SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P49207 Cluster: 60S ribosomal protein L34; n=62; Fungi/...   130   2e-29
UniRef50_P87262 Cluster: 60S ribosomal protein L34-A; n=55; Euka...   122   6e-27
UniRef50_Q42351 Cluster: 60S ribosomal protein L34-1; n=29; Euka...   119   3e-26
UniRef50_A7AVD9 Cluster: Ribosomal protein L34, putative; n=1; B...   119   4e-26
UniRef50_Q5CVM8 Cluster: 60S ribosomal protein L34; n=2; Cryptos...   116   2e-25
UniRef50_Q4WI54 Cluster: Ribosomal protein L34 protein, putative...   113   2e-24
UniRef50_Q4MZM9 Cluster: 60S ribosomal protein L34a, putative; n...   112   3e-24
UniRef50_Q7RF49 Cluster: Ribosomal protein L34e, putative; n=5; ...   111   1e-23
UniRef50_Q6E6C0 Cluster: Large subunit ribosomal protein L34e; n...   109   3e-23
UniRef50_UPI000049A50B Cluster: 60S ribosomal protein L34; n=3; ...   103   2e-21
UniRef50_A0D0J3 Cluster: Chromosome undetermined scaffold_33, wh...    97   1e-19
UniRef50_Q8SSA2 Cluster: 60S ribosomal protein L34; n=1; Encepha...    86   5e-16
UniRef50_Q17JY6 Cluster: Ribosomal protein L34, putative; n=1; A...    82   6e-15
UniRef50_A2DT99 Cluster: Ribosomal protein L34e, putative; n=3; ...    79   7e-14
UniRef50_Q4Q141 Cluster: 60S ribosomal protein L34, putative; n=...    77   3e-13
UniRef50_Q8TZB2 Cluster: 50S ribosomal protein L34e; n=3; Archae...    63   3e-09
UniRef50_O14396 Cluster: Putative uncharacterized protein; n=1; ...    61   1e-08
UniRef50_Q9UZJ7 Cluster: 50S ribosomal protein L34e; n=8; Archae...    60   3e-08
UniRef50_A1RXV1 Cluster: Ribosomal protein L34e; n=1; Thermofilu...    59   5e-08
UniRef50_O26137 Cluster: 50S ribosomal protein L34e; n=3; Methan...    57   2e-07
UniRef50_P58026 Cluster: 50S ribosomal protein L34e; n=4; Thermo...    57   2e-07
UniRef50_Q6LZK0 Cluster: Ribosomal protein L34e; n=5; Methanococ...    54   2e-06
UniRef50_Q3LW25 Cluster: Ribosomal protein L34; n=1; Bigelowiell...    49   6e-05
UniRef50_Q74NH0 Cluster: NEQ297; n=1; Nanoarchaeum equitans|Rep:...    48   1e-04
UniRef50_Q8ZTJ2 Cluster: 50S ribosomal protein L34e; n=3; Pyroba...    44   0.002
UniRef50_Q98SA5 Cluster: 60S ribosomal protein L34; n=1; Guillar...    43   0.004
UniRef50_Q975K6 Cluster: 50S ribosomal protein L34e; n=2; Sulfol...    41   0.013
UniRef50_UPI0000E4799B Cluster: PREDICTED: similar to zinc trans...    33   4.5  
UniRef50_A1IBG0 Cluster: Glycosyltransferases involved in cell w...    32   6.0  
UniRef50_UPI00003AD95B Cluster: PREDICTED: hypothetical protein;...    32   7.9  
UniRef50_Q9WY78 Cluster: UDP-N-acetylmuramoylalanyl-D-glutamyl-2...    32   7.9  
UniRef50_Q7P5Y3 Cluster: Chromosomal replication initiator prote...    32   7.9  
UniRef50_A2EX93 Cluster: Putative uncharacterized protein; n=1; ...    32   7.9  

>UniRef50_P49207 Cluster: 60S ribosomal protein L34; n=62;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L34 -
           Homo sapiens (Human)
          Length = 117

 Score =  130 bits (313), Expect = 2e-29
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>UniRef50_P87262 Cluster: 60S ribosomal protein L34-A; n=55;
           Eukaryota|Rep: 60S ribosomal protein L34-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 121

 Score =  122 bits (293), Expect = 6e-27
 Identities = 58/102 (56%), Positives = 72/102 (70%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           M QR+TFRRR  YNT+SN+ ++V+TPGG L  Q+VKK    P+CG C S L+GI   RP 
Sbjct: 1   MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           + + +    KTV R YGG  C  CVK+RI+RAFLIEEQKIVK
Sbjct: 61  QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIVK 102


>UniRef50_Q42351 Cluster: 60S ribosomal protein L34-1; n=29;
           Eukaryota|Rep: 60S ribosomal protein L34-1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 120

 Score =  119 bits (287), Expect = 3e-26
 Identities = 60/104 (57%), Positives = 74/104 (71%), Gaps = 2/104 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRL +R R SY TKSNQ RIV+TPGG+LVYQ  KK    P+C     +++GI   RP+
Sbjct: 1   MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS 60

Query: 211 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           E  RSRL   ++TV R YGGVL    V++RI+RAFL+EEQKIVK
Sbjct: 61  EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104


>UniRef50_A7AVD9 Cluster: Ribosomal protein L34, putative; n=1;
           Babesia bovis|Rep: Ribosomal protein L34, putative -
           Babesia bovis
          Length = 157

 Score =  119 bits (286), Expect = 4e-26
 Identities = 58/102 (56%), Positives = 69/102 (67%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQR+  RR   YNT+SN++R V+TPGGRLV Q   K  + P+CG CK KL GI   RP 
Sbjct: 1   MVQRVVLRRHCRYNTRSNKQRKVKTPGGRLVVQRRVKVAQGPKCGDCKCKLAGIPALRPH 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
               L  R++ V R YGGV CHKCVK RI+RAFL EEQK +K
Sbjct: 61  LYRNLKKRERRVSRAYGGVRCHKCVKDRIIRAFLKEEQKALK 102


>UniRef50_Q5CVM8 Cluster: 60S ribosomal protein L34; n=2;
           Cryptosporidium|Rep: 60S ribosomal protein L34 -
           Cryptosporidium parvum Iowa II
          Length = 138

 Score =  116 bits (280), Expect = 2e-25
 Identities = 54/103 (52%), Positives = 69/103 (66%)
 Frame = +1

Query: 28  KMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARP 207
           KM  R+T+RR+  YNT SN+ R+V+TPGGR + Q + K    P+CG CK  L GI    P
Sbjct: 3   KMSPRVTYRRKCRYNTPSNRVRVVKTPGGRNLIQNIGKVYSRPKCGDCKKPLAGIPACAP 62

Query: 208 AERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
            E   L  R++TV R YGG  C  CV+QRI+RAFL+EEQK+VK
Sbjct: 63  YEMKHLKKRERTVARAYGGTKCPTCVRQRILRAFLLEEQKVVK 105


>UniRef50_Q4WI54 Cluster: Ribosomal protein L34 protein, putative;
           n=10; Eukaryota|Rep: Ribosomal protein L34 protein,
           putative - Aspergillus fumigatus (Sartorya fumigata)
          Length = 192

 Score =  113 bits (273), Expect = 2e-24
 Identities = 57/101 (56%), Positives = 67/101 (66%)
 Frame = +1

Query: 34  VQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAE 213
           + R  F R   YNT+SN+ RI++TPGG L Y ++KK    P+CG C  KL GI   RP E
Sbjct: 81  IDRFLFYR---YNTRSNKVRIIKTPGGELRYLHIKKKGTAPKCGDCGIKLPGIPALRPRE 137

Query: 214 RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
            S++   KKTV R YGG  C  CVK RIVRAFLIEEQKIVK
Sbjct: 138 YSQISRPKKTVSRAYGGSRCAGCVKDRIVRAFLIEEQKIVK 178


>UniRef50_Q4MZM9 Cluster: 60S ribosomal protein L34a, putative; n=4;
           Eukaryota|Rep: 60S ribosomal protein L34a, putative -
           Theileria parva
          Length = 138

 Score =  112 bits (270), Expect = 3e-24
 Identities = 56/102 (54%), Positives = 64/102 (62%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQR+ +RRR  Y T SN  + VRTPG RLV   +KK  K PRCG CK  L G+   RP 
Sbjct: 1   MVQRVHYRRRNKYKTPSNVVKRVRTPGARLVLHNLKKVGKRPRCGDCKRTLAGVSAVRPF 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
               L  R +TV R YGG  CH CVK RI+RAFL EEQK V+
Sbjct: 61  LYKNLKRRNRTVSRPYGGSRCHNCVKDRIIRAFLKEEQKCVR 102


>UniRef50_Q7RF49 Cluster: Ribosomal protein L34e, putative; n=5;
           Plasmodium|Rep: Ribosomal protein L34e, putative -
           Plasmodium yoelii yoelii
          Length = 164

 Score =  111 bits (266), Expect = 1e-23
 Identities = 48/102 (47%), Positives = 68/102 (66%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           M QR+ +R+   YNTKSN+ R +RTPGG+L    +KK    P+C  CK+ ++G++  RPA
Sbjct: 1   MAQRVHYRKHNHYNTKSNKVRPIRTPGGKLTIHVIKKKAGKPKCADCKNPIQGVKALRPA 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           +  R   + + V R YGG +C KC K+RI+RAFL EEQK V+
Sbjct: 61  DNQRARKKDRKVSRAYGGSICAKCXKERIMRAFLFEEQKCVR 102


>UniRef50_Q6E6C0 Cluster: Large subunit ribosomal protein L34e; n=1;
           Antonospora locustae|Rep: Large subunit ribosomal
           protein L34e - Antonospora locustae (Nosema locustae)
          Length = 113

 Score =  109 bits (262), Expect = 3e-23
 Identities = 52/101 (51%), Positives = 70/101 (69%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQ LT R R +YN  SNQ++I RTPG R VY   KKP ++P+C +C+SKLRGI   RPA
Sbjct: 1   MVQHLTHRGRRTYNNASNQKKIRRTPGNRRVYIPKKKPGRVPKCVKCRSKLRGIDICRPA 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIV 333
             +RL   ++TV R YGG LC  C++ RI+ AFL  E++++
Sbjct: 61  AFARLRKSQRTVARTYGGNLCGSCLENRILDAFLSAEEQLL 101


>UniRef50_UPI000049A50B Cluster: 60S ribosomal protein L34; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal
           protein L34 - Entamoeba histolytica HM-1:IMSS
          Length = 137

 Score =  103 bits (247), Expect = 2e-21
 Identities = 50/103 (48%), Positives = 67/103 (65%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           M  R+T+ R+ SYNTKSN  RIV+T GG +  Q+ +K     RCG C   L GI+  RP 
Sbjct: 1   MAVRVTYVRKHSYNTKSNGIRIVKTAGGNMTVQHRQKISNGVRCGDCGCVLAGIRHIRPH 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKV 339
           +   L   K+TV R YGGV CHKCV+++I+RAFLI E  ++K+
Sbjct: 61  QYGWLGKSKRTVTRAYGGVRCHKCVQKKILRAFLINEHNLIKL 103


>UniRef50_A0D0J3 Cluster: Chromosome undetermined scaffold_33, whole
           genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_33,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 108

 Score = 97.5 bits (232), Expect = 1e-19
 Identities = 49/101 (48%), Positives = 64/101 (63%), Gaps = 2/101 (1%)
 Frame = +1

Query: 40  RLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSK--LRGIQPARPAE 213
           R+T+RRR SYNT+SN+ R V+TPGG +V QY  K      C        L G++  RP +
Sbjct: 4   RITYRRRTSYNTRSNKIRKVKTPGGNVVVQYPNKKTSASTCADSNLNVVLNGLKRIRPTK 63

Query: 214 RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
             +L  R++TV R YGGVL    +K RI+RAFL+EE KIVK
Sbjct: 64  LKQLARRQRTVSRPYGGVLSAGALKNRIIRAFLVEEVKIVK 104


>UniRef50_Q8SSA2 Cluster: 60S ribosomal protein L34; n=1;
           Encephalitozoon cuniculi|Rep: 60S ribosomal protein L34
           - Encephalitozoon cuniculi
          Length = 110

 Score = 85.8 bits (203), Expect = 5e-16
 Identities = 42/100 (42%), Positives = 61/100 (61%)
 Frame = +1

Query: 34  VQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAE 213
           ++ +   +  +Y T+SN+RR VRTP G+LV + VKK  K  RC +C + L  I   RPAE
Sbjct: 1   MKNVLIHKGATYKTRSNRRRKVRTPSGKLVNRRVKKHSKKHRCHECNAILGSIARMRPAE 60

Query: 214 RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIV 333
            SR     + V R YG   C +CV+++I+ AFL  E++IV
Sbjct: 61  FSRQKVSARRVNRPYGATTCGRCVREKIISAFLGNEERIV 100


>UniRef50_Q17JY6 Cluster: Ribosomal protein L34, putative; n=1;
           Aedes aegypti|Rep: Ribosomal protein L34, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 123

 Score = 82.2 bits (194), Expect = 6e-15
 Identities = 46/96 (47%), Positives = 65/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query: 58  RLSYNTKSNQRRIVRTPGG-RLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYR 234
           ++SYNT  N+RR+VRT G  RLVY ++KK + + +C QCK +    Q +       +C  
Sbjct: 9   KMSYNT--NKRRVVRTLGSDRLVYLFIKKQRIVSKCCQCKGEAVRNQAS---VHVCMCRC 63

Query: 235 KKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
            KTV R +GGV+CH+   +RI+RAFLI+EQK+VKVL
Sbjct: 64  LKTVIRTFGGVICHR---ERIIRAFLIDEQKVVKVL 96


>UniRef50_A2DT99 Cluster: Ribosomal protein L34e, putative; n=3;
           Trichomonas vaginalis G3|Rep: Ribosomal protein L34e,
           putative - Trichomonas vaginalis G3
          Length = 116

 Score = 78.6 bits (185), Expect = 7e-14
 Identities = 38/94 (40%), Positives = 54/94 (57%)
 Frame = +1

Query: 40  RLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERS 219
           R T RR L ++T  N+   VRTPG +LV  Y+ K +  P C +   ++ GI+  +  E  
Sbjct: 5   RYTLRRSLGFHTIRNRVAPVRTPGNKLVAHYIAKRQNGPHCAETGKRINGIKCVKTCELR 64

Query: 220 RLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEE 321
           R+   ++TV R YGGV C   VK RI+ AF+ EE
Sbjct: 65  RMKKNQRTVSRPYGGVYCGAVVKDRIINAFMEEE 98


>UniRef50_Q4Q141 Cluster: 60S ribosomal protein L34, putative; n=10;
           Trypanosomatidae|Rep: 60S ribosomal protein L34,
           putative - Leishmania major
          Length = 168

 Score = 76.6 bits (180), Expect = 3e-13
 Identities = 45/101 (44%), Positives = 62/101 (61%), Gaps = 2/101 (1%)
 Frame = +1

Query: 40  RLTFRRRLSYNTKSNQRRIVRTPGGRLVYQY-VKKPKKIPRCGQCKSKLRGIQPARPAER 216
           R+ +RRR+ Y T+ N+ ++VRTPG +LV Q   K+ + I        K  G   A     
Sbjct: 5   RVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHTPWVLGHKRLGGTKALRHID 64

Query: 217 SRLCYR-KKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           +RL  R +K+V R YGGVL H  V+ R+VRAFL+EEQ+IVK
Sbjct: 65  ARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQRIVK 105


>UniRef50_Q8TZB2 Cluster: 50S ribosomal protein L34e; n=3;
           Archaea|Rep: 50S ribosomal protein L34e - Methanopyrus
           kandleri
          Length = 113

 Score = 63.3 bits (147), Expect = 3e-09
 Identities = 30/77 (38%), Positives = 41/77 (53%)
 Frame = +1

Query: 67  YNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRKKTV 246
           Y ++S +R   RTPGGR V  + KK    P+CG C  +L G+   R  E       +K  
Sbjct: 6   YRSRSCRRVYKRTPGGRTVIHFEKKIPNWPKCGACGRRLNGVMRGRNVELKNAPKTQKRP 65

Query: 247 KRVYGGVLCHKCVKQRI 297
            R YGGVLC +C ++ I
Sbjct: 66  NRPYGGVLCPECARKLI 82


>UniRef50_O14396 Cluster: Putative uncharacterized protein; n=1;
           Schizosaccharomyces pombe|Rep: Putative uncharacterized
           protein - Schizosaccharomyces pombe (Fission yeast)
          Length = 97

 Score = 60.9 bits (141), Expect = 1e-08
 Identities = 31/72 (43%), Positives = 42/72 (58%)
 Frame = +1

Query: 94  IVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLC 273
           +++TPG  + Y ++KK   IPRCG     L+GI        +RL + KKTV+R YGG L 
Sbjct: 26  VIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALVLVSLTRLSHNKKTVQRAYGGCLS 85

Query: 274 HKCVKQRIVRAF 309
              V+  IVRAF
Sbjct: 86  ANAVRS-IVRAF 96


>UniRef50_Q9UZJ7 Cluster: 50S ribosomal protein L34e; n=8;
           Archaea|Rep: 50S ribosomal protein L34e - Pyrococcus
           abyssi
          Length = 91

 Score = 60.1 bits (139), Expect = 3e-08
 Identities = 30/75 (40%), Positives = 43/75 (57%)
 Frame = +1

Query: 67  YNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRKKTV 246
           Y ++S +R+ VRTPGGR+V  + ++  KI  C  C   L GI   RP E  +L   KK  
Sbjct: 5   YRSRSWRRKYVRTPGGRVVIHFERRKPKIAHCAICGRPLNGIPRGRPVEMRKLPKTKKRP 64

Query: 247 KRVYGGVLCHKCVKQ 291
           +R Y   LC KC+++
Sbjct: 65  ERPYPH-LCPKCMRR 78


>UniRef50_A1RXV1 Cluster: Ribosomal protein L34e; n=1; Thermofilum
           pendens Hrk 5|Rep: Ribosomal protein L34e - Thermofilum
           pendens (strain Hrk 5)
          Length = 91

 Score = 59.3 bits (137), Expect = 5e-08
 Identities = 29/80 (36%), Positives = 45/80 (56%)
 Frame = +1

Query: 58  RLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRK 237
           R +  ++S +R++VRTPGGRL    + K    P+C  C   ++G+ P   +   R   R 
Sbjct: 3   RPALRSRSKKRKLVRTPGGRLALHVIDKKHDYPKCAICGRPIQGV-PKLTSRLERRGVRM 61

Query: 238 KTVKRVYGGVLCHKCVKQRI 297
            T  R YGG LCH+C+++ I
Sbjct: 62  PT--RPYGGYLCHECLRKGI 79


>UniRef50_O26137 Cluster: 50S ribosomal protein L34e; n=3;
           Methanobacteriaceae|Rep: 50S ribosomal protein L34e -
           Methanobacterium thermoautotrophicum
          Length = 88

 Score = 57.2 bits (132), Expect = 2e-07
 Identities = 28/77 (36%), Positives = 37/77 (48%)
 Frame = +1

Query: 61  LSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRKK 240
           L Y ++S +R   +TPGGR V  Y +K      C  C   L G+   RP E  +L   KK
Sbjct: 4   LRYRSRSYKRIFKKTPGGRTVTHYRRKKPSKHVCAGCGKPLHGVPRGRPYEIRKLSKSKK 63

Query: 241 TVKRVYGGVLCHKCVKQ 291
              R YGG  C  C ++
Sbjct: 64  RPNRPYGGYYCSSCARK 80


>UniRef50_P58026 Cluster: 50S ribosomal protein L34e; n=4;
           Thermoprotei|Rep: 50S ribosomal protein L34e - Aeropyrum
           pernix
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-07
 Identities = 30/83 (36%), Positives = 40/83 (48%)
 Frame = +1

Query: 58  RLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRK 237
           R    ++S +R   RTPGG  V  Y ++     RC +C   L G+   RP    RL    
Sbjct: 8   RPGLRSRSLRRVYRRTPGGSTVVHYERRKPGPARCARCGRPLGGVPRGRPPRVRRLSKTA 67

Query: 238 KTVKRVYGGVLCHKCVKQRIVRA 306
           K  +R YGGVLC  C+ + I  A
Sbjct: 68  KRPERPYGGVLCSTCLAEMIFEA 90


>UniRef50_Q6LZK0 Cluster: Ribosomal protein L34e; n=5;
           Methanococcus|Rep: Ribosomal protein L34e -
           Methanococcus maripaludis
          Length = 89

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 25/78 (32%), Positives = 42/78 (53%)
 Frame = +1

Query: 67  YNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRKKTV 246
           Y + S+++   + PG   +  Y +K +    CG C + L G+   R  E ++L   +K  
Sbjct: 6   YKSGSSKKVYRKAPGNSSIVHYRRKKQSKAVCGACGALLNGVPRGRAVEITKLAKTEKRP 65

Query: 247 KRVYGGVLCHKCVKQRIV 300
           +R +GG LC KCVK+ +V
Sbjct: 66  ERPFGGNLCPKCVKKMMV 83


>UniRef50_Q3LW25 Cluster: Ribosomal protein L34; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L34 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 90

 Score = 48.8 bits (111), Expect = 6e-05
 Identities = 30/100 (30%), Positives = 53/100 (53%)
 Frame = +1

Query: 40  RLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERS 219
           R+T ++R +Y T SN+  I +  GG+ V +Y+   KK+    +CK   + I  +      
Sbjct: 2   RITLKKRKTYKTNSNKFIIKKILGGKYVAKYI---KKLRTSNKCKYTNKDIPTSN----- 53

Query: 220 RLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKV 339
               +K  + R+YG  + HK VKQ+++  FL  E K +++
Sbjct: 54  ----KKPRLSRIYGKEIHHKIVKQKLLIKFLKTENKSLRI 89


>UniRef50_Q74NH0 Cluster: NEQ297; n=1; Nanoarchaeum equitans|Rep:
           NEQ297 - Nanoarchaeum equitans
          Length = 83

 Score = 47.6 bits (108), Expect = 1e-04
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
 Frame = +1

Query: 100 RTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAE--RSRLCYRKKTVKRVYGGVLC 273
           RTPGGR+   Y ++     +C  C   L+G+    PA   +S    RKK V R +GG LC
Sbjct: 9   RTPGGRVTVLYKRRKPSPAKCAICGRPLQGVV-REPAYWLKSEPKQRKK-VSRKFGGYLC 66

Query: 274 HKCVKQRIVR 303
           H+C ++ I R
Sbjct: 67  HECARRVIAR 76


>UniRef50_Q8ZTJ2 Cluster: 50S ribosomal protein L34e; n=3;
           Pyrobaculum|Rep: 50S ribosomal protein L34e -
           Pyrobaculum aerophilum
          Length = 84

 Score = 43.6 bits (98), Expect = 0.002
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +1

Query: 58  RLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRK 237
           R +Y ++S +R  V+TPGGR V  Y K+ K +P+C      + G+      +  R   + 
Sbjct: 3   RPAYRSRSVRRIKVKTPGGRTVIHYEKRAKGVPKCPITGLPIGGMN----KKVYRFGIKI 58

Query: 238 KTVKRVYGGVLCHKCVKQRI 297
           +   R YGGV  HK + + +
Sbjct: 59  RAPSRPYGGVYSHKVLARAL 78


>UniRef50_Q98SA5 Cluster: 60S ribosomal protein L34; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L34 - Guillardia theta
           (Cryptomonas phi)
          Length = 103

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = +1

Query: 58  RLSYNTKSN-QRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYR 234
           RLS +  S+ +R+  +TPGGRLV   +KK  K  RC      L GI      +       
Sbjct: 5   RLSCHRNSHSKRKNTKTPGGRLVSILLKKKIKKKRCPVNGKILNGIDSDIVRKTG----- 59

Query: 235 KKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 336
           K  + R   G L    +K +I+++FL EE+K+ K
Sbjct: 60  KTHISRHSSGDLSASALKDKIIKSFLKEEKKLAK 93


>UniRef50_Q975K6 Cluster: 50S ribosomal protein L34e; n=2;
           Sulfolobus|Rep: 50S ribosomal protein L34e - Sulfolobus
           tokodaii
          Length = 87

 Score = 41.1 bits (92), Expect = 0.013
 Identities = 20/77 (25%), Positives = 39/77 (50%)
 Frame = +1

Query: 67  YNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLCYRKKTV 246
           Y + S ++   + P G+    Y ++      C  CK  L+G++     + S+    +K  
Sbjct: 6   YRSTSYRKIHTKLPSGKSTIHYERRKNNRAVCAICKKPLQGVKTNLLYKYSKT---EKRP 62

Query: 247 KRVYGGVLCHKCVKQRI 297
           +R+YGG +C+KC++  I
Sbjct: 63  ERMYGGYICYKCLENLI 79


>UniRef50_UPI0000E4799B Cluster: PREDICTED: similar to zinc
           transporter ZnT-2; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to zinc transporter
           ZnT-2 - Strongylocentrotus purpuratus
          Length = 379

 Score = 32.7 bits (71), Expect = 4.5
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -1

Query: 283 HIYGRGHHHKHVSLFSYGSKDGNV 212
           H +G GH H H SLF  GSKD  +
Sbjct: 190 HSHGGGHGHSHGSLFGGGSKDDEI 213


>UniRef50_A1IBG0 Cluster: Glycosyltransferases involved in cell wall
           biogenesis-like; n=2; Candidatus Desulfococcus
           oleovorans Hxd3|Rep: Glycosyltransferases involved in
           cell wall biogenesis-like - Candidatus Desulfococcus
           oleovorans Hxd3
          Length = 720

 Score = 32.3 bits (70), Expect = 6.0
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = -1

Query: 229 SKDGNVQQV*LAGYHGVCSCTDHTLGSSWAFLHTDK-PSGHPVSLLFFFDLI 77
           ++ G +  +   G  GV        G+SW F +  K PS HP+SL  F+D +
Sbjct: 442 TRQGRLTALLCLGAIGVSQLVPALTGNSWFFYYLYKVPSSHPLSLENFYDFL 493


>UniRef50_UPI00003AD95B Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 1221

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 15/34 (44%), Positives = 16/34 (47%)
 Frame = -3

Query: 368 DLVLACCALRTFTIFCSSMRKALTMRCLTHLWQR 267
           DL LA C     T  C+    AL   CLT LW R
Sbjct: 421 DLTLAVCLSVFITFLCAFCLGALARPCLTRLWMR 454


>UniRef50_Q9WY78 Cluster: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
           6-diaminopimelate--D-alanyl- D-alanyl ligase; n=2;
           Thermotoga|Rep: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
           6-diaminopimelate--D-alanyl- D-alanyl ligase -
           Thermotoga maritima
          Length = 426

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 3/68 (4%)
 Frame = -2

Query: 330 NFLFFNEEGSDNALLDTFMAEDTTINTFHCF---LTVAKTGTFSRSSWLDTTEFALALTT 160
           N LFF +EG D+ L D +  E +TI  F  F    TV  +G ++    L+       + T
Sbjct: 215 NTLFFGKEGGDSVLKDWWYYEGSTIAEFEAFDSLFTVKLSGYWNGGQLLNIAASLCVMRT 274

Query: 159 PWDLLGLF 136
             + + +F
Sbjct: 275 LGETVDIF 282


>UniRef50_Q7P5Y3 Cluster: Chromosomal replication initiator protein
           dnaA; n=3; Fusobacterium nucleatum|Rep: Chromosomal
           replication initiator protein dnaA - Fusobacterium
           nucleatum subsp. vincentii ATCC 49256
          Length = 637

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSK-LRGIQPARP 207
           +V ++  +R + YNTK+    +V+ P    +Y+Y+ K +     G+   + L  I P + 
Sbjct: 235 IVNKIKSKRYIKYNTKNLLEIMVKDPIASRIYKYISKIRYKNNKGEINVRTLAAIIPLKI 294

Query: 208 AERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAF 309
            +R      K  VK  Y   +  K V  RI++AF
Sbjct: 295 EQRVERIV-KNGVKEYYLNRM--KPVLTRILKAF 325


>UniRef50_A2EX93 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 580

 Score = 31.9 bits (69), Expect = 7.9
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +3

Query: 9   PAVKKLENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCKKAQEDPKVWSVQEQ 179
           P  KK  N + +    ++ +  +++SK +S D+ W  GL   KKA+E+ ++    EQ
Sbjct: 249 PPNKKPANNSDSDSDTSSSIPPRMRSKLSSDDSSWSDGLKNMKKAKEEQELKLKLEQ 305


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 399,884,488
Number of Sequences: 1657284
Number of extensions: 8098502
Number of successful extensions: 21213
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 20617
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21192
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 28130105105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -