SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9V3G1 Cluster: 60S ribosomal protein L8; n=71; Eukaryo...   322   3e-87
UniRef50_P62917 Cluster: 60S ribosomal protein L8; n=122; cellul...   311   1e-83
UniRef50_Q06B43 Cluster: Ribosomal protein; n=7; Coelomata|Rep: ...   237   1e-61
UniRef50_O15574 Cluster: 60S ribosomal protein L8; n=1; Entamoeb...   169   5e-41
UniRef50_Q9YFN1 Cluster: 50S ribosomal protein L2P; n=3; Archaea...   159   5e-38
UniRef50_Q8ZYF5 Cluster: 50S ribosomal protein L2P; n=6; Thermop...   154   2e-36
UniRef50_Q8TRU4 Cluster: 50S ribosomal protein L2P; n=12; Archae...   144   2e-33
UniRef50_Q975I4 Cluster: 50S ribosomal protein L2P; n=10; Archae...   143   3e-33
UniRef50_Q8TY93 Cluster: 50S ribosomal protein L2P; n=17; Euryar...   143   4e-33
UniRef50_Q3LWH0 Cluster: Ribosomal protein L8; n=1; Bigelowiella...   137   2e-31
UniRef50_UPI00015BAE9D Cluster: LSU ribosomal protein L2P; n=1; ...   134   2e-30
UniRef50_Q8SSM6 Cluster: 60S ribosomal protein L8; n=1; Encephal...   132   9e-30
UniRef50_A7DQR3 Cluster: Ribosomal protein L2; n=1; Candidatus N...   119   5e-26
UniRef50_P60408 Cluster: 50S ribosomal protein L2P; n=1; Nanoarc...   115   9e-25
UniRef50_A0RZ09 Cluster: Ribosomal protein L2; n=2; Crenarchaeot...   110   3e-23
UniRef50_Q41960 Cluster: 60S ribosomal protein KD4/L2; n=3; Euka...   107   2e-22
UniRef50_Q97BX4 Cluster: 50S ribosomal protein L2P; n=4; Thermop...   105   7e-22
UniRef50_Q88XY3 Cluster: 50S ribosomal protein L2; n=90; Bacteri...    81   3e-14
UniRef50_P56791 Cluster: Chloroplast 50S ribosomal protein L2; n...    78   2e-13
UniRef50_Q8YHN7 Cluster: 50S ribosomal protein L2; n=133; cellul...    77   3e-13
UniRef50_Q01G37 Cluster: Ribosomal protein L2, bacterial and org...    73   8e-12
UniRef50_Q6F1Z1 Cluster: 50S ribosomal protein L2; n=7; cellular...    71   3e-11
UniRef50_O66434 Cluster: 50S ribosomal protein L2; n=113; cellul...    70   6e-11
UniRef50_Q5BZD1 Cluster: SJCHGC07017 protein; n=1; Schistosoma j...    69   1e-10
UniRef50_P75577 Cluster: 50S ribosomal protein L2; n=17; Bacteri...    67   4e-10
UniRef50_P26859 Cluster: Mitochondrial 60S ribosomal protein L2;...    66   9e-10
UniRef50_A6YEA9 Cluster: Ribosomal protein L2; n=1; Chlorokybus ...    65   2e-09
UniRef50_A3LNH9 Cluster: Predicted protein; n=5; Saccharomycetac...    64   4e-09
UniRef50_Q605B5 Cluster: 50S ribosomal protein L2; n=396; cellul...    62   1e-08
UniRef50_A2Q9C8 Cluster: Contig An01c0260, complete genome. prec...    62   2e-08
UniRef50_Q8VZZ8 Cluster: Ribosomal protein L2; n=1; Zea mays|Rep...    61   3e-08
UniRef50_Q1XGA1 Cluster: Ribosomal protein L2; n=2; cellular org...    60   3e-08
UniRef50_P92812 Cluster: Mitochondrial 60S ribosomal protein L2;...    60   3e-08
UniRef50_Q2WGE5 Cluster: Ribosomal protein L2; n=5; Tracheophyta...    59   8e-08
UniRef50_Q7YAM0 Cluster: Ribosomal protein L2; n=2; Streptophyti...    58   1e-07
UniRef50_Q39213 Cluster: Ribosomal protein L2; n=3; Arabidopsis ...    57   3e-07
UniRef50_A7CUV2 Cluster: Ribosomal protein L2; n=1; Opitutaceae ...    55   2e-06
UniRef50_A5AS87 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_P32611 Cluster: 54S ribosomal protein RML2, mitochondri...    54   2e-06
UniRef50_Q9AIG2 Cluster: Ribosomal protein L2; n=4; Bacteria|Rep...    53   7e-06
UniRef50_P46763 Cluster: Mitochondrial 60S ribosomal protein L2;...    53   7e-06
UniRef50_Q95299 Cluster: Ribosomal protein L8; n=1; Sus scrofa|R...    52   1e-05
UniRef50_A1CWB9 Cluster: 50S ribosomal protein L2; n=6; Eurotiom...    46   7e-05
UniRef50_Q41912 Cluster: 50S ribosomal protein L2; n=10; Magnoli...    49   1e-04
UniRef50_A5C022 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q9MTE5 Cluster: Ribosomal protein L2; n=1; Toxoplasma g...    48   1e-04
UniRef50_A5DY19 Cluster: 60S ribosomal protein RML2, mitochondri...    48   1e-04
UniRef50_Q2LZ31 Cluster: GA20496-PA; n=2; Diptera|Rep: GA20496-P...    47   5e-04
UniRef50_Q9G4C8 Cluster: Ribosomal protein L2; n=1; Thraustochyt...    46   6e-04
UniRef50_Q9AIM8 Cluster: Ribosomal protein L2; n=2; Candidatus C...    46   8e-04
UniRef50_Q9G918 Cluster: Ribosomal protein L2; n=1; Ochromonas d...    46   8e-04
UniRef50_Q2LCR9 Cluster: Ribosomal protein L2; n=3; Dictyostelii...    45   0.001
UniRef50_Q5IX18 Cluster: 50S ribosomal protein L2; n=1; Protothe...    44   0.002
UniRef50_Q16XA5 Cluster: Putative uncharacterized protein; n=1; ...    44   0.002
UniRef50_Q8MYY5 Cluster: RE45450p; n=6; Endopterygota|Rep: RE454...    43   0.006
UniRef50_A7QZU6 Cluster: Chromosome undetermined scaffold_288, w...    42   0.013
UniRef50_Q4P5V2 Cluster: Putative uncharacterized protein; n=1; ...    42   0.013
UniRef50_A7PXN3 Cluster: Chromosome chr12 scaffold_36, whole gen...    42   0.017
UniRef50_Q5T653 Cluster: 39S ribosomal protein L2, mitochondrial...    42   0.017
UniRef50_Q7YN79 Cluster: Ribosomal protein L2; n=1; Eimeria tene...    41   0.023
UniRef50_Q4S2E6 Cluster: Chromosome 17 SCAF14762, whole genome s...    41   0.030
UniRef50_UPI00003617AD Cluster: 39S ribosomal protein L2, mitoch...    40   0.040
UniRef50_Q3T1K8 Cluster: Rpl8 protein; n=8; Coelomata|Rep: Rpl8 ...    39   0.092
UniRef50_Q9G8Q6 Cluster: Ribosomal protein L2; n=1; Naegleria gr...    39   0.12 
UniRef50_Q2HAK3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q5DC89 Cluster: SJCHGC02322 protein; n=1; Schistosoma j...    38   0.21 
UniRef50_Q5KGY0 Cluster: Ribosomal protein L2, putative; n=2; Fi...    38   0.21 
UniRef50_O45110 Cluster: Putative uncharacterized protein; n=2; ...    37   0.49 
UniRef50_A1W550 Cluster: ApbE family lipoprotein precursor; n=1;...    36   0.65 
UniRef50_Q02CU7 Cluster: Tetratricopeptide TPR_2 repeat protein;...    35   2.0  
UniRef50_Q2HG61 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_O86372 Cluster: Putative uncharacterized protein; n=7; ...    33   6.0  
UniRef50_A6NSE2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_Q0CD71 Cluster: Predicted protein; n=3; Trichocomaceae|...    33   6.0  
UniRef50_UPI0000E48847 Cluster: PREDICTED: similar to titin isof...    33   8.0  
UniRef50_UPI000065ED52 Cluster: Complement C5 precursor [Contain...    33   8.0  
UniRef50_A3JMF2 Cluster: Glycosyl transferase, family 2; n=1; Rh...    33   8.0  
UniRef50_A1TSE8 Cluster: TonB-dependent receptor, plug precursor...    33   8.0  
UniRef50_A0YL57 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_Q17DQ5 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_Q17A88 Cluster: Sensory neuron membrane protein-1; n=3;...    33   8.0  
UniRef50_A6R0K7 Cluster: Predicted protein; n=2; Pezizomycotina|...    33   8.0  
UniRef50_A3LYD9 Cluster: Hypothetical transcription factor; n=1;...    33   8.0  

>UniRef50_Q9V3G1 Cluster: 60S ribosomal protein L8; n=71;
           Eukaryota|Rep: 60S ribosomal protein L8 - Drosophila
           melanogaster (Fruit fly)
          Length = 256

 Score =  322 bits (792), Expect = 3e-87
 Identities = 148/185 (80%), Positives = 165/185 (89%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G A L      +AER GYI+GVVKDIIHDPGRGAPLAVVHFRDPY++K RKELFIAP
Sbjct: 22  KRKGAAKLRSL--DFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAP 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG++TGQFVYCG+KATL++GNVMP+  MPEGTI+CNLEEK GDRGRLAR SGN+ATVI H
Sbjct: 80  EGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           N D K+TRVKLPSGAKKV+PS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRN WP V
Sbjct: 140 NQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +H KKRKGA KLRSL
Sbjct: 7   AQRKGAGSVFKAHVKKRKGAAKLRSL 32


>UniRef50_P62917 Cluster: 60S ribosomal protein L8; n=122; cellular
           organisms|Rep: 60S ribosomal protein L8 - Homo sapiens
           (Human)
          Length = 257

 Score =  311 bits (763), Expect = 1e-83
 Identities = 143/184 (77%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.092
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>UniRef50_Q06B43 Cluster: Ribosomal protein; n=7; Coelomata|Rep:
           Ribosomal protein - Codakia orbicularis
          Length = 234

 Score =  237 bits (581), Expect = 1e-61
 Identities = 118/184 (64%), Positives = 136/184 (73%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+GKA L      +AERHGY+KGVVKDI+HDPGRGAPLA V FRDPYK+K R E FIA E
Sbjct: 23  RKGKAALRAV--DFAERHGYVKGVVKDIVHDPGRGAPLAKVTFRDPYKYKMRTETFIATE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQF+Y                        C  +  +  RG+LARASGN+ATVI HN
Sbjct: 81  GMYTGQFIY------------------------CGKKANLQIRGKLARASGNYATVISHN 116

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           PD K++RVKLPSG+KKV+PS+NR +VGIVAGGGRIDKP+LKAGRAYHKYK KRNCWP VR
Sbjct: 117 PDTKKSRVKLPSGSKKVIPSANRAIVGIVAGGGRIDKPMLKAGRAYHKYKAKRNCWPKVR 176

Query: 645 GVAM 656
           GVAM
Sbjct: 177 GVAM 180



 Score = 36.7 bits (81), Expect = 0.49
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           +QRKG GSVF +HTK RKG   LR++
Sbjct: 7   SQRKGPGSVFKAHTKHRKGKAALRAV 32


>UniRef50_O15574 Cluster: 60S ribosomal protein L8; n=1; Entamoeba
           histolytica|Rep: 60S ribosomal protein L8 - Entamoeba
           histolytica
          Length = 158

 Score =  169 bits (411), Expect = 5e-41
 Identities = 74/114 (64%), Positives = 93/114 (81%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNV 347
           +G+VK I HDPGRGAPLA V FR+P ++   KELFI  EGLY+GQ++YCG KA+L +GNV
Sbjct: 33  RGLVKSIEHDPGRGAPLARVVFRNPRQYGLDKELFICAEGLYSGQYIYCGSKASLHIGNV 92

Query: 348 MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           +P+G  PEGT+VCN+E K GDRG +ARASGN+ATVI HN D + TR++LPSGAK
Sbjct: 93  LPIGQCPEGTVVCNVESKPGDRGIIARASGNYATVISHNADNETTRIRLPSGAK 146


>UniRef50_Q9YFN1 Cluster: 50S ribosomal protein L2P; n=3;
           Archaea|Rep: 50S ribosomal protein L2P - Aeropyrum
           pernix
          Length = 238

 Score =  159 bits (386), Expect = 5e-38
 Identities = 81/164 (49%), Positives = 109/164 (66%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           ++G V ++IHDPGR  PLA V   D  +F     L  A EG+Y GQ +  G  A  E GN
Sbjct: 38  LRGKVVELIHDPGRYVPLARVVREDGVEF-----LMPAAEGMYVGQIIEIGPAAKPEAGN 92

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
           ++P+G +PEGT V N+E + GD G+LAR +G++A V+G      +T ++LPSG  K +P+
Sbjct: 93  ILPLGKIPEGTEVFNVELRPGDGGKLARQAGSYALVVGRA--GAKTILRLPSGKDKEVPN 150

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            +R  +GI AG GRI+KPI+KAG AYHK+KVK   WP VRGVAM
Sbjct: 151 DSRATIGIPAGAGRIEKPIMKAGFAYHKWKVKARKWPRVRGVAM 194


>UniRef50_Q8ZYF5 Cluster: 50S ribosomal protein L2P; n=6;
           Thermoproteales|Rep: 50S ribosomal protein L2P -
           Pyrobaculum aerophilum
          Length = 246

 Score =  154 bits (373), Expect = 2e-36
 Identities = 77/163 (47%), Positives = 105/163 (64%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNV 347
           KG V DI+H+PG  AP+A +   +  +F        A EGLY GQ V  GK A+ + GN+
Sbjct: 39  KGYVVDILHEPGLNAPVAKIVTENGVEFFN-----YAAEGLYVGQVVEIGKGASPKTGNI 93

Query: 348 MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSS 527
           M +G +PEGT++ N+E++ GD G+ ARA G +A VIG  P+  +T ++LPSG    + S 
Sbjct: 94  MILGEIPEGTMIFNVEKRAGDGGKFARAGGTYAVVIGQKPEENKTIIRLPSGRTVEVDSR 153

Query: 528 NRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            R  VGIVAGGGRI+KP LKAG+ YH+ + K   +P VRG AM
Sbjct: 154 GRATVGIVAGGGRIEKPFLKAGKKYHRARAKAWKYPTVRGKAM 196


>UniRef50_Q8TRU4 Cluster: 50S ribosomal protein L2P; n=12;
           Archaea|Rep: 50S ribosomal protein L2P - Methanosarcina
           acetivorans
          Length = 238

 Score =  144 bits (349), Expect = 2e-33
 Identities = 75/170 (44%), Positives = 105/170 (61%), Gaps = 1/170 (0%)
 Frame = +3

Query: 150 ERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFI-APEGLYTGQFVYCGKKA 326
           + +  ++G V  I HDP R AP+A V       F+  +ELF+ A EG+  G  + CG  A
Sbjct: 34  DENSSLRGEVVGIEHDPARSAPIAKV------AFENGEELFLLASEGIAVGNIIECGDDA 87

Query: 327 TLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGA 506
            ++ GN++P+G +PEG  +CN+E K  D G+  R+SG +ATV+ H  +A RT V +PSG 
Sbjct: 88  EVKPGNIVPIGNVPEGFFICNVESKPNDGGKFVRSSGVYATVVTH--EATRTAVSMPSGN 145

Query: 507 KKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            K L    R +VGIVAG GR+D+P LKAG+ YHK K +   +P V  VAM
Sbjct: 146 IKWLNPKCRAVVGIVAGSGRVDRPWLKAGKKYHKMKTRAAKYPRVSAVAM 195


>UniRef50_Q975I4 Cluster: 50S ribosomal protein L2P; n=10;
           Archaea|Rep: 50S ribosomal protein L2P - Sulfolobus
           tokodaii
          Length = 238

 Score =  143 bits (347), Expect = 3e-33
 Identities = 74/162 (45%), Positives = 101/162 (62%)
 Frame = +3

Query: 171 GVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVM 350
           G V DI+H+PG  APLA++   D  KF        + +GL  GQ +  GK A +  GN++
Sbjct: 39  GKVIDIVHNPGTNAPLALIKLDDGTKFYVP-----SVQGLVVGQKIQIGKNAAISNGNIV 93

Query: 351 PVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSN 530
            VG +PEGTI+ N+E+  GD G+ AR++G +  V+G   D  +  VKL S     + S+ 
Sbjct: 94  EVGNVPEGTIISNIEKTRGDGGKFARSAGTYGVVVGKTGD--KVLVKLSSEKIAQVSSNA 151

Query: 531 RGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           R +VG+VAGGG  +KP+LKAG  Y KYKVK   WP+VRGVAM
Sbjct: 152 RAIVGVVAGGGVTEKPLLKAGNNYWKYKVKAKKWPHVRGVAM 193


>UniRef50_Q8TY93 Cluster: 50S ribosomal protein L2P; n=17;
           Euryarchaeota|Rep: 50S ribosomal protein L2P -
           Methanopyrus kandleri
          Length = 243

 Score =  143 bits (346), Expect = 4e-33
 Identities = 69/169 (40%), Positives = 101/169 (59%)
 Frame = +3

Query: 150 ERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKAT 329
           E+ G + G V +++HDP R AP+A V F D       + L + PEG   G  + CG  A 
Sbjct: 37  EKKGKVVGKVVELLHDPARNAPVARVRFEDG-----EERLILVPEGTKVGDIIECGVSAE 91

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           ++ GN +P+  +PEG  + N+E + GD G+ ARA G +AT+I H  D  RT V+LPSG  
Sbjct: 92  IKPGNTLPLAEIPEGVPIFNIEGQPGDGGKFARAPGCYATIIAH--DVGRTYVQLPSGKV 149

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           +      R  +G+++GGG+ +KP +KAG+ Y+  + K   WP VRGVAM
Sbjct: 150 RTFDPRCRATIGVMSGGGKREKPFVKAGKKYYHMRSKGGKWPKVRGVAM 198


>UniRef50_Q3LWH0 Cluster: Ribosomal protein L8; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L8 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 281

 Score =  137 bits (332), Expect = 2e-31
 Identities = 71/182 (39%), Positives = 107/182 (58%)
 Frame = +3

Query: 99  TRRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIA 278
           +RR GK  +++      E++  IKG++     D  +  P   + F     FK   EL+IA
Sbjct: 47  SRRIGK--ISYKSMTNEEKYSVIKGIISKFHIDTVKKVPAIKIKFNVTKYFKNYYELYIA 104

Query: 279 PEGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIG 458
            E LY  + + CG +A    GNV+P+  +P G  VCN+EEK GD G+LAR++G F  V+ 
Sbjct: 105 VEKLYLNKTIACGLQARPITGNVLPLFNIPNGVFVCNVEEKEGDGGKLARSAGAFVGVLS 164

Query: 459 HNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPY 638
           H+     T++KLPS   K+L S  R  +G+VAGGG+ +KP+LKAG+ Y+K+K     +P 
Sbjct: 165 HSKYNNVTKLKLPSKKIKILSSFCRATIGVVAGGGKYEKPLLKAGKNYYKFKSLNKKYPI 224

Query: 639 VR 644
           V+
Sbjct: 225 VK 226


>UniRef50_UPI00015BAE9D Cluster: LSU ribosomal protein L2P; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: LSU ribosomal protein
           L2P - Ignicoccus hospitalis KIN4/I
          Length = 251

 Score =  134 bits (323), Expect = 2e-30
 Identities = 71/163 (43%), Positives = 101/163 (61%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNV 347
           +G V ++ HDPGR  PLA +   +   F        A EG+YTGQ V  G  A    GN+
Sbjct: 43  EGYVVELKHDPGRWVPLAHIVIPNVADF-----WIPAAEGMYTGQKVQIGPNAAPVNGNI 97

Query: 348 MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSS 527
           +P+ A+PEGT + N+E + GD G+LAR+ G +A ++G + ++    ++LPSG  K + + 
Sbjct: 98  LPLYAIPEGTQIFNVEIRPGDGGKLARSGGAYAILVGKSGNS--AIIQLPSGKVKQVNAK 155

Query: 528 NRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            R  +GI AG GR +KP+LKAG AY+K+K K   WP VRGVAM
Sbjct: 156 ARATIGIAAGAGRDEKPLLKAGNAYYKWKAKAKKWPVVRGVAM 198


>UniRef50_Q8SSM6 Cluster: 60S ribosomal protein L8; n=1;
           Encephalitozoon cuniculi|Rep: 60S ribosomal protein L8 -
           Encephalitozoon cuniculi
          Length = 239

 Score =  132 bits (318), Expect = 9e-30
 Identities = 65/163 (39%), Positives = 101/163 (61%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNV 347
           +G V DI+H+  RGAP+A++ F++         +  A EG+YTGQ +  G  A +++GN+
Sbjct: 34  EGEVIDIVHERSRGAPVAIISFKED------DCMVPASEGMYTGQKILIGDDAPIDIGNI 87

Query: 348 MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSS 527
             +  +PEG  V ++E   GD G  A  +G+++ V+ H  +   T +K+PSG K  + S 
Sbjct: 88  TKIKNVPEGMAVNSVESVYGDGGTFAMVNGSYSLVVNHRKETNETVIKIPSGKKLTVSSE 147

Query: 528 NRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            R +VG+VAGGG  DKP+LKA  A++K K + + +P VRGVAM
Sbjct: 148 CRCIVGVVAGGGIHDKPLLKASVAHYKAKARGHVFPRVRGVAM 190


>UniRef50_A7DQR3 Cluster: Ribosomal protein L2; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein L2
           - Candidatus Nitrosopumilus maritimus SCM1
          Length = 244

 Score =  119 bits (287), Expect = 5e-26
 Identities = 63/162 (38%), Positives = 91/162 (56%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNV 347
           +G + D++H+ GR APLA V F D            A  G   G+ +  G K+ +E GNV
Sbjct: 41  EGEIIDLVHERGREAPLAKVRFEDG-----SVSFVPAVLGAKVGETLQFGLKSKIEKGNV 95

Query: 348 MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSS 527
           + +  +P+GTIVCN+E+  GD G + +++G  ATV  H  +     VKLPSG    L   
Sbjct: 96  ISIQNIPDGTIVCNIEKHFGDGGAIVKSAGTDATVFSHGDEG--VTVKLPSGKFTTLNPK 153

Query: 528 NRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVA 653
           NR M+G +AGGG  ++P + AG  +  +K K   +P VRGVA
Sbjct: 154 NRAMIGTLAGGGASERPFMSAGGKWRNFKAKGKKYPIVRGVA 195


>UniRef50_P60408 Cluster: 50S ribosomal protein L2P; n=1;
           Nanoarchaeum equitans|Rep: 50S ribosomal protein L2P -
           Nanoarchaeum equitans
          Length = 238

 Score =  115 bits (277), Expect = 9e-25
 Identities = 64/162 (39%), Positives = 93/162 (57%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           +KG V  +I D    APL VV + +       + L  AP G+  G  VY GK+A   +G+
Sbjct: 39  VKGKVVALIKDSIHYAPLMVVKWENG-----AQSLLPAPLGISVGDTVYYGKEAPNAIGS 93

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
           + P+  +PEGT +  LE   GD G+L RASG+FA ++    D  +  V+LPSG  K L +
Sbjct: 94  IKPLSEIPEGTKIYMLENNPGDGGKLVRASGDFALLVQKLGD--KVIVQLPSGQFKTLSA 151

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGV 650
           + R ++G++AGGGR +KP +KAG  Y+    +   WP V GV
Sbjct: 152 NARAVIGVIAGGGRKEKPFVKAGNKYYWASSRNRHWPVVNGV 193


>UniRef50_A0RZ09 Cluster: Ribosomal protein L2; n=2;
           Crenarchaeota|Rep: Ribosomal protein L2 - Cenarchaeum
           symbiosum
          Length = 243

 Score =  110 bits (264), Expect = 3e-23
 Identities = 61/162 (37%), Positives = 88/162 (54%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNV 347
           +G V D++H+ GR APLA + F D         L     G   G  +  G K+ +  GNV
Sbjct: 40  EGTVIDLVHERGRDAPLAKIRFEDGIVSYVPAVL-----GTRVGSSMNFGLKSEIRDGNV 94

Query: 348 MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSS 527
           + V  +P+GT VCN+E+  GD G + +++G  ATV  H        +KLPSG    L   
Sbjct: 95  ISVQNIPDGTTVCNVEKHYGDGGAIVKSAGGNATVFSHGEGG--VVLKLPSGRFSTLNPK 152

Query: 528 NRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVA 653
           NR MVG +AGGG  ++P + AG  + +++ K   +P VRGVA
Sbjct: 153 NRAMVGTLAGGGVSERPFMSAGGKWRRFRSKGRKYPIVRGVA 194


>UniRef50_Q41960 Cluster: 60S ribosomal protein KD4/L2; n=3;
           Eukaryota|Rep: 60S ribosomal protein KD4/L2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 123

 Score =  107 bits (258), Expect = 2e-22
 Identities = 53/103 (51%), Positives = 69/103 (66%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A   F    + ER+GY+KGVV +IIHDPGRGAPLA V FR P++FK +KELF+  E
Sbjct: 23  RKGPA--KFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVTFRHPFRFKKQKELFVXXE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDR 413
                  +YCGKKATL VGNV+P+ ++PEG       + +G R
Sbjct: 81  VCTPVSSLYCGKKATLVVGNVLPLRSIPEGAXCLQRRDHVGYR 123



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 19/26 (73%), Positives = 19/26 (73%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRK AGSVF SHT  RKG  K RSL
Sbjct: 7   AQRKVAGSVFKSHTHHRKGPAKFRSL 32


>UniRef50_Q97BX4 Cluster: 50S ribosomal protein L2P; n=4;
           Thermoplasmatales|Rep: 50S ribosomal protein L2P -
           Thermoplasma volcanium
          Length = 234

 Score =  105 bits (253), Expect = 7e-22
 Identities = 68/163 (41%), Positives = 88/163 (53%), Gaps = 2/163 (1%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELF-IAPEGLYTGQFVYCGKKATLEVGNVM 350
           VVKDIIH PGR +PL  +   D     T K+++ IA  G Y GQ +  G   T+  G   
Sbjct: 37  VVKDIIHAPGRNSPL--LELVD----STGKKVYQIAFTGAYVGQKIVAGNVDTINPGTTT 90

Query: 351 PVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSN 530
            +  +P+G+ V N+E   GD G   R++G FA V+ H     R  +KLPSG+ +      
Sbjct: 91  VLANIPDGSYVYNIESSPGDGGEFCRSAGTFALVVSH---GSRVTLKLPSGSMRDFDPRC 147

Query: 531 RGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPY-VRGVAM 656
           R  VG+VA  G ID PILKAG   H  + K    PY VRGVAM
Sbjct: 148 RATVGVVAASGIIDAPILKAGTHVHYLRSKAK-RPYTVRGVAM 189


>UniRef50_Q88XY3 Cluster: 50S ribosomal protein L2; n=90;
           Bacteria|Rep: 50S ribosomal protein L2 - Lactobacillus
           plantarum
          Length = 279

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 54/165 (32%), Positives = 91/165 (55%), Gaps = 1/165 (0%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           +   VK I +DP R A +A++ + D  K        +AP+GL  G  V  G +A ++VGN
Sbjct: 74  VPATVKAIEYDPNRTANIALLVYADGVK-----SYILAPKGLEVGMQVQSGAEADIKVGN 128

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
            +P+  +P GT++ N+E K G  G+LAR++G  A ++G   + K   V+L SG  +++  
Sbjct: 129 ALPLTNIPVGTVIHNIELKPGKGGQLARSAGTSAQLLG--KEGKYAIVRLSSGEVRLVLL 186

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYH-KYKVKRNCWPYVRGVAM 656
           ++R  +G V   G     ++ +G+A   +++ KR   P VRG  M
Sbjct: 187 TSRATIGTV---GNEQHELINSGKAGRTRWQGKR---PTVRGSVM 225


>UniRef50_P56791 Cluster: Chloroplast 50S ribosomal protein L2;
           n=423; cellular organisms|Rep: Chloroplast 50S ribosomal
           protein L2 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 274

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 53/164 (32%), Positives = 82/164 (50%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           I G +  I +DP R A + ++H+ D       K   + P G   G  +  G +  +++GN
Sbjct: 72  IYGRIVTIEYDPNRNAYICLIHYGDG-----EKRYILHPRGAIIGDTIVSGTEVPIKMGN 126

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
            +P+  MP GT + N+E  +G  G+LARA+G  A +I    + K   +KLPSG  +++  
Sbjct: 127 ALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIA--KEGKSATLKLPSGEVRLISK 184

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           +    VG V   G   K +   GRA  K  + +   P VRGV M
Sbjct: 185 NCSATVGQVGNVGVNQKSL---GRAGSKCWLGKR--PVVRGVVM 223


>UniRef50_Q8YHN7 Cluster: 50S ribosomal protein L2; n=133; cellular
           organisms|Rep: 50S ribosomal protein L2 - Brucella
           melitensis
          Length = 277

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 52/164 (31%), Positives = 88/164 (53%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           + G V+ + +DP R A +A++ + D           +AP+ L  G  V  G    ++ GN
Sbjct: 74  VVGTVERLEYDPNRTAFIALIRYTDG-----ELAYILAPQRLAVGDQVVAGNSVDVKPGN 128

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
            MP+ +MP GTI+ N+E   G  G++AR++G +A ++G   D     ++L SG ++++  
Sbjct: 129 AMPLSSMPVGTIIHNVELMPGKGGQIARSAGTYAQLVGR--DQGMAILRLNSGEQRLVSG 186

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           +    VG V+     +    KAGR+   ++ KR   P+VRGVAM
Sbjct: 187 ACFASVGAVSNPDHGNINDGKAGRSV--WRGKR---PHVRGVAM 225


>UniRef50_Q01G37 Cluster: Ribosomal protein L2, bacterial and
           organelle form; n=5; cellular organisms|Rep: Ribosomal
           protein L2, bacterial and organelle form - Ostreococcus
           tauri
          Length = 294

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 40/144 (27%), Positives = 78/144 (54%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           ++G ++ + +DP R A +A+V     Y+        +AP G   G  +  G ++ ++VGN
Sbjct: 99  VRGTIRRLEYDPNRSAHIALVD----YEGGNASRYVLAPHGSTPGDALESGPESDIKVGN 154

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
            +P+  +P  T + N+E   G  G+L R++G+ AT++    D     V+LPSG ++++  
Sbjct: 155 ALPLKNIPLQTTIHNIELVPGRGGQLCRSAGSAATLVKKADDGGYCVVRLPSGEQRLVLE 214

Query: 525 SNRGMVGIVAGGGRIDKPILKAGR 596
           +    +G+++  G  ++ I KA R
Sbjct: 215 NCMATIGMLSNRGHQNRNIGKAAR 238


>UniRef50_Q6F1Z1 Cluster: 50S ribosomal protein L2; n=7; cellular
           organisms|Rep: 50S ribosomal protein L2 - Mesoplasma
           florum (Acholeplasma florum)
          Length = 281

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 40/119 (33%), Positives = 68/119 (57%), Gaps = 1/119 (0%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           + G +  I +DP R A + +V++ D  K   R  LF   +G+  G  +   + A ++VGN
Sbjct: 75  VVGTIATIEYDPNRNAFICLVNYLDGEK---RYILFA--KGMTVGMKIVASEHADIKVGN 129

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSG-AKKVL 518
             P+  +PEGT++ N+E K G  G++AR++G    ++G + D K   ++L SG  +KVL
Sbjct: 130 AAPLKNIPEGTLIHNVELKPGKGGQMARSAGTSVQILGKDDDGKYVTLRLTSGEVRKVL 188


>UniRef50_O66434 Cluster: 50S ribosomal protein L2; n=113; cellular
           organisms|Rep: 50S ribosomal protein L2 - Aquifex
           aeolicus
          Length = 304

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 56/170 (32%), Positives = 84/170 (49%), Gaps = 10/170 (5%)
 Frame = +3

Query: 177 VKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVY--------CGKKAT- 329
           V  I +DP R A + ++H+ D       K   I PEGL  G  V          GK    
Sbjct: 94  VVSIEYDPFRSARICLLHYADG-----EKRYIIWPEGLKVGDTVMSISWEDAEAGKPLPE 148

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           ++ GN MP+  +PEGTIV N+E   G  G++ARA+G +A V+G +       V++PSG  
Sbjct: 149 IKPGNAMPLKYIPEGTIVHNIEFIPGKGGQIARAAGTWAQVLGRSTRKGYVLVRMPSGEV 208

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCW-PYVRGVAM 656
           +++       VG V   G  +  ++K G+A    + +   W P+ RG AM
Sbjct: 209 RMIHERCMATVGRV---GLAEHELVKLGKA---GRARWLGWRPHTRGTAM 252


>UniRef50_Q5BZD1 Cluster: SJCHGC07017 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC07017 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 112

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/40 (75%), Positives = 34/40 (85%)
 Frame = +3

Query: 144 YAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRK 263
           +AERHGYI+GVVK+IIHDPGRGAPLA V FRD Y +K  K
Sbjct: 30  FAERHGYIRGVVKEIIHDPGRGAPLAKVAFRDVYSYKLIK 69



 Score = 39.5 bits (88), Expect = 0.069
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLR 133
           +QRKGAG VF +HTK RKGA +LR
Sbjct: 3   SQRKGAGGVFKAHTKHRKGAARLR 26


>UniRef50_P75577 Cluster: 50S ribosomal protein L2; n=17;
           Bacteria|Rep: 50S ribosomal protein L2 - Mycoplasma
           pneumoniae
          Length = 287

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 49/165 (29%), Positives = 81/165 (49%), Gaps = 1/165 (0%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKAT-LEVG 341
           I+  VK I +DP R   ++++ + +       K   I+P+G+  G  +   +    ++ G
Sbjct: 79  IEATVKSIEYDPNRSCFVSLITYANG-----AKSYIISPDGIKVGDKILASEHPIDIKPG 133

Query: 342 NVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLP 521
             MP+  +PEGT V N+E      G++AR++G++A ++G +   K   ++L SG  +   
Sbjct: 134 FSMPLAFIPEGTQVHNIELHPKGGGQIARSAGSYARILGQDETGKYVILQLLSGETRKFL 193

Query: 522 SSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
              R  VG+V+        I KAGR  H     R   P VRG AM
Sbjct: 194 KECRATVGVVSNLDHNLVVIGKAGRNRH-----RGIRPTVRGSAM 233


>UniRef50_P26859 Cluster: Mitochondrial 60S ribosomal protein L2;
           n=2; Embryophyta|Rep: Mitochondrial 60S ribosomal
           protein L2 - Marchantia polymorpha (Liverwort)
          Length = 501

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 40/107 (37%), Positives = 60/107 (56%)
 Frame = +3

Query: 336 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           VGN +P+  +P GT V N+E   G   +L RA+G FA +I    +  +  V+LPSG  K+
Sbjct: 359 VGNCIPLAKIPIGTWVHNIERNPGQGAKLTRAAGTFAQIIQKVENTPQCIVRLPSGVDKL 418

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + S  R  +GIV+      +   KAG++  ++  +R   P VRGVAM
Sbjct: 419 IDSRCRATIGIVSNLNHGKRKFNKAGQS--RWLGRR---PIVRGVAM 460


>UniRef50_A6YEA9 Cluster: Ribosomal protein L2; n=1; Chlorokybus
           atmophyticus|Rep: Ribosomal protein L2 - Chlorokybus
           atmophyticus (Soil alga)
          Length = 368

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 45/129 (34%), Positives = 67/129 (51%), Gaps = 1/129 (0%)
 Frame = +3

Query: 273 IAPEGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATV 452
           +A   L  G FV  G    +  GN +P+ ++P GT+V N+E   G  G++ RA+G  A +
Sbjct: 199 LASHQLKAGDFVSSGPNVEIRTGNALPLISIPLGTLVHNIELYPGSGGQVVRAAGTSAQL 258

Query: 453 I-GHNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNC 629
           I  HN   K   ++LPSG  K  P      +GIV+     +  + KAG +  ++  +R  
Sbjct: 259 IKKHN---KYAILRLPSGELKSFPLQCMATIGIVSNLNHFNTDLKKAGAS--RWLGRR-- 311

Query: 630 WPYVRGVAM 656
            P VRGVAM
Sbjct: 312 -PTVRGVAM 319


>UniRef50_A3LNH9 Cluster: Predicted protein; n=5;
           Saccharomycetaceae|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 364

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 36/109 (33%), Positives = 61/109 (55%)
 Frame = +3

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           ++ GN +P+  +P G+I+ N+    G RG+L +A+G FA ++  +P+ K+  +KL SG  
Sbjct: 212 MQRGNCLPLHMLPVGSIIHNIGLHPGGRGQLVKAAGTFARLLSKHPEEKKVVIKLSSGEH 271

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + +  +    +G+V+          KAGR+ H+ K      P VRGVAM
Sbjct: 272 RYVHMNCHATLGVVSNKEHQAISWGKAGRSRHRGK-----RPMVRGVAM 315


>UniRef50_Q605B5 Cluster: 50S ribosomal protein L2; n=396; cellular
           organisms|Rep: 50S ribosomal protein L2 - Methylococcus
           capsulatus
          Length = 281

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 46/160 (28%), Positives = 80/160 (50%)
 Frame = +3

Query: 177 VKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPV 356
           V+ I +DP R A +A+V +RD       +   +AP GL  G  +  G+ A ++VGN +P+
Sbjct: 84  VERIEYDPNRTAYIALVLYRDG-----ERRYIVAPAGLSAGSEIVAGEFAAIKVGNSLPL 138

Query: 357 GAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRG 536
             +P GT+V  +E K G   + AR++G    ++    + +   +++ SG  + + +  + 
Sbjct: 139 RNIPVGTVVHCVEGKPGKGAQYARSAGTSIQLVA--KEGEYATLRMRSGEMRKVLADCKA 196

Query: 537 MVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            +G V+        + KAG +       R   P VRGVAM
Sbjct: 197 TIGEVSNNEHNLVSLGKAGASRW-----RGVRPTVRGVAM 231


>UniRef50_A2Q9C8 Cluster: Contig An01c0260, complete genome.
           precursor; n=9; Pezizomycotina|Rep: Contig An01c0260,
           complete genome. precursor - Aspergillus niger
          Length = 414

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 53/182 (29%), Positives = 82/182 (45%), Gaps = 21/182 (11%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEV----- 338
           VV+ I HDPGR A +A+V  ++  K        +A EG+  G  V+       E      
Sbjct: 141 VVERIEHDPGRSAHIALVRSQETKKLS----YILAAEGMRAGDVVHSYMSGIPEELWKSM 196

Query: 339 ----------------GNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPD 470
                           GN +P+  MP GT+V N+  + G  G+L R++G FATVI     
Sbjct: 197 GGTVDPGVLAARTAWRGNCLPLHMMPVGTLVFNVGLRPGQGGQLCRSAGTFATVIAKERI 256

Query: 471 AKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGV 650
           ++   ++L SG  +++       VG+ +      + + KAGR+        N  P VRG+
Sbjct: 257 SQHVTIRLQSGEVRLIHKDCCATVGVASNPNHQYRQLGKAGRSRW-----LNIRPTVRGL 311

Query: 651 AM 656
           AM
Sbjct: 312 AM 313


>UniRef50_Q8VZZ8 Cluster: Ribosomal protein L2; n=1; Zea mays|Rep:
           Ribosomal protein L2 - Zea mays (Maize)
          Length = 448

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 40/108 (37%), Positives = 62/108 (57%)
 Frame = +3

Query: 333 EVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKK 512
           +VGN +P+     GT V N+E + G  G++ RA+G +A V+   P AK   ++LPSGA+K
Sbjct: 295 KVGNCIPLANARIGTWVHNIECRPGQGGKMVRAAGTYAKVV-QEPGAKCV-LRLPSGAEK 352

Query: 513 VLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            + S     +GIV+      + + KAG  + ++  +R   P VRGVAM
Sbjct: 353 AVDSRCHATIGIVSNPSHGTRKLRKAG--HSRWLGRR---PVVRGVAM 395


>UniRef50_Q1XGA1 Cluster: Ribosomal protein L2; n=2; cellular
           organisms|Rep: Ribosomal protein L2 - Physcomitrella
           patens (Moss)
          Length = 463

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 40/107 (37%), Positives = 60/107 (56%)
 Frame = +3

Query: 336 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           VGN + +  +P GT V N+E   G   +L RA+G FA +I    +  +  V+LPSG  K+
Sbjct: 321 VGNCVSLANIPIGTWVHNIEWNPGQGAKLIRAAGTFAQIIKKFENTPQCIVRLPSGVDKL 380

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + S  R  VGIV+      + + KAG++  ++  +R   P VRGVAM
Sbjct: 381 IDSRCRATVGIVSNLHHGKRKLDKAGQS--RWLGRR---PIVRGVAM 422


>UniRef50_P92812 Cluster: Mitochondrial 60S ribosomal protein L2;
           n=24; Spermatophyta|Rep: Mitochondrial 60S ribosomal
           protein L2 - Oryza sativa subsp. japonica (Rice)
          Length = 502

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 39/108 (36%), Positives = 63/108 (58%)
 Frame = +3

Query: 333 EVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKK 512
           +VGN +P+  +  GT V ++E   G   +LARA+G +A +I     A +  V+LPSG +K
Sbjct: 359 KVGNSIPLADIRMGTWVHDIECHPGQGAKLARAAGTYAKII--KEPASQCLVRLPSGVEK 416

Query: 513 VLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           ++ S  R  +GIV+      + + KAG++  ++  +R   P VRGVAM
Sbjct: 417 LIDSRCRATIGIVSNPNHGARKLRKAGQS--RWSGRR---PIVRGVAM 459


>UniRef50_Q2WGE5 Cluster: Ribosomal protein L2; n=5;
           Tracheophyta|Rep: Ribosomal protein L2 - Selaginella
           uncinata (Blue spikemoss) (Peacock spikemoss)
          Length = 282

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 50/165 (30%), Positives = 74/165 (44%), Gaps = 1/165 (0%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           + G +  + +DP R A ++ VH  D       K     PEG+  G  +  G  A   VGN
Sbjct: 74  VPGRIITVEYDPNRSAYISPVHHGDG-----DKGYISHPEGIRVGDAIPTGPGAPTTVGN 128

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
             P   MP GT++  +E   G  G+ ARA+G  A  +     +  +R  LP G  + +P 
Sbjct: 129 APPPTHMPLGTVMHGIEVAPGKGGQSARAAGAPAKPVAKEGQSATSR--LPPGEVRSIPQ 186

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHK-YKVKRNCWPYVRGVAM 656
           +   +VG     G +D     +G+A  K +   R   P VRGV M
Sbjct: 187 NRPAVVG---QAGNVDSKNRASGKAGSKRWPGSR---PRVRGVVM 225


>UniRef50_Q7YAM0 Cluster: Ribosomal protein L2; n=2;
           Streptophytina|Rep: Ribosomal protein L2 - Chara
           vulgaris (Common stonewort)
          Length = 262

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 54/179 (30%), Positives = 87/179 (48%), Gaps = 10/179 (5%)
 Frame = +3

Query: 150 ERHGYIKGVVKDIIHDPGRGAPLAVVHF----RDPYK--FKTRKELFIAPEGLYTGQFVY 311
           +R+  + G V+ I +DP R + +A+V +      P      TR    +A +   TG  V 
Sbjct: 50  QRNTSLTGKVERIEYDPNRSSWIALVRWYSGSTQPQHQTASTRFTYILACDKFKTGSPVM 109

Query: 312 CGKKA--TLE--VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKR 479
               +   LE  +GN + +  +P GT++ N+E   G   +  RA+G FA +I        
Sbjct: 110 NNVHSFGNLEQALGNCVQLAYIPVGTLIHNIEWNPGQGAKFVRAAGTFAQLI--QKHEAT 167

Query: 480 TRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            R++LPSGA   + S  R  +GIV+      +   KAG++  ++  +R   P VRGVAM
Sbjct: 168 VRLRLPSGALASINSQCRATIGIVSNENHGKRNFRKAGQS--RWLGRR---PVVRGVAM 221


>UniRef50_Q39213 Cluster: Ribosomal protein L2; n=3; Arabidopsis
           thaliana|Rep: Ribosomal protein L2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 169

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 37/107 (34%), Positives = 58/107 (54%)
 Frame = +3

Query: 336 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           +G+ MP+G M  GTI+ N+E   G   ++ RA+G  A ++   P   +  +KLPSG  K 
Sbjct: 14  IGSSMPLGMMRIGTIIHNIEMNPGQGAKMVRAAGTNAKIL-KEPAKGKCLIKLPSGDTKW 72

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + +  R  +G V+      K + KAG++  ++   R   P VRGVAM
Sbjct: 73  INAKCRATIGTVSNPSHGTKKLYKAGQS--RWLGIR---PKVRGVAM 114


>UniRef50_A7CUV2 Cluster: Ribosomal protein L2; n=1; Opitutaceae
           bacterium TAV2|Rep: Ribosomal protein L2 - Opitutaceae
           bacterium TAV2
          Length = 288

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 46/158 (29%), Positives = 76/158 (48%), Gaps = 3/158 (1%)
 Frame = +3

Query: 192 HDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLE---VGNVMPVGA 362
           +DP R A LA++ + +       K   IAP GL  G  +    KATL     GN  P+  
Sbjct: 83  YDPNRTAHLALLKYENG-----DKRYIIAPLGLKVGAKIVTSNKATLNDYVTGNNYPLSI 137

Query: 363 MPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMV 542
           +P  T +  +E   G   +L R +G    ++    +    ++K+PSG  +++    R  +
Sbjct: 138 IPPSTKLHCVELVPGKGAQLGRTAGTSIELVA--VENGYAQLKMPSGEIRLVNPKCRATI 195

Query: 543 GIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           G V  G  +++ + KAGR  +++  KR   P VRG+ M
Sbjct: 196 GEVGNGEHMNRKLGKAGR--NRWLGKR---PRVRGMVM 228


>UniRef50_A5AS87 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 185

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 28/87 (32%), Positives = 53/87 (60%)
 Frame = -1

Query: 416 TSITHFLFKIAHNGTLRHSSNRHHISNFKSCFLSTINKLACVEPFGSNEELLPCLELVWI 237
           T++TH +  +AHNGTL   S R +I+N +   L+TI++L  V   G +E+L   L    +
Sbjct: 7   TTVTHMVLNVAHNGTLGDGSKRQYIANNEIGLLATIDELVGVHALGGDEQLFLMLVPEGV 66

Query: 236 AEVYNSQRCTSTRVMDYILNNSLDVSM 156
           AE  +S+   +  ++D + +++L+V++
Sbjct: 67  AEGNSSKWGAAIGIVDDLGDHTLEVAI 93


>UniRef50_P32611 Cluster: 54S ribosomal protein RML2, mitochondrial
           precursor; n=6; Ascomycota|Rep: 54S ribosomal protein
           RML2, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 393

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 34/110 (30%), Positives = 59/110 (53%)
 Frame = +3

Query: 327 TLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGA 506
           T + GN +P+  +P GTI+ N+       G+  R++G +A V+   P+ K+  V+L SG 
Sbjct: 234 TTQRGNCLPISMIPIGTIIHNVGITPVGPGKFCRSAGTYARVLAKLPEKKKAIVRLQSGE 293

Query: 507 KKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            + +       +G+V+     ++ + KAGR+  ++   R   P VRGVAM
Sbjct: 294 HRYVSLEAVATIGVVSNIDHQNRSLGKAGRS--RWLGIR---PTVRGVAM 338


>UniRef50_Q9AIG2 Cluster: Ribosomal protein L2; n=4; Bacteria|Rep:
           Ribosomal protein L2 - Carsonella ruddii
          Length = 235

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 50/165 (30%), Positives = 79/165 (47%), Gaps = 1/165 (0%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCG-KKATLEVG 341
           IKG+V+ I +DP R A +A++ + D       K   I    L    FV     K +L  G
Sbjct: 48  IKGIVESIHYDPNRNARIALIKYLD-----GEKRYIIKTNNLEISNFVVSSLNKISLNSG 102

Query: 342 NVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLP 521
           N   +  +  GT++  +E      G  +R+SG+ + +I    D K   +KLPSG KK + 
Sbjct: 103 NSTIIKNINIGTLINCVEIFPKIGGIFSRSSGSESEII--FKDNKFGVIKLPSGIKKKIS 160

Query: 522 SSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            +    +G +     + K + KAG+  +++   R   P VRGVAM
Sbjct: 161 LNCMATIGKIC-TFNVKKKLYKAGQ--NRW---RGIRPTVRGVAM 199


>UniRef50_P46763 Cluster: Mitochondrial 60S ribosomal protein L2;
           n=1; Acanthamoeba castellanii|Rep: Mitochondrial 60S
           ribosomal protein L2 - Acanthamoeba castellanii (Amoeba)
          Length = 253

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 45/164 (27%), Positives = 79/164 (48%)
 Frame = +3

Query: 165 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGN 344
           I G V  + +DP R + +A++ + +           +APEGL  G  ++  +   L+ GN
Sbjct: 55  IFGFVHRVEYDPKRNSLIALIVYSNGVM-----SYILAPEGLLVGDCIFAKENIVLKPGN 109

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
              +  +P G  + ++E       +  RA+G++AT+I  +   K   +KL SG  + + S
Sbjct: 110 STYLQHIPIGLKINSIELSENKGAQFIRAAGSYATII--SKFEKIVILKLKSGELRRVHS 167

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           +    +G ++    I +   KAG     Y++K    P VRGVAM
Sbjct: 168 NCMATIGSISNFQYIYRNFRKAG----FYRLK-GWLPVVRGVAM 206


>UniRef50_Q95299 Cluster: Ribosomal protein L8; n=1; Sus scrofa|Rep:
           Ribosomal protein L8 - Sus scrofa (Pig)
          Length = 106

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = -1

Query: 656 HGNTTYIWPAVTFDLVLVVCPSSFQNRFVNTSTSSNNTDHASVA*WQNLL 507
           HG+T + WPA+   L+LV+  +  QN  VN +TSS++TDH+ V    +LL
Sbjct: 55  HGHTPHAWPAIPLGLILVIGTAGLQNGLVNAATSSHHTDHSPVGRGDDLL 104


>UniRef50_A1CWB9 Cluster: 50S ribosomal protein L2; n=6;
           Eurotiomycetidae|Rep: 50S ribosomal protein L2 -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 404

 Score = 45.6 bits (103), Expect(2) = 7e-05
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 17/118 (14%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFK-------------TRKELFIAPEGLYT--GQFV 308
           +V+ I HDPGR A +A+V  ++  K                +  +   PE L+   G  V
Sbjct: 140 LVERIEHDPGRSAHIALVRSQETQKLSYILAAEGMRAGDVVQSYMSGIPEDLWKSMGGTV 199

Query: 309 YCGKKA--TLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAK 476
             G  A  T   GN +P+  +P GT++ N+  + G  G+L R++G +ATVI    D K
Sbjct: 200 DPGVLAARTAWRGNCLPLHMIPVGTLIFNVGLRPGKGGQLCRSAGTYATVISKGSDTK 257



 Score = 23.4 bits (48), Expect(2) = 7e-05
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +3

Query: 471 AKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGV 650
           A+   ++L SG  +++       VG+ +      + + KAGR+        N  P VRG+
Sbjct: 288 AQHVTIRLQSGEVRLIHKDCCATVGVASNPNHQYRQLGKAGRSRW-----LNIRPTVRGL 342

Query: 651 AM 656
           AM
Sbjct: 343 AM 344


>UniRef50_Q41912 Cluster: 50S ribosomal protein L2; n=10;
           Magnoliophyta|Rep: 50S ribosomal protein L2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 144

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 36/98 (36%), Positives = 51/98 (52%)
 Frame = +3

Query: 363 MPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMV 542
           MP GT + N+E  +G  G+LARA+G  A +I    + K   +KLPSG  +++  +    V
Sbjct: 3   MPLGTAIHNIEITLGRGGQLARAAGAVAKLIA--KEGKSATLKLPSGEVRLISKNCSATV 60

Query: 543 GIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           G V   G   K +   GRA  K  + +   P VRGV M
Sbjct: 61  GQVGNVGVNQKSL---GRAGSKCWLGKR--PVVRGVVM 93


>UniRef50_A5C022 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 128

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = +3

Query: 264 ELFIAPEGLYTGQFVYCGKKATLEVGNVMPVGAMPEG 374
           E  +  E +YTGQFV C KKATL V NV+P+ + PEG
Sbjct: 40  EPIVVAESIYTGQFVCCSKKATLIVDNVLPLRSTPEG 76


>UniRef50_Q9MTE5 Cluster: Ribosomal protein L2; n=1; Toxoplasma
           gondii|Rep: Ribosomal protein L2 - Toxoplasma gondii
          Length = 267

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 46/158 (29%), Positives = 76/158 (48%)
 Frame = +3

Query: 183 DIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPVGA 362
           +II+D  R   LAV +F      K     F+  + L  G  +  G KA L++GN +P+  
Sbjct: 67  NIIYDSFRRIFLAV-YFIINSIIKNIYRYFLLTKNLKIGSQINFGFKAPLKIGNALPLYK 125

Query: 363 MPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMV 542
           +  G+ + N+E +   +G L + + N   +I    D   T VKLPSG  K+L  +   ++
Sbjct: 126 ILLGSFIYNIEIRYKGKGSLVK-NANHNAIILMIGDIYVT-VKLPSGEIKLLLKNLFCIL 183

Query: 543 GIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           G +    +++K I K      K  ++    P +RG AM
Sbjct: 184 GQLEIRRKVNKNIKKHAGFNRKLSIR----PKIRGAAM 217


>UniRef50_A5DY19 Cluster: 60S ribosomal protein RML2, mitochondrial;
           n=2; Saccharomycetales|Rep: 60S ribosomal protein RML2,
           mitochondrial - Lodderomyces elongisporus (Yeast)
           (Saccharomyces elongisporus)
          Length = 376

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 33/109 (30%), Positives = 56/109 (51%)
 Frame = +3

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           L+ GN +P+  +P G+I+  +      R +L RA+G F  ++G + + +   +KL SG +
Sbjct: 220 LQRGNCLPLRMIPVGSIIHCIGLNSQRRSQLVRAAGTFGKILGKDQERQLAIIKLCSGEQ 279

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + +       +G+V+          KAGR   +Y  KR   P VRG+AM
Sbjct: 280 RYISLDCHATLGVVSNKEHQLISWGKAGR--RRYLGKR---PVVRGMAM 323


>UniRef50_Q2LZ31 Cluster: GA20496-PA; n=2; Diptera|Rep: GA20496-PA -
           Drosophila pseudoobscura (Fruit fly)
          Length = 297

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 35/109 (32%), Positives = 55/109 (50%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMP 353
           +V +I+HD  R A +A+V   D  K+    E   A + L T + +        E G+  P
Sbjct: 110 LVVEILHDGCRTAKVALVAVGDELKYILATENMKAGDVLKTSRVIPRIPVRPNE-GDAYP 168

Query: 354 VGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPS 500
           +GA+P GT +  LE+  G +  L  A+G F T++    D  +  V+LPS
Sbjct: 169 LGALPVGTRIHCLEKNPGQQCHLIHAAGTFGTILRKFDD--KVVVQLPS 215


>UniRef50_Q9G4C8 Cluster: Ribosomal protein L2; n=1;
           Thraustochytrium aureum|Rep: Ribosomal protein L2 -
           Thraustochytrium aureum
          Length = 236

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 42/162 (25%), Positives = 76/162 (46%), Gaps = 2/162 (1%)
 Frame = +3

Query: 177 VKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTG--QFVYCGKKATLEVGNVM 350
           V +  +DP R   + +VH  + + F+ R  + +AP+G + G   F +  +  +  +G   
Sbjct: 51  VLNFFYDPNRSCKVIIVH--NVHTFQPR--IVLAPKGAFQGINLFDFTKENPSNSIGCSQ 106

Query: 351 PVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSN 530
               +  G+ V +++     +    R++G+   V+    D   T VK+PS   K   S+ 
Sbjct: 107 FFHNINVGSYVYSIQSTPNSKMTFIRSAGSQGQVV--KKDHYFTFVKIPSSEVKKFSSNC 164

Query: 531 RGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           R  +G V         ++KAG +  +++ KR   P VRGVAM
Sbjct: 165 RACLGQVGNESHFLSSLMKAGES--RWRNKR---PKVRGVAM 201


>UniRef50_Q9AIM8 Cluster: Ribosomal protein L2; n=2; Candidatus
           Carsonella ruddii|Rep: Ribosomal protein L2 - Carsonella
           ruddii
          Length = 235

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 46/170 (27%), Positives = 84/170 (49%), Gaps = 1/170 (0%)
 Frame = +3

Query: 150 ERHGY-IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKA 326
           +R+ Y I G+V+ I +DP R A +A++ + D  K    K +    E   + + +      
Sbjct: 42  KRNKYNILGIVESIHYDPNRNAKIALIKYLDGDK----KYIIKTNELEVSDKIISSLNNV 97

Query: 327 TLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGA 506
            L+ GN   +  +  GT++   E     +G  +R++G+ + +I  N +     +KL SG 
Sbjct: 98  ILKPGNSTIIKNINVGTLINCFESIPKTKGIFSRSAGSESEIIFKNNNF--GIIKLSSGI 155

Query: 507 KKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           KK +  +    +G +     ++K + KAG+  +++K  R   P VRGVAM
Sbjct: 156 KKKISINCMATIGKIC-TFNLNKKLYKAGQ--NRWKGIR---PTVRGVAM 199


>UniRef50_Q9G918 Cluster: Ribosomal protein L2; n=1; Ochromonas
           danica|Rep: Ribosomal protein L2 - Ochromonas danica
          Length = 261

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 1/164 (0%)
 Frame = +3

Query: 168 KGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVY-CGKKATLEVGN 344
           K V+  + +D  R A L  ++F D  K K   +++   +  Y G  +     K+    G 
Sbjct: 75  KSVIIGVSYDSNRTA-LTSINF-DILKKKFFNDIYT--KDTYIGNIINRIDSKSEFRNGF 130

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
            + +  +P GTI+ N+      + +  +++GNFA +I    D +  ++KLPSG     P 
Sbjct: 131 RLLLKQIPTGTIINNIGNINSKKSKYVKSAGNFAELI--QKDTENAKLKLPSGKIIKHPI 188

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           ++   +G ++     +  I KAGR  ++   +R   P VRGVAM
Sbjct: 189 TSLATIGSISNEQLRNIVIGKAGR--NRNLGRR---PIVRGVAM 227


>UniRef50_Q2LCR9 Cluster: Ribosomal protein L2; n=3;
           Dictyosteliida|Rep: Ribosomal protein L2 - Dictyostelium
           citrinum
          Length = 266

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 33/113 (29%), Positives = 58/113 (51%)
 Frame = +3

Query: 318 KKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP 497
           K+  L+VG    +  +PEG ++ N+E       +L+RA+G  + +I    + K + VKL 
Sbjct: 102 KQGILQVGYTTKIKNIPEGILINNIELMENSGSKLSRAAGTSSLII-KQYNKKYSLVKLS 160

Query: 498 SGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           S   +++ +     +G V+    I+K I K+ +A      K+   P VRG+AM
Sbjct: 161 SKECRLISNECYATIGTVS---NIEKKIKKSKKASESR--KKGIRPIVRGLAM 208


>UniRef50_Q5IX18 Cluster: 50S ribosomal protein L2; n=1; Prototheca
           wickerhamii|Rep: 50S ribosomal protein L2 - Prototheca
           wickerhamii
          Length = 218

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
 Frame = +3

Query: 171 GVVKDIIHDPGRGAPLAVVHF---RDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVG 341
           G V+ + +DP R A LA++     R+  +  T     +AP G+  G  V CG  A +  G
Sbjct: 135 GTVERLEYDPIRSARLALLRLDGAREGERSPTSHAYVLAPAGVGPGDRVMCGATAPIVPG 194

Query: 342 NVMPVGAMPEGTIVCNLEEKMG 407
           + +P+ A+P G  + N+E + G
Sbjct: 195 SSLPLSAIPVGMPIHNVELRPG 216


>UniRef50_Q16XA5 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 719

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)
 Frame = -1

Query: 593 SSFQNRFVNTSTSSNNTDHASVA*WQNLLGSRR*LYSCTLSIRIVS--NHSGEVSR 432
           +S Q+  V+T+T+SNNT++ SV  WQN L +RR L + T  +R+ S  N   +V R
Sbjct: 30  TSLQDWLVDTTTASNNTNYGSVGRWQNFLDTRRQLVTGTHVLRLASCQNDQSQVVR 85


>UniRef50_Q8MYY5 Cluster: RE45450p; n=6; Endopterygota|Rep: RE45450p
           - Drosophila melanogaster (Fruit fly)
          Length = 294

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 33/109 (30%), Positives = 54/109 (49%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMP 353
           +V +++ D  R A +A+V   D  K+    E   A + L T +F+        E G+  P
Sbjct: 107 LVLEVLRDGCRTAKVALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNE-GDAYP 165

Query: 354 VGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPS 500
           +GA+P GT +  LE+  G    L  A+G F T++      ++  V+LPS
Sbjct: 166 LGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTIL--RKFDEKVVVQLPS 212


>UniRef50_A7QZU6 Cluster: Chromosome undetermined scaffold_288,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_288, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 315

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 24/94 (25%), Positives = 45/94 (47%)
 Frame = -1

Query: 542 DHASVA*WQNLLGSRR*LYSCTLSIRIVSNHSGEVSRGTCQTTSITHFLFKIAHNGTLRH 363
           +H S + W NLL  R  L      IR+V++ +  ++    + TSIT+ +F +   GT   
Sbjct: 68  NHCSASTWNNLLSPRWELDPAGAIIRVVADDNSSLAGCPGEDTSITNVIFNVTDLGTFGS 127

Query: 362 SSNRHHISNFKSCFLSTINKLACVEPFGSNEELL 261
            +   ++   +  FL+  N+LA V     ++  +
Sbjct: 128 RAQGQNVIGNEGGFLTAANELARVYALSHHDRFI 161


>UniRef50_Q4P5V2 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 467

 Score = 41.9 bits (94), Expect = 0.013
 Identities = 29/110 (26%), Positives = 57/110 (51%), Gaps = 4/110 (3%)
 Frame = +3

Query: 339 GNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDA----KRTRVKLPSGA 506
           GN +P+  +P GT + ++        ++ R++G F  ++  +  +       +V+L SG 
Sbjct: 303 GNFLPLNLIPIGTTIHSITINPLGPAKMVRSAGTFGQLVAFSGRSGGGDSHAQVRLQSGE 362

Query: 507 KKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
            +++PS+    +G V+      + + KAGR+  ++  +R   P VRGVAM
Sbjct: 363 VRLIPSNCCAAIGTVSNKDHQHRRLGKAGRS--RWLGRR---PKVRGVAM 407


>UniRef50_A7PXN3 Cluster: Chromosome chr12 scaffold_36, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr12 scaffold_36, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 166

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = -1

Query: 416 TSITHFLFKIAHNGTLRHSSNRHHISNFKSCFLSTINKLACVEPFGSNEELLPCLELVWI 237
           T +TH +  +AHNGTL   S R +I+N +   L+ +++L  V     +E+L   L    +
Sbjct: 19  TMVTHMVLNVAHNGTLGDGSKRQNIANNEIGLLAIVDELVGVHALDGDEQLFLMLVPEGM 78

Query: 236 AE 231
           AE
Sbjct: 79  AE 80


>UniRef50_Q5T653 Cluster: 39S ribosomal protein L2, mitochondrial
           precursor; n=24; Euteleostomi|Rep: 39S ribosomal protein
           L2, mitochondrial precursor - Homo sapiens (Human)
          Length = 305

 Score = 41.5 bits (93), Expect = 0.017
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 5/153 (3%)
 Frame = +3

Query: 153 RHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFV----YCGK 320
           + G  +  V  + +DP R A +A+V         +RK   IA E +  G  +    + G+
Sbjct: 118 KSGPFEEKVIQVRYDPCRSADIALV------AGGSRKRWIIATENMQAGDTILNSNHIGR 171

Query: 321 KATL-EVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP 497
            A     G+  P+GA+P GT++ N+E + G   +  RA+G    ++          ++LP
Sbjct: 172 MAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLL--RKVNGTAIIQLP 229

Query: 498 SGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGR 596
           S  +  +  +    VG V+      + I KAGR
Sbjct: 230 SKRQMQVLETCVATVGRVSNVDHNKRVIGKAGR 262


>UniRef50_Q7YN79 Cluster: Ribosomal protein L2; n=1; Eimeria
           tenella|Rep: Ribosomal protein L2 - Eimeria tenella
          Length = 273

 Score = 41.1 bits (92), Expect = 0.023
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 1/121 (0%)
 Frame = +3

Query: 297 GQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAK 476
           G  +Y G+   L++GN++P+  +P G+ + N+E          + S   A +I      K
Sbjct: 109 GDIIYIGETIELKIGNILPIKKIPCGSWIHNIEHNPTKGAVFVKNSKISAFLI--YIGKK 166

Query: 477 RTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRA-YHKYKVKRNCWPYVRGVA 653
              +KLPSG  ++L  +    V  + G   I    LK  +A +++   KR   P VRGVA
Sbjct: 167 YVTIKLPSGEIRLLNKN----VFCILGELNIIPLFLKKNKAGFNRLLGKR---PKVRGVA 219

Query: 654 M 656
           M
Sbjct: 220 M 220


>UniRef50_Q4S2E6 Cluster: Chromosome 17 SCAF14762, whole genome
           shotgun sequence; n=2; Eumetazoa|Rep: Chromosome 17
           SCAF14762, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 259

 Score = 40.7 bits (91), Expect = 0.030
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 5/145 (3%)
 Frame = +3

Query: 177 VKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFV----YCGKKA-TLEVG 341
           V ++ +DP R A +A+V   +      RK   IA E +  G  +      G+ A +   G
Sbjct: 111 VVEVRYDPCRSADIALVAGGN------RKRWIIATENMQAGDVIKTSAVIGRMAVSANEG 164

Query: 342 NVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLP 521
           +  P+GA+P GT+V NLE + G      RA+G    ++          V+LPS  +  + 
Sbjct: 165 DAYPLGALPVGTLVNNLEIQPGKGSEYIRAAGTSGVLL--RKVNGTAIVQLPSKQQVQVL 222

Query: 522 SSNRGMVGIVAGGGRIDKPILKAGR 596
            +    VG V+      + I KAGR
Sbjct: 223 ETCMVTVGRVSNIDHDKEIIGKAGR 247


>UniRef50_UPI00003617AD Cluster: 39S ribosomal protein L2,
           mitochondrial precursor (L2mt) (MRP-L2).; n=2;
           Deuterostomia|Rep: 39S ribosomal protein L2,
           mitochondrial precursor (L2mt) (MRP-L2). - Takifugu
           rubripes
          Length = 255

 Score = 40.3 bits (90), Expect = 0.040
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = +3

Query: 177 VKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKA-TLEVGNVMP 353
           V ++ +DP R A +A+V   +  ++    E   A + + T   +  G+ A + + G+  P
Sbjct: 77  VVEVRYDPCRSADIALVAGGNRKRWIIATENMQAEDIIKTSAVI--GRMAVSAKEGDAYP 134

Query: 354 VGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNR 533
           +GA+P GT+V NLE + G      RA+G    ++          V+LPS  +  +  +  
Sbjct: 135 LGALPVGTLVNNLEIQPGKGSEYIRAAGTSGVLL--RKVNGTAIVQLPSKQQVQVLETCM 192

Query: 534 GMVGIVAGGGRIDKPILKAGR 596
             VG V+      + I KAGR
Sbjct: 193 VTVGRVSNVDHNKEIIGKAGR 213


>UniRef50_Q3T1K8 Cluster: Rpl8 protein; n=8; Coelomata|Rep: Rpl8
           protein - Rattus norvegicus (Rat)
          Length = 47

 Score = 39.1 bits (87), Expect = 0.092
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>UniRef50_Q9G8Q6 Cluster: Ribosomal protein L2; n=1; Naegleria
           gruberi|Rep: Ribosomal protein L2 - Naegleria gruberi
          Length = 268

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 7/168 (4%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDP-YKFKTRKELFIAPEGLYTGQFVYCGKKAT--LEVGN 344
           VV+ + +DP R   + +V++++  Y F       +A    + G    C  K    L+ GN
Sbjct: 74  VVESLEYDPNRSGFINLVYYKNGIYSF------ILATHNTFIGNVYMCNMKFFDFLKTGN 127

Query: 345 VMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 524
                 +P G+IV N+     ++ +  R++G F  ++    +     VKLPS       +
Sbjct: 128 RSLFFNLPIGSIVHNVATTFNEKAKYLRSAGTFGLLL--KKENNMALVKLPSNKN----N 181

Query: 525 SNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCW----PYVRGVAM 656
           ++  +   + G G + K      R  +  K  R+ W    P VRGVAM
Sbjct: 182 NDVFLSCSLFGFGTLGKTSNLMQRNVNLGKAGRSRWLGIRPTVRGVAM 229


>UniRef50_Q2HAK3 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 382

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = +3

Query: 339 GNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVL 518
           GN +P+  +P GT+V N+  +M       R++G +AT+I    + +    K+ +G   V+
Sbjct: 154 GNCLPMHMIPVGTVVYNVGSRMDGGAVFCRSAGTYATIISKEEETRDDGTKVMTGKHVVV 213


>UniRef50_Q5DC89 Cluster: SJCHGC02322 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02322 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 393

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +3

Query: 339 GNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVI 455
           G+  PVGA+P GT++   E K G      R +G+ ATV+
Sbjct: 186 GDAYPVGALPVGTVISQFEIKPGQGALFCRTAGSSATVV 224


>UniRef50_Q5KGY0 Cluster: Ribosomal protein L2, putative; n=2;
           Filobasidiella neoformans|Rep: Ribosomal protein L2,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 481

 Score = 37.9 bits (84), Expect = 0.21
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = +3

Query: 318 KKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           +  TL+ GNV+P+  +P G  V N+   +  R +L R++G F  V+ H
Sbjct: 290 RTVTLKPGNVLPLYLIPPGMQVHNISLTVDGRMQLCRSAGTFGQVVSH 337


>UniRef50_O45110 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 321

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +3

Query: 339 GNVMPVGAMPEGTIVCNLEE-KMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKV 515
           GN  P+G++  GT++ ++E     D     +A+G  AT++ H  D   T VKLP   +  
Sbjct: 160 GNAYPIGSLAAGTVINSIERYPTMDSETFVKAAGTSATIVRHQGDF--TVVKLPHKHEFS 217

Query: 516 LPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVK 620
           L  +    VG ++    ID  I  + + + ++  K
Sbjct: 218 LHRTCMATVGRLSHAD-IDGKIFGSAQMHRRFGYK 251


>UniRef50_A1W550 Cluster: ApbE family lipoprotein precursor; n=1;
           Acidovorax sp. JS42|Rep: ApbE family lipoprotein
           precursor - Acidovorax sp. (strain JS42)
          Length = 362

 Score = 36.3 bits (80), Expect = 0.65
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 3/112 (2%)
 Frame = +3

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAK-RTRVKLPSGA 506
           L++G V  +  +  G  V    E+ G    L    G+   V+G   D   R  V+ PS  
Sbjct: 193 LDLGGVAKLPILQAGLQVL---ERAGVTDALVNGGGD-VLVMGRQHDRPWRVGVRNPSAP 248

Query: 507 KKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPY--VRGVAM 656
            ++L        G+VA  G  ++  L+AGR  H     R  WP   V GVA+
Sbjct: 249 AQLLGVLELQGRGVVASSGDYERGFLRAGRRLHHVLNPRTGWPTEGVSGVAL 300


>UniRef50_Q02CU7 Cluster: Tetratricopeptide TPR_2 repeat protein;
           n=1; Solibacter usitatus Ellin6076|Rep:
           Tetratricopeptide TPR_2 repeat protein - Solibacter
           usitatus (strain Ellin6076)
          Length = 731

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 4/108 (3%)
 Frame = -2

Query: 610 YLWYALPAFKIGLSIRPPPATIPTMPLLLD----GRTFLAPDGSFTLVRLASGLCPITVA 443
           + W+ L AF  G   +P   T+P + +LLD    GR  L+    F  +  AS L    V 
Sbjct: 172 WYWFTLAAFIAGSMAKPMMVTLPVVLVLLDVWPLGRRALSEKIPFFAISAASALTTFAVQ 231

Query: 442 KFPEARARRPLSPIFSSRLHTMVPSGIAPTGITFPTSRVAFFPQ*TNW 299
               A     + P+     + +V   +    + +P +   F+P  T++
Sbjct: 232 SGAGAVRNLAIFPLGLRIENALVTYVVYAAKMLWPANLAVFYPYPTDF 279


>UniRef50_Q2HG61 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 734

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 34/129 (26%), Positives = 49/129 (37%), Gaps = 3/129 (2%)
 Frame = -2

Query: 535 PLLLDGRTFLAPDGSFTLVRLASGLCPITVAKF--PEARARRPLSPIFSSRLHTMVPSGI 362
           P   DGRTF+       L     G C +   K   P A    P     SS   +  PSG 
Sbjct: 315 PFCEDGRTFIHQAADSVLEASQKGECAVLTVKVKPPPATTSTPTPSANSS--ESTDPSGP 372

Query: 361 AP-TGITFPTSRVAFFPQ*TNWPV*SPSGAMKSSFLVLNLYGSRKCTTAKGAPLPGSWII 185
            P T       RV   P  +++ +  P+ A++       +Y  R+   A  AP   +   
Sbjct: 373 RPRTRPATQEERVPIPPTISHFVMNLPATAIEFLSSYRGVYAGREALFAAAAPTSTTTTT 432

Query: 184 SLTTPLMYP 158
           + TTP + P
Sbjct: 433 TTTTPALPP 441


>UniRef50_O86372 Cluster: Putative uncharacterized protein; n=7;
           Mycobacterium tuberculosis complex|Rep: Putative
           uncharacterized protein - Mycobacterium tuberculosis
          Length = 116

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 16/59 (27%), Positives = 30/59 (50%)
 Frame = -2

Query: 655 MATPRTYGQQLRLTLYLWYALPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLV 479
           ++T R  G++   T   W  L  ++ G +  P P    T+ ++LDG   +  DG+ T++
Sbjct: 20  VSTMRLQGREAGRTERFWVGLSVYRPGGTAEPAPTREETVYVVLDGELVVTVDGAETVL 78


>UniRef50_A6NSE2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 348

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +3

Query: 384 CNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVL 518
           C+L+E+M +RG L R+  N+    G  PD  R  V+LP   ++++
Sbjct: 297 CDLKERMAERGILLRSCANYD---GLGPDYYRAAVRLPEENERLI 338


>UniRef50_Q0CD71 Cluster: Predicted protein; n=3;
           Trichocomaceae|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 471

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 23/56 (41%), Positives = 28/56 (50%), Gaps = 5/56 (8%)
 Frame = -2

Query: 565 RPPPA---TIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPIT--VAKFPEARARRP 413
           R PP    T+PT PL LDGRT    +G   LVR+A  L  +T    +    R  RP
Sbjct: 3   REPPQSQETVPTSPLDLDGRTL---EGGGQLVRIAVALAALTGQAIRINHIRGNRP 55


>UniRef50_UPI0000E48847 Cluster: PREDICTED: similar to titin isoform
            N2-A; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
            similar to titin isoform N2-A - Strongylocentrotus
            purpuratus
          Length = 10984

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 23/82 (28%), Positives = 35/82 (42%)
 Frame = +3

Query: 348  MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSS 527
            +P+   P  T+   ++EK  D GR  +AS    + +  N DA+RT     SG   +  S+
Sbjct: 8790 VPISGTPTPTVAWLMDEKQVDDGRRIKASTTTYSAVLTNKDARRT----DSGTYTIKISN 8845

Query: 528  NRGMVGIVAGGGRIDKPILKAG 593
              G          +DKP    G
Sbjct: 8846 KAGTDTATIRVAVLDKPSAPEG 8867


>UniRef50_UPI000065ED52 Cluster: Complement C5 precursor [Contains:
            Complement C5 beta chain; Complement C5 alpha chain; C5a
            anaphylatoxin; Complement C5 alpha' chain].; n=1;
            Takifugu rubripes|Rep: Complement C5 precursor [Contains:
            Complement C5 beta chain; Complement C5 alpha chain; C5a
            anaphylatoxin; Complement C5 alpha' chain]. - Takifugu
            rubripes
          Length = 1281

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 9/113 (7%)
 Frame = +3

Query: 195  DPGRGAPLAVVHFRDPYKFKTRKELFIAPEG----LYTG-----QFVYCGKKATLEVGNV 347
            +PG      V+  +   K    K+L + PEG    L +G     Q +Y  +K T+E+ N 
Sbjct: 819  EPGEHTLTFVLKTQHGQKDVVEKKLRVVPEGIKRELLSGGRLDPQGLYGSQKITVELKNT 878

Query: 348  MPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGA 506
            +P   +P  T+V   E  +   G +     +  T + H+PD  R  V LP+G+
Sbjct: 879  LPSNMVPN-TVV---ERMLTINGEVL----DDITSVVHSPDGLRQLVNLPAGS 923


>UniRef50_A3JMF2 Cluster: Glycosyl transferase, family 2; n=1;
           Rhodobacterales bacterium HTCC2150|Rep: Glycosyl
           transferase, family 2 - Rhodobacterales bacterium
           HTCC2150
          Length = 407

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 22/66 (33%), Positives = 36/66 (54%)
 Frame = +3

Query: 360 AMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGM 539
           A+PE T +CNL E   D+G +A A+G    V G N  + + R +L +G  + LP + +  
Sbjct: 88  AVPEPTWLCNLSEAFKDQG-VAAATG---FVRGRNGISFQWRGRLVNGQSQTLPITTKSD 143

Query: 540 VGIVAG 557
             ++ G
Sbjct: 144 DPMIVG 149


>UniRef50_A1TSE8 Cluster: TonB-dependent receptor, plug precursor;
           n=1; Acidovorax avenae subsp. citrulli AAC00-1|Rep:
           TonB-dependent receptor, plug precursor - Acidovorax
           avenae subsp. citrulli (strain AAC00-1)
          Length = 737

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 28/91 (30%), Positives = 43/91 (47%)
 Frame = -2

Query: 598 ALPAFKIGLSIRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARAR 419
           A  A ++GL++R  PA+I  +P     R  LA  GS T+   A     +    FP   A 
Sbjct: 55  AAAASRLGLTVRETPASIDVVP-----REMLAERGSRTVSEAAQAAVGVLAGDFPAEPAA 109

Query: 418 RPLSPIFSSRLHTMVPSGIAPTGITFPTSRV 326
             +    +S+++T+  +GI   G    TSRV
Sbjct: 110 FSMRGFANSQINTLY-NGI-KIGPPNMTSRV 138


>UniRef50_A0YL57 Cluster: Putative uncharacterized protein; n=1;
           Lyngbya sp. PCC 8106|Rep: Putative uncharacterized
           protein - Lyngbya sp. PCC 8106
          Length = 620

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 6/82 (7%)
 Frame = -2

Query: 568 IRPPPATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARRPLSPI--FS 395
           I P PAT+ + PL  D  +  +P  +  ++RLA+ L P  +A F  + + RPL  +   S
Sbjct: 171 IAPQPATVTSKPLPDDPNSPSSPALTPWMIRLAAQLDPAAIAPF-SSLSERPLDGLEQVS 229

Query: 394 SRLHTM----VPSGIAPTGITF 341
            R  T     VP G  P   TF
Sbjct: 230 DRHQTTLTFNVPVGWRPVVSTF 251


>UniRef50_Q17DQ5 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1433

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +3

Query: 378 IVCNLEEKMGDRGRLARASGNFATVIGHNP-DAKRTRVKLPSGAKKVLPSSNRGMVGIVA 554
           I CN   K+G     +R +GN        P D +RT+ K   G+ K+  +     VGIV 
Sbjct: 124 INCNESVKVGKSENTSRINGNQCNSSLATPIDGERTK-KEDDGSTKLCDTGGSTAVGIVG 182

Query: 555 GGG 563
           GGG
Sbjct: 183 GGG 185


>UniRef50_Q17A88 Cluster: Sensory neuron membrane protein-1; n=3;
           Culicidae|Rep: Sensory neuron membrane protein-1 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 529

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +3

Query: 375 TIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP--SGAKKVLPSSNRGMVGI 548
           T + N+       G  A+  G   TV+GH PD+K   V  P    AK +L +S R +  +
Sbjct: 452 TKMVNVTPVQSVNGSSAKGKGAGMTVVGHQPDSKGGSVTAPVIPSAKDLLQNS-RNLPTV 510

Query: 549 VAGGGRIDKP 578
           + G   +DKP
Sbjct: 511 IEG---LDKP 517


>UniRef50_A6R0K7 Cluster: Predicted protein; n=2;
           Pezizomycotina|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 325

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 17/42 (40%), Positives = 18/42 (42%)
 Frame = +2

Query: 434 WKLRHCDWTQS*C*AYKSKATVWSQEGSAIKQQRHGRYCCWR 559
           W L H DWT         K  +WS E S I   R G Y  WR
Sbjct: 48  WCLDHQDWTLE-----DWKRVIWSDEASVILLHRRGGYRIWR 84


>UniRef50_A3LYD9 Cluster: Hypothetical transcription factor; n=1;
           Pichia stipitis|Rep: Hypothetical transcription factor -
           Pichia stipitis (Yeast)
          Length = 756

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -1

Query: 443 EVSRGTCQTTSITHFLFKIAHNGTLRHSSNRHHISNFKSCFLSTINKLACVEPFGSN--E 270
           E S  T    S+ H L K      +  SSN +H+S  KS F + +N    V   G N   
Sbjct: 453 ENSHSTKNAHSVDHSLVKNRELDQVSSSSNSNHLSLKKSAFSNWLNNPNQVHTVGGNPSA 512

Query: 269 ELLPCLELVWIAEV-YNSQRCTSTRVMDYILNNSLD 165
            L+P   L+  ++  YNS    S      + NNS+D
Sbjct: 513 NLIPLSPLLNDSDTEYNSSNTAS------LNNNSID 542


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 704,553,869
Number of Sequences: 1657284
Number of extensions: 15309951
Number of successful extensions: 42668
Number of sequences better than 10.0: 83
Number of HSP's better than 10.0 without gapping: 41115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42623
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49586781480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -