35/50 (70%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  V+VKDV+  K +   AA LK++GK+  P+ +D+VKT   KELAPYDP
Sbjct: 1   MAGVSVKDVDAQKFITAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDP 50


>UniRef50_Q6V579 Cluster: Ribosomal protein S19S; n=4;
           Ascarididae|Rep: Ribosomal protein S19S - Parascaris
           univalens
          Length = 128

 Score = 98.7 bits (235), Expect = 7e-20
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+YVR A++ R +YIRSP GV  + +++G  KR GVTP+HF ++SGS+ RKALQ+LEA+K
Sbjct: 53  WYYVRTASVARRLYIRSPTGVGALRRVYGSNKRRGVTPNHFAKASGSVIRKALQTLEAIK 112

Query: 369 LVEKVQDG-GRILT 407
            VEK  DG GRILT
Sbjct: 113 WVEKHPDGNGRILT 126



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 24/41 (58%), Positives = 30/41 (73%)
 Frame = +2

Query: 59  VEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           ++Q +IV+ +A  LKK+GKVKVPE  DLVK    KELAP D
Sbjct: 10  IDQHEIVRQIAGFLKKSGKVKVPEWSDLVKLGITKELAPVD 50


>UniRef50_O59041 Cluster: 30S ribosomal protein S19e; n=5;
           Archaea|Rep: 30S ribosomal protein S19e - Pyrococcus
           horikoshii
          Length = 150

 Score = 93.9 bits (223), Expect = 2e-18
 Identities = 42/88 (47%), Positives = 59/88 (67%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y R A+ILR +YI  PVG++ +   +GGRK  G  P  F ++ GSI RKALQ LEA  
Sbjct: 50  WWYYRVASILRRVYIDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKALQQLEAAG 109

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQVR 452
            +EKV   GR++T +GR  LD+IA +++
Sbjct: 110 FIEKVPGKGRVVTPKGRSFLDKIATELK 137


>UniRef50_Q2M3Z3 Cluster: Ribosomal protein S19; n=1; Phytophthora
           infestans|Rep: Ribosomal protein S19 - Phytophthora
           infestans (Potato late blight fungus)
          Length = 154

 Score = 91.9 bits (218), Expect = 8e-18
 Identities = 45/109 (41%), Positives = 67/109 (61%), Gaps = 4/109 (3%)
 Frame = +3

Query: 135 WIL*RQLASKSWLRMTLXWFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFC 314
           W + +  + K +      W+Y+R A+I R +Y+R   GV ++ K++GG  R GV   HF 
Sbjct: 43  WDVVKTASFKEYSPADPDWYYIRAASIARKVYLRQYTGVGSLKKVYGGAARKGVHRQHFQ 102

Query: 315 RSSGSIARKALQSLEALKLVEK----VQDGGRILTTQGRRDLDRIAAQV 449
           ++SG + R  LQ LE +K+VEK    V  GGR +T+ G++DLDRIA QV
Sbjct: 103 KASGGLIRHILQQLEEMKVVEKCPEGVNKGGRKITSHGQQDLDRIAGQV 151



 Score = 59.3 bits (137), Expect = 5e-08
 Identities = 25/50 (50%), Positives = 37/50 (74%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           +R VTV+DV+  + +K  A HLK++GK+++P   D+VKTA FKE +P DP
Sbjct: 10  VRGVTVRDVKPAEFIKAYAEHLKRSGKIELPAWWDVVKTASFKEYSPADP 59


>UniRef50_Q54X51 Cluster: 40S ribosomal protein S19; n=1;
           Dictyostelium discoideum AX4|Rep: 40S ribosomal protein
           S19 - Dictyostelium discoideum AX4
          Length = 148

 Score = 89.0 bits (211), Expect = 6e-17
 Identities = 42/88 (47%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W Y R A + R +YIR   GV T  ++FGG +RNGV P+HF   +G   R  L+ L+ LK
Sbjct: 54  WIYYRIATLARKVYIRGGDGVATYRRVFGGNRRNGVRPNHFADVNGGNIRYCLKQLQNLK 113

Query: 369 LVE-KVQDGGRILTTQGRRDLDRIAAQV 449
           ++E     GGR +T  GRRDLDRIA Q+
Sbjct: 114 VIETDAVKGGRTITATGRRDLDRIAKQI 141



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 22/48 (45%), Positives = 34/48 (70%)
 Frame = +2

Query: 41  SVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           +VT+KDV   + + T A  LKKTG+V++P+  D+ KTA ++EL P +P
Sbjct: 5   AVTLKDVCPQEFIATYARFLKKTGRVQIPKWNDIAKTATYRELPPTNP 52


>UniRef50_Q4WJN7 Cluster: 40S ribosomal protein S19; n=3;
           Ascomycota|Rep: 40S ribosomal protein S19 - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 221

 Score = 89.0 bits (211), Expect = 6e-17
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+YVR AA+ RHIY+R  VGV  + K+ G  K  G  P+H   +SGS+ RK +QSLE + 
Sbjct: 126 WYYVRAAAVARHIYMRKTVGVGRLRKVHGSTKNRGSRPNHHVDASGSVDRKIIQSLEKIG 185

Query: 369 LVEKVQD-GGRILTTQGRRDLDRIA 440
           ++E  ++ GGR +T  G+RDLDRIA
Sbjct: 186 VLEYDEEKGGRRITQAGQRDLDRIA 210



 Score = 35.5 bits (78), Expect = 0.76
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +2

Query: 38  RSVTVKDVE---QDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           +++ ++DVE     K +   +A LK+ GK+ +P  +D VKT+   EL P D
Sbjct: 73  QNLQIEDVEILTAQKFIAAYSAFLKRQGKLPIPGWVDTVKTSCSNELPPQD 123


>UniRef50_O27653 Cluster: 30S ribosomal protein S19e; n=12;
           Euryarchaeota|Rep: 30S ribosomal protein S19e -
           Methanobacterium thermoautotrophicum
          Length = 145

 Score = 89.0 bits (211), Expect = 6e-17
 Identities = 41/88 (46%), Positives = 61/88 (69%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+YVR AA+LR +YI  PVGV ++   +GG+K  G  P  F R SG+I R+ALQ LE   
Sbjct: 50  WWYVRAAALLRRVYIDGPVGVNSLRTHYGGKKDRGSRPEKFRRGSGAIIRRALQQLEESG 109

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQVR 452
           L+++ ++ GR++T +GR  LD+ AA+V+
Sbjct: 110 LIKR-EENGRVITPEGRSFLDKAAAEVK 136



 Score = 41.1 bits (92), Expect = 0.015
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TV DV  D ++  VA  LK   KVK PE ++ VKT   KE  P +P
Sbjct: 3   TVYDVPADLLINRVAEELKNDSKVKSPEWVNFVKTGVHKERRPENP 48


>UniRef50_O28210 Cluster: 30S ribosomal protein S19e; n=2;
           Euryarchaeota|Rep: 30S ribosomal protein S19e -
           Archaeoglobus fulgidus
          Length = 147

 Score = 85.4 bits (202), Expect = 7e-16
 Identities = 38/88 (43%), Positives = 58/88 (65%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+R A+I R +YI  PVG++ +   +GGRKR G  P  F + SG+I R AL  LE L 
Sbjct: 48  WWYLRLASIFRRVYIDGPVGIERLRTFYGGRKRRGSKPPKFRKGSGAIVRNALHQLEQLG 107

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQVR 452
            V+K ++ GR++T  GR  LD++A +++
Sbjct: 108 FVKKTRE-GRVVTPMGRSFLDKVATELK 134


>UniRef50_A7DPW7 Cluster: Ribosomal protein S19e; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein
           S19e - Candidatus Nitrosopumilus maritimus SCM1
          Length = 150

 Score = 82.6 bits (195), Expect = 5e-15
 Identities = 35/87 (40%), Positives = 57/87 (65%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W++ RCA+I+R IY+  P+G+  + K +GG K +G   +H   + G+I R A+  LE L 
Sbjct: 49  WWHTRCASIMRKIYLHGPIGINELRKDYGGGKPSGYGAAHHKDAGGAIIRNAIHGLEKLG 108

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
            +EKV+  GRI++ QG + LDR+A ++
Sbjct: 109 YLEKVEKKGRIVSKQGMQKLDRLATEI 135


>UniRef50_Q8TUY1 Cluster: Ribosomal protein S19E; n=2; Archaea|Rep:
           Ribosomal protein S19E - Methanopyrus kandleri
          Length = 149

 Score = 81.8 bits (193), Expect = 9e-15
 Identities = 38/87 (43%), Positives = 56/87 (64%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+R A+ILR +Y+  PVGV  +   +GGR+  G  P  F + SG+I RK LQ LE   
Sbjct: 50  WWYMRAASILRRVYMDGPVGVSRLRTYYGGRQDRGARPERFRKGSGAIIRKILQQLEEAG 109

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK ++ GR++T +GR  +D  A ++
Sbjct: 110 LVEKTEE-GRVVTPEGRSLVDSTAHEI 135



 Score = 33.1 bits (72), Expect = 4.1
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +2

Query: 59  VEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           V   ++V+ +A  LK   ++K PE    VKT R KE  P DP
Sbjct: 7   VPGSELVERLAEKLKDFEEIKPPEWAKYVKTGRHKERPPEDP 48


>UniRef50_Q7XYZ1 Cluster: Putative 40S ribosomal protein S19; n=1;
           Griffithsia japonica|Rep: Putative 40S ribosomal protein
           S19 - Griffithsia japonica (Red alga)
          Length = 150

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 37/86 (43%), Positives = 55/86 (63%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W Y+R A+I R +YIR  +G     KI+G RKR G+ P    +SSG + R +LQ LE L 
Sbjct: 59  WLYIRIASIARKLYIRGGIGTGEFRKIYGDRKRRGMKPCRSSKSSGGLIRYSLQQLEKLG 118

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQ 446
           + EK + GGR +T++G+ ++D  A+Q
Sbjct: 119 VAEKDERGGRRITSKGQSEMDTQASQ 144



 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 24/46 (52%), Positives = 33/46 (71%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TVKDV   + V T A+HLK+ G +++P  +D +KTA  +ELAPYDP
Sbjct: 12  TVKDVPAAEFVNTYASHLKRVGMIEIPPWVDTIKTAASRELAPYDP 57


>UniRef50_Q9YD22 Cluster: 30S ribosomal protein S19e; n=18;
           Archaea|Rep: 30S ribosomal protein S19e - Aeropyrum
           pernix
          Length = 153

 Score = 80.6 bits (190), Expect = 2e-14
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIR-SPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEAL 365
           W+YVR A+ILR +Y    P+G++T   I+GGR+  G  P HF ++ GS+ RK LQ LE  
Sbjct: 51  WWYVRAASILRKLYKSPEPIGIETFRTIYGGRQNRGSAPEHFRKAGGSVPRKILQQLEEA 110

Query: 366 KLVEKVQDGGRILTTQGRRDLDRIAAQV 449
            LV KV   GR ++  GR  LD  A ++
Sbjct: 111 GLVVKVPGRGRTISPAGRSLLDTTAREI 138


>UniRef50_Q4MYX5 Cluster: 40S ribosomal protein S19, putative; n=2;
           Theileria|Rep: 40S ribosomal protein S19, putative -
           Theileria parva
          Length = 169

 Score = 79.4 bits (187), Expect = 5e-14
 Identities = 35/88 (39%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY+R AA+LRH+Y     GV  + K++  +KRNG  P+H CR+SG I R  +Q LE++ 
Sbjct: 74  WFYIRAAAVLRHLYFHPDSGVDRLRKVYSSKKRNGSAPNHTCRASGKILRTIVQQLESIG 133

Query: 369 LVEK-VQDGGRILTTQGRRDLDRIAAQV 449
            +E+ ++  GR L+ +G   ++  A Q+
Sbjct: 134 FLEQDLKKHGRRLSRKGCNTVNAFARQL 161



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +2

Query: 41  SVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           + ++KD   D  VK  A H+K  G ++ P+ +D  KT+  KELAP DP
Sbjct: 25  NTSLKDCNPDLFVKAFAEHMKLKGYLECPKRLDYAKTSVAKELAPQDP 72


>UniRef50_Q5CSY3 Cluster: 40S ribosomal protein S19; n=2;
           Cryptosporidium|Rep: 40S ribosomal protein S19 -
           Cryptosporidium parvum Iowa II
          Length = 154

 Score = 77.8 bits (183), Expect = 1e-13
 Identities = 39/89 (43%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W Y+R A+ILRH+Y+R  VGV  ++K +G ++RNG   +H   +S  I R  L  L++L 
Sbjct: 65  WLYIRAASILRHLYVRPNVGVGALSKFYGRKQRNGTARNHSAVASRGIIRYCLIQLQSLG 124

Query: 369 LVE-KVQDGGRILTTQGRRDLDRIAAQVR 452
           LVE     G R L+ QG+R+LD IA Q +
Sbjct: 125 LVEFNPNTGTRRLSPQGQRELDSIARQCK 153



 Score = 41.9 bits (94), Expect = 0.009
 Identities = 21/43 (48%), Positives = 27/43 (62%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAP 175
           T KDV    +++  A  LKK GK+ +PE +D VKTA  KEL P
Sbjct: 18  TAKDVPAGILIEKFAQQLKKGGKMTMPEWVDHVKTASSKELPP 60


>UniRef50_A0RYF9 Cluster: Ribosomal protein S19E; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein S19E - Cenarchaeum
           symbiosum
          Length = 144

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 30/87 (34%), Positives = 55/87 (63%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W++ RCA+++R IY+  P+G+  +   +GG K  G   ++  ++ G+I R A+  LE L 
Sbjct: 43  WWHTRCASLMRKIYLHGPIGINGLRSEYGGGKPRGYGAANHRKAGGAIIRNAVHGLEKLG 102

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
            +EK+   GRI++ QG + LDR++ ++
Sbjct: 103 YIEKLDKKGRIVSRQGMQKLDRLSTEI 129


>UniRef50_A7AM94 Cluster: 40S ribosomal protein S19, putative; n=1;
           Babesia bovis|Rep: 40S ribosomal protein S19, putative -
           Babesia bovis
          Length = 171

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY+R AAILRH+Y     G+  + +++  RKR G  P+H C +SG I R  +Q LEA  
Sbjct: 74  WFYIRSAAILRHLYFHPDEGIGRLRRVYASRKRRGCAPNHTCPASGKIIRTIVQQLEANG 133

Query: 369 LVEKVQDG-GRILTTQG 416
            +EK +D  GR L+ +G
Sbjct: 134 FLEKSKDNKGRRLSRRG 150



 Score = 33.9 bits (74), Expect = 2.3
 Identities = 15/48 (31%), Positives = 26/48 (54%)
 Frame = +2

Query: 41  SVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           + ++ D + D  +   A  ++    +  P+ +D VKT+  KELAP DP
Sbjct: 25  NTSLNDCQPDVFIAAFAQQMELKNYIDPPKWIDYVKTSCAKELAPQDP 72


>UniRef50_O15631 Cluster: 40S ribosomal protein S19; n=3; Entamoeba
           histolytica|Rep: 40S ribosomal protein S19 - Entamoeba
           histolytica
          Length = 148

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 53/86 (61%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W Y+R AAI R +Y+ + +GV  + + +G +      PSH    SG + R  LQ LE + 
Sbjct: 53  WIYIRAAAIARKVYLNNGIGVMALRRAYGDQYNKHYYPSHRTLGSGKVNRYILQQLEKMG 112

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQ 446
           +V K+Q  GR LT +GR+D+D+IA++
Sbjct: 113 IVGKIQ-SGRSLTKEGRKDMDKIASK 137



 Score = 52.0 bits (119), Expect = 8e-06
 Identities = 23/45 (51%), Positives = 31/45 (68%)
 Frame = +2

Query: 50  VKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           +KDV     +K  A HLKK+GK+++PE +D VKT   KELAP +P
Sbjct: 7   IKDVVAIDFIKAYAEHLKKSGKLEIPEWVDTVKTGMCKELAPLNP 51


>UniRef50_A7I9J1 Cluster: Ribosomal protein S19e; n=1; Candidatus
           Methanoregula boonei 6A8|Rep: Ribosomal protein S19e -
           Methanoregula boonei (strain 6A8)
          Length = 199

 Score = 73.3 bits (172), Expect = 3e-12
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W++ R AA+LR +Y+  P+GV+ +   +GG K  G  P+ F + SGS+ RKALQ LEA  
Sbjct: 50  WWFTRAAAVLRRVYVDGPLGVERMRSFYGGSKNRGSKPNAFRKGSGSVLRKALQQLEAAG 109

Query: 369 LVEKVQD-GGRILTTQGRRDLDRIAAQV 449
           L+  V D  GR ++  G   LD +A +V
Sbjct: 110 LI--VHDKTGRKVSPAGMAFLDSVAKEV 135



 Score = 39.1 bits (87), Expect = 0.062
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           TV DV  D +++ VA  LKK  ++K P      KT   KE+ P DP
Sbjct: 3   TVYDVPADHLIRKVAEELKKRQEIKPPAWAAFAKTGVHKEMPPEDP 48


>UniRef50_Q4Q2R6 Cluster: 40S ribosomal protein S19 protein,
           putative; n=9; Trypanosomatidae|Rep: 40S ribosomal
           protein S19 protein, putative - Leishmania major
          Length = 172

 Score = 71.7 bits (168), Expect = 9e-12
 Identities = 37/89 (41%), Positives = 51/89 (57%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+RCAA+LR IY+R  VG   ++K FG +K  G  P H   SS      A +SL  L 
Sbjct: 77  WYYIRCAAVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLG 136

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQVRL 455
           LVE     G+ LT +G +  D +A QV++
Sbjct: 137 LVEPGAQSGQRLTRKGHKFADSLAFQVQI 165



 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +2

Query: 29  GKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           GK +  T+KDV   + +KT A H K+ GK+ VP   +++K++  +E AP +P
Sbjct: 24  GKRKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNP 75


>UniRef50_UPI0000DA3B01 Cluster: PREDICTED: similar to 40S ribosomal
           protein S19; n=3; Rattus norvegicus|Rep: PREDICTED:
           similar to 40S ribosomal protein S19 - Rattus norvegicus
          Length = 268

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 36/55 (65%), Positives = 41/55 (74%)
 Frame = +3

Query: 285 RNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRIAAQV 449
           R+ V PSHF R S S A + LQ+LE LK+VEK QDGGR L  QG+RDLDRIA QV
Sbjct: 207 RHRVRPSHFSRGSKSAACRVLQALEGLKMVEKDQDGGRKLIPQGQRDLDRIARQV 261



 Score = 52.0 bits (119), Expect = 8e-06
 Identities = 23/39 (58%), Positives = 31/39 (79%)
 Frame = +2

Query: 65  QDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPY+
Sbjct: 156 QQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYE 194


>UniRef50_A0CH22 Cluster: Chromosome undetermined scaffold_18, whole
           genome shotgun sequence; n=8; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_18,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 197

 Score = 70.1 bits (164), Expect = 3e-11
 Identities = 40/94 (42%), Positives = 56/94 (59%), Gaps = 5/94 (5%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W YVR AA+ R IY+R   GV  +T +FG    NG   S     SG + R  LQ LE +K
Sbjct: 104 WMYVRAAALARKIYVRGHWGVGNLTHMFGSVNDNGKHES----GSGKVIRYLLQQLETIK 159

Query: 369 LVEK-----VQDGGRILTTQGRRDLDRIAAQVRL 455
           +++K     ++ G RI+T +G++DL+RIA QV L
Sbjct: 160 VLKKDNKSLLKKGSRIVTKEGQQDLNRIATQVAL 193



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           TVKDV     ++  A +LKK  K+K+PE   +VKT   KE +P D
Sbjct: 57  TVKDVPAQDFIRGYAEYLKKNNKIKIPEWASIVKTGLGKETSPID 101


>UniRef50_UPI00006D00E1 Cluster: Ribosomal protein S19e containing
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ribosomal protein S19e containing protein - Tetrahymena
           thermophila SB210
          Length = 155

 Score = 65.3 bits (152), Expect = 8e-10
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W Y+R AA+ R +Y++   G+ T+  IFG  K  G   +      G I R AL+SLE LK
Sbjct: 56  WVYIRTAALARKVYLKPHTGISTLKHIFGSNKDRGNLRNKHQACHGKILRWALKSLEDLK 115

Query: 369 LVEKVQDG-----GRILTTQGRRDLDRIAAQVRL 455
           ++ K ++       R++T +G  +L+RIA Q+ +
Sbjct: 116 IIRKDKNSATKKFSRVITKEGMTELNRIATQIAI 149



 Score = 41.5 bits (93), Expect = 0.012
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +2

Query: 47  TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           TVKDV     ++  A+HLKK  K+ +PE      T+  +ELAP D
Sbjct: 9   TVKDVAAADFIREYASHLKKANKLSIPEFTQWTTTSVARELAPQD 53


>UniRef50_Q7RHC7 Cluster: Ribosomal protein S19e, putative; n=5;
           Plasmodium|Rep: Ribosomal protein S19e, putative -
           Plasmodium yoelii yoelii
          Length = 193

 Score = 64.5 bits (150), Expect = 1e-09
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W++++ ++ILR +YI   +GV  + + F  ++R GV P+H   +SG I R  LQ LE + 
Sbjct: 96  WYFIKTSSILRRLYIHPDIGVGFLRRQFSYKQRRGVAPNHTSLASGKILRSILQQLENIG 155

Query: 369 LVEK-VQDGGRILTTQGRRDLDRIAAQV 449
            VE+  +  GR LTT+G   ++  A  +
Sbjct: 156 YVEQNPKKKGRRLTTKGENAINNFARYI 183



 Score = 35.9 bits (79), Expect = 0.58
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +2

Query: 50  VKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           +KDV+ +  +   A +LK   K+  P+  + VKT + ++LAP D
Sbjct: 50  IKDVDAELFISAYAKYLKLHNKITFPKWCNFVKTGKGRKLAPLD 93


>UniRef50_Q97CU4 Cluster: 30S ribosomal protein S19e; n=4;
           Thermoplasmatales|Rep: 30S ribosomal protein S19e -
           Thermoplasma volcanium
          Length = 150

 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W YVR A++LR +YI   +G+  ++  +GG+   G    H    S SI R     LE+  
Sbjct: 50  WIYVRAASMLRKLYINGYLGISRMSSEYGGKVDRGSKRYHAASGSRSITRFLFHELESAG 109

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LV+K Q  GR L+ QG   LD  + ++
Sbjct: 110 LVQKTQK-GRSLSPQGMSLLDNASKEI 135



 Score = 33.1 bits (72), Expect = 4.1
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +2

Query: 44  VTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAP 175
           V+VK V  D ++  V+  LK+  K+K P  +  VKT   KE  P
Sbjct: 2   VSVKYVPSDMLINYVSGKLKEEKKIKEPNWVKFVKTGVSKEKPP 45


>UniRef50_A2EN51 Cluster: Ribosomal protein S19e, putative; n=4;
           Trichomonas vaginalis G3|Rep: Ribosomal protein S19e,
           putative - Trichomonas vaginalis G3
          Length = 148

 Score = 55.2 bits (127), Expect = 9e-07
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W+Y+R AA+ R IY+     +  +   +G   +    P H   +S  + R  LQ LE   
Sbjct: 59  WWYIRAAAVTRQIYLHHDASLSGLAFHYGANMKAVTMPKHHHEASRKVIRTILQQLEKAG 118

Query: 369 LVEKVQDGGRILTTQGRRDLDRIA 440
           LV +V + GR LT +G++ LD+IA
Sbjct: 119 LV-RVAEKGRQLTPKGQKLLDQIA 141



 Score = 39.1 bits (87), Expect = 0.062
 Identities = 17/41 (41%), Positives = 26/41 (63%)
 Frame = +2

Query: 53  KDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAP 175
           +++  D +V  +A H + T  ++ PE  DLVKTA  K+LAP
Sbjct: 14  REIAADVLVNALAKHYQDTQVIRNPEWADLVKTASLKQLAP 54


>UniRef50_A7D1C3 Cluster: Ribosomal protein S19e; n=1; Halorubrum
           lacusprofundi ATCC 49239|Rep: Ribosomal protein S19e -
           Halorubrum lacusprofundi ATCC 49239
          Length = 163

 Score = 46.8 bits (106), Expect = 3e-04
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRN----GVTPSHFCRSSGSIARKALQSL 356
           ++YVR A++LR +    P+G++ +   +G +KR      V P      S  + R +LQ+L
Sbjct: 60  FWYVRSASLLRKVAQNEPIGIERLATEYGSKKRGSNRYSVRPGEHEGGSRKLIRASLQAL 119

Query: 357 EALKLVEKVQDGGRILTTQGRRDLDRIAAQV 449
           E   LV      GR ++  G   L  +AA V
Sbjct: 120 EEDGLVTTAAGEGRRISDDGEAFLSEVAADV 150


>UniRef50_UPI00001CA3A8 Cluster: PREDICTED: similar to 40S ribosomal
           protein S19; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to 40S ribosomal protein S19 - Rattus norvegicus
          Length = 131

 Score = 46.0 bits (104), Expect = 5e-04
 Identities = 20/31 (64%), Positives = 25/31 (80%)
 Frame = +3

Query: 276 GRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           GR+RNGV PSHF R S ++AR+ LQ+LE LK
Sbjct: 77  GRQRNGVRPSHFNRGSKTVARRVLQALEGLK 107


>UniRef50_Q9AW29 Cluster: 40S ribosomal protein S19; n=1; Guillardia
           theta|Rep: 40S ribosomal protein S19 - Guillardia theta
           (Cryptomonas phi)
          Length = 143

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/81 (27%), Positives = 45/81 (55%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           W + R A+I+   YI   +G + + +I+ G+K+     S     SG I R +++ LE +K
Sbjct: 51  WIFKRMASIIIKFYIYKKLGTRQLVRIYNGKKKG--RRSKKTNGSGKIIRFSIKELEKMK 108

Query: 369 LVEKVQDGGRILTTQGRRDLD 431
           +++K + G   L+ + + ++D
Sbjct: 109 ILKKDESGRFGLSKKAQNEID 129



 Score = 33.5 bits (73), Expect = 3.1
 Identities = 11/42 (26%), Positives = 27/42 (64%)
 Frame = +2

Query: 50  VKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAP 175
           +KD+ +D  +   A  L+K+G++ +P  +++ K++  K+ +P
Sbjct: 5   LKDIPKDVFINYYAEFLEKSGQINIPSWIEICKSSSLKKYSP 46


>UniRef50_Q5H6B5 Cluster: Putative uncharacterized protein; n=1;
           Xanthomonas oryzae pv. oryzae|Rep: Putative
           uncharacterized protein - Xanthomonas oryzae pv. oryzae
          Length = 390

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
 Frame = +1

Query: 265 RSLVGA-NVMELHLHISAGHQAVLHARLCNRWRH 363
           R+L GA   +E H   +AG +  +HAR+  RWRH
Sbjct: 190 RALAGAAGAVEQHRRQAAGQRIFMHARIAQRWRH 223


>UniRef50_Q4P756 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 350

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 22/72 (30%), Positives = 31/72 (43%)
 Frame = +2

Query: 11  FRLPTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPXL 190
           ++L  Q   R + +  VE    +   A H K   K+ +      V    FK+  PY P  
Sbjct: 87  YQLNVQDAERDLLIPAVEGTLNLLRFAKHEKSVKKIVITSSFAAV--TNFKDGGPYRPGF 144

Query: 191 VLCALCCHPSSY 226
           V  A C +PSSY
Sbjct: 145 VYTADCWNPSSY 156


>UniRef50_UPI0000E22B1D Cluster: PREDICTED: hypothetical protein
           isoform 1; n=2; Pan troglodytes|Rep: PREDICTED:
           hypothetical protein isoform 1 - Pan troglodytes
          Length = 180

 Score = 33.5 bits (73), Expect = 3.1
 Identities = 23/83 (27%), Positives = 42/83 (50%)
 Frame = -1

Query: 437 DSVKVSSTLCGENATTVLNFLNKLQCLQRLQSLACNTA**PAEM*RCNSITFAPTKDLGD 258
           DSV++S +L  + A  +L   +  Q LQ L+  A +T    AE+   ++++     DLG 
Sbjct: 24  DSVQISLSLRCQFAAAILVLFHHFQPLQGLEDPAGHTLGASAEVAGHDAVSLTSPIDLGH 83

Query: 257 SLYSNR*ANVNMTKDGSTTHIEP 189
               +    V + + GS++ +EP
Sbjct: 84  GANPSATPEVQVPRCGSSSRVEP 106


>UniRef50_Q66KP5 Cluster: LOC446927 protein; n=3; Xenopus|Rep:
           LOC446927 protein - Xenopus laevis (African clawed frog)
          Length = 353

 Score = 33.1 bits (72), Expect = 4.1
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 2/70 (2%)
 Frame = +2

Query: 200 ALCCHPSSYLH-SLTCWSKDCHQDLWWAQT*WSYTFT-FLQVIRQYCTQGFAIVGGIEAC 373
           A+C     ++H SL+C  + C           +Y    F  V+R  C +GF ++G   + 
Sbjct: 70  AVCSSAGIWIHASLSCARRQCSLSDTLENGDITYENNKFQNVVRFSCKEGFVLIGANSST 129

Query: 374 *ESSGRWSHS 403
              SG+W+ S
Sbjct: 130 CNESGKWNES 139


>UniRef50_Q874V5 Cluster: Putative uncharacterized protein Pa5D0093;
           n=1; Podospora anserina|Rep: Putative uncharacterized
           protein Pa5D0093 - Podospora anserina
          Length = 592

 Score = 31.9 bits (69), Expect = 9.4
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +2

Query: 65  QDKIVKTVAAHLKKT--GKVKVPEHMDLVKTARFKELAPYDPXLVLCALCCHPSSYLHSL 238
           +D+++  V+  +K +   K  + +  D VK+ RF  L PYD  L+    C  P   L SL
Sbjct: 422 RDQVLALVSNAIKTSQDSKYLLDDLTDKVKSDRFNML-PYD--LIHIISCLLPDRDLFSL 478

Query: 239 TCWSKDCHQDLWWAQT*WSY 298
            C S   H++L   +  W Y
Sbjct: 479 CCASYIVHKNLEENENFWRY 498


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 498,457,091
Number of Sequences: 1657284
Number of extensions: 9513760
Number of successful extensions: 23458
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 22769
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23442
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 33455602480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -