SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000DB7531 Cluster: PREDICTED: similar to CG15387-PA...   125   7e-28
UniRef50_UPI0000D56E7A Cluster: PREDICTED: similar to CG15387-PA...   114   1e-24
UniRef50_Q9VQ92 Cluster: CG15387-PA; n=4; Diptera|Rep: CG15387-P...   111   1e-23
UniRef50_Q6TH01 Cluster: Protein C10; n=5; Euteleostomi|Rep: Pro...   100   2e-20
UniRef50_UPI0000E498C5 Cluster: PREDICTED: similar to MGC76235 p...    94   2e-18
UniRef50_Q99622 Cluster: Protein C10; n=13; Tetrapoda|Rep: Prote...    93   5e-18
UniRef50_A7SH80 Cluster: Predicted protein; n=1; Nematostella ve...    68   1e-10
UniRef50_UPI0000D9CB06 Cluster: PREDICTED: similar to C10 protei...    40   0.034
UniRef50_Q8YA30 Cluster: Lmo0335 protein; n=18; Listeria|Rep: Lm...    35   1.3  
UniRef50_A4S0E5 Cluster: Predicted protein; n=2; Ostreococcus|Re...    34   2.9  
UniRef50_Q5BIM0 Cluster: UT01249p; n=3; Sophophora|Rep: UT01249p...    33   5.1  
UniRef50_Q3W7T4 Cluster: Transposase IS116/IS110/IS902; n=1; Fra...    33   6.8  
UniRef50_Q4RN13 Cluster: Chromosome 6 SCAF15017, whole genome sh...    32   9.0  

>UniRef50_UPI0000DB7531 Cluster: PREDICTED: similar to CG15387-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG15387-PA - Apis mellifera
          Length = 119

 Score =  125 bits (302), Expect = 7e-28
 Identities = 59/103 (57%), Positives = 82/103 (79%)
 Frame = +1

Query: 163 RQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSRE 342
           + +L +I+ AL +P+   KL EAKE +GNEMLKMMQ VFP+VVQIEM+ IK++GF+ SRE
Sbjct: 13  KAVLTDILTALNTPENTQKLTEAKENSGNEMLKMMQFVFPIVVQIEMDVIKNYGFSESRE 72

Query: 343 GIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTS 471
           G VQF +L+R LE  D EVA+LH+Q+RS++LPPV ++S ++ S
Sbjct: 73  GTVQFVKLLRTLEREDPEVAQLHSQVRSYFLPPV-LNSHINCS 114


>UniRef50_UPI0000D56E7A Cluster: PREDICTED: similar to CG15387-PA;
           n=2; Endopterygota|Rep: PREDICTED: similar to CG15387-PA
           - Tribolium castaneum
          Length = 124

 Score =  114 bits (275), Expect = 1e-24
 Identities = 49/97 (50%), Positives = 74/97 (76%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           +IL + ++ L++P    KLDEAK+  GNEMLKMMQ +FP+V+Q++M+ IK  GF   R+G
Sbjct: 17  EILGKTLEELQTPQNVKKLDEAKDNVGNEMLKMMQFLFPIVMQVQMDVIKEFGFPGGRDG 76

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSISS 456
           I++F Q++R LE  D EVARL+  I+++YLPPVS+++
Sbjct: 77  IIKFAQMLRSLEREDAEVARLNALIKAYYLPPVSVNT 113


>UniRef50_Q9VQ92 Cluster: CG15387-PA; n=4; Diptera|Rep: CG15387-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 100

 Score =  111 bits (267), Expect = 1e-23
 Identities = 50/96 (52%), Positives = 74/96 (77%)
 Frame = +1

Query: 178 EIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQF 357
           +II  +  P+ + KL EAK +AG EM+ MMQ VFP+V+Q+++E IK HGF  +REG+VQF
Sbjct: 2   DIIRCVNQPENSKKLSEAKASAGKEMILMMQHVFPLVMQLQLEVIKGHGFPGNREGLVQF 61

Query: 358 TQLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVD 465
           +QLIR++E  D E+ RL +QIR+ YLPP++I+++ D
Sbjct: 62  SQLIREMERDDMEIVRLRSQIRAIYLPPIAINTTND 97


>UniRef50_Q6TH01 Cluster: Protein C10; n=5; Euteleostomi|Rep:
           Protein C10 - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 122

 Score =  100 bits (240), Expect = 2e-20
 Identities = 46/113 (40%), Positives = 80/113 (70%), Gaps = 3/113 (2%)
 Frame = +1

Query: 142 SVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHH 321
           +++V+Q R +L+E+I A   P+ A++++EA+E+A N+M KM+Q+V P+  QI+ E IK +
Sbjct: 10  TLTVEQARVVLSEVIQAFSVPENAARMEEARESACNDMGKMLQLVLPVATQIQQEVIKAY 69

Query: 322 GFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVS---ISSSVDTS 471
           GFNN  EG+++F +L++  E+ D E+A +  +++S  LPP+S   I S + TS
Sbjct: 70  GFNNEGEGVLKFARLVKMYETQDPEIAAMSVKLKSLLLPPLSTPPIGSGIPTS 122


>UniRef50_UPI0000E498C5 Cluster: PREDICTED: similar to MGC76235
           protein; n=6; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC76235 protein -
           Strongylocentrotus purpuratus
          Length = 243

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 40/91 (43%), Positives = 63/91 (69%)
 Frame = +1

Query: 172 LNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIV 351
           L +++DA  SP+  + +D+ KEAAGN+M+ MM +VFP   QI+ME I+ +GF    EG +
Sbjct: 11  LRDVLDAFLSPENKALMDKQKEAAGNDMMHMMHLVFPAATQIQMEAIQKYGFTPDGEGAI 70

Query: 352 QFTQLIRDLESIDGEVARLHTQIRSHYLPPV 444
           +F Q +R  ES D EVA + ++++S +LPP+
Sbjct: 71  KFAQTVRQYESADNEVAEMASRLKSMFLPPL 101


>UniRef50_Q99622 Cluster: Protein C10; n=13; Tetrapoda|Rep: Protein
           C10 - Homo sapiens (Human)
          Length = 126

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 39/107 (36%), Positives = 74/107 (69%)
 Frame = +1

Query: 130 SSPQSVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMET 309
           + P ++S +Q + +L E+I A  +P+ A ++DEA++ A N+M KM+Q V P+  QI+ E 
Sbjct: 6   TQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEV 65

Query: 310 IKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSI 450
           IK +GF+   EG+++F +L++  E+ D E+A L  ++++ +LPP+++
Sbjct: 66  IKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTL 112


>UniRef50_A7SH80 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 122

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 29/103 (28%), Positives = 61/103 (59%)
 Frame = +1

Query: 142 SVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHH 321
           S++ +Q++ IL E++ A + P+   K++   +++G  ++ +M  + P    I+   I+ H
Sbjct: 9   SLTSEQIKCILREVLSAFDEPENKVKMEVIFDSSGANLVALMHQLVPAAAAIQRNVIQAH 68

Query: 322 GFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSI 450
           GF +S EG+++FTQ++      D EV  L  Q+R+ ++P + +
Sbjct: 69  GFPSSDEGVLRFTQMVNFFAKDDPEVETLANQLRTKFIPQMPV 111


>UniRef50_UPI0000D9CB06 Cluster: PREDICTED: similar to C10 protein
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: similar
           to C10 protein isoform 1 - Macaca mulatta
          Length = 97

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)
 Frame = +1

Query: 130 SSPQSVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEM--LKMMQIV 276
           S P ++S +Q + +L E+I A  +P+ A ++DEA++ A N+M  LK  ++V
Sbjct: 6   SQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGVLKFARLV 56



 Score = 33.9 bits (74), Expect = 2.9
 Identities = 13/52 (25%), Positives = 34/52 (65%)
 Frame = +1

Query: 295 IEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSI 450
           + M+  + +  N+   G+++F +L++  E+ D E+A L  ++++ +LPP+++
Sbjct: 34  VRMDEARDNACNDM--GVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTL 83


>UniRef50_Q8YA30 Cluster: Lmo0335 protein; n=18; Listeria|Rep:
           Lmo0335 protein - Listeria monocytogenes
          Length = 94

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 18/65 (27%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
 Frame = +1

Query: 112 IRN*NMSSPQSVSVDQMRQILNEIIDALESPDYASKLDEAK-EAAGNEMLKMMQIVFPMV 288
           ++N NM+  ++ S+DQ+R  L E++D +E   + +K D ++ +  G    K  Q++   +
Sbjct: 29  LKNGNMAYSKANSIDQLRSALIELVDVVEDFQHVTKKDASRLKKMGIAYAKQDQLMGQKI 88

Query: 289 VQIEM 303
            Q+E+
Sbjct: 89  NQLEV 93


>UniRef50_A4S0E5 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 816

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 11/30 (36%), Positives = 22/30 (73%)
 Frame = +1

Query: 334 SREGIVQFTQLIRDLESIDGEVARLHTQIR 423
           SREG+ +  + ++++E ++G V RLH ++R
Sbjct: 95  SREGVARVPKAVKEIEVVEGRVKRLHEEVR 124


>UniRef50_Q5BIM0 Cluster: UT01249p; n=3; Sophophora|Rep: UT01249p -
           Drosophila melanogaster (Fruit fly)
          Length = 1072

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 18/71 (25%), Positives = 40/71 (56%)
 Frame = +1

Query: 253 MLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHY 432
           ML+++  +  + V+ + ET++H+ F + R+ +VQ  + ++ LES   + ++    + SH 
Sbjct: 464 MLRLVSEMRRLRVECDEETLRHYLFPHLRQTLVQPLEAVKALESAGVKPSQTLCPVVSHL 523

Query: 433 LPPVSISSSVD 465
           L    +S  +D
Sbjct: 524 LQQHQMSEVLD 534


>UniRef50_Q3W7T4 Cluster: Transposase IS116/IS110/IS902; n=1;
           Frankia sp. EAN1pec|Rep: Transposase IS116/IS110/IS902 -
           Frankia sp. EAN1pec
          Length = 298

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = +1

Query: 355 FTQLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTSL*NSIKGKTWNSSTVNGVLRF 534
           F QL+RDL + D E+ARL     +  L  V     V  S   +  G  W  +  +   R+
Sbjct: 125 FEQLLRDLANCDQELARLLPLTPAAVLATVPGVGVVTASYYGAALGDPWRFANADAAYRY 184

Query: 535 SKLA 546
           S LA
Sbjct: 185 SGLA 188


>UniRef50_Q4RN13 Cluster: Chromosome 6 SCAF15017, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 6
           SCAF15017, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 580

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 4/72 (5%)
 Frame = +1

Query: 286 VVQIEMETIKHHGFNNSREGIVQFTQLIR--DLESIDGEVARL-HT-QIRSHYLPPVSIS 453
           VV  E   +  HG    R  + Q TQL     LE    E  RL H  Q++S  LP  S+ 
Sbjct: 460 VVSHEHNCVSEHGSGLDRSVLAQLTQLYMTVKLECPFYEGPRLPHKYQVKSFLLPGRSLE 519

Query: 454 SSVDTSL*NSIK 489
           + VD  L NS+K
Sbjct: 520 TPVDPHLYNSVK 531


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 559,831,040
Number of Sequences: 1657284
Number of extensions: 10776919
Number of successful extensions: 27632
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 26356
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27609
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42317807226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -