SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1WWB7 Cluster: IP10750p; n=4; Diptera|Rep: IP10750p - ...    84   3e-15
UniRef50_UPI00015B4329 Cluster: PREDICTED: similar to receptor f...    74   3e-12
UniRef50_UPI0000D564C4 Cluster: PREDICTED: similar to CG13192-PA...    70   6e-11
UniRef50_A7RV82 Cluster: Predicted protein; n=1; Nematostella ve...    46   6e-04
UniRef50_Q51714 Cluster: Prolyl endopeptidase; n=6; Thermococcac...    40   0.052
UniRef50_UPI00015BACF2 Cluster: 4Fe-4S ferredoxin, iron-sulfur b...    40   0.069
UniRef50_Q7RG25 Cluster: Guanine nucleotide-binding protein beta...    38   0.16 
UniRef50_A2F8Z8 Cluster: EF hand family protein; n=1; Trichomona...    37   0.37 
UniRef50_A2EWI4 Cluster: Putative uncharacterized protein; n=2; ...    37   0.49 
UniRef50_Q6C0A7 Cluster: Yarrowia lipolytica chromosome F of str...    37   0.49 
UniRef50_UPI0000D56A87 Cluster: PREDICTED: similar to zinc finge...    36   0.85 
UniRef50_Q6CDF6 Cluster: Similar to sp|Q12220 Saccharomyces cere...    36   1.1  
UniRef50_A0DGC8 Cluster: Chromosome undetermined scaffold_5, who...    35   1.5  
UniRef50_A0BVL6 Cluster: Chromosome undetermined scaffold_13, wh...    35   1.5  
UniRef50_Q6FLI3 Cluster: Candida glabrata strain CBS138 chromoso...    35   1.5  
UniRef50_Q9LXF4 Cluster: Putative uncharacterized protein F8M21_...    34   2.6  
UniRef50_O16318 Cluster: Putative uncharacterized protein; n=2; ...    34   2.6  
UniRef50_A6NXK0 Cluster: Putative uncharacterized protein; n=1; ...    34   3.4  
UniRef50_Q8IB94 Cluster: Ubiquitin-protein ligase 1, putative; n...    34   3.4  
UniRef50_Q6L1T8 Cluster: Hypothetical phosphoglycerate kinase; n...    34   3.4  
UniRef50_Q1ZXS5 Cluster: Putative uncharacterized protein; n=3; ...    33   4.5  
UniRef50_Q5KDH7 Cluster: Putative uncharacterized protein; n=2; ...    33   4.5  
UniRef50_P48234 Cluster: WD repeat-containing protein YGR145W; n...    33   4.5  
UniRef50_A4ASD4 Cluster: Putative uncharacterized protein; n=2; ...    33   6.0  
UniRef50_Q18403 Cluster: Putative uncharacterized protein; n=2; ...    33   6.0  
UniRef50_Q6CFV3 Cluster: Similar to tr|Q9UTR9 Schizosaccharomyce...    33   6.0  
UniRef50_UPI0000F2DBC0 Cluster: PREDICTED: similar to partner an...    33   7.9  
UniRef50_Q9KBI4 Cluster: BH1943 protein; n=1; Bacillus haloduran...    33   7.9  
UniRef50_Q74C86 Cluster: NHL repeat domain protein; n=2; Geobact...    33   7.9  

>UniRef50_Q1WWB7 Cluster: IP10750p; n=4; Diptera|Rep: IP10750p -
           Drosophila melanogaster (Fruit fly)
          Length = 323

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 56/161 (34%), Positives = 83/161 (51%), Gaps = 8/161 (4%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILH 313
           PV+++R+ D   V SL F       +RLLAG+  G V+ ++LQTNR     +VG  PI  
Sbjct: 8   PVFSLRSPDMGAVNSLCFQ----ESDRLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITS 63

Query: 314 LIHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLAS-----LYVP 478
           L HT   L+TQEKGG + +F +  S Y ++  I  ++ GFCR   +T  +      L+ P
Sbjct: 64  LHHTPDRLVTQEKGGTITMFSIGGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYP 123

Query: 479 EKDYKINIYNFNGEKLGS--LEYDDASV-KLGDVMCLKFIE 592
            ++  I + +       +  L  DD  + KLG V C K  E
Sbjct: 124 CEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFKPFE 164


>UniRef50_UPI00015B4329 Cluster: PREDICTED: similar to receptor for
           activated C kinase, putative; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to receptor for
           activated C kinase, putative - Nasonia vitripennis
          Length = 319

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 42/126 (33%), Positives = 71/126 (56%), Gaps = 1/126 (0%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILH 313
           PVY +R  D  PV+SL F   P  +E L AG+++G V+ ++L  NR   K+     P L 
Sbjct: 8   PVYLMRG-DMGPVHSLMFRVSPY-IEHLYAGTESGRVHIWDLMKNREIFKLNTSNEPCLA 65

Query: 314 LIH-TDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDY 490
           + +  D   ITQ KGG +  ++  +S +  +  ++ DY GFCR + +T+ + L +P  D 
Sbjct: 66  MHNMADECFITQRKGGAINFWQARSSSWVINKTVDTDYCGFCRCQVSTE-SELLIPLNDS 124

Query: 491 KINIYN 508
           +I +++
Sbjct: 125 RIGLFS 130


>UniRef50_UPI0000D564C4 Cluster: PREDICTED: similar to CG13192-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG13192-PA - Tribolium castaneum
          Length = 312

 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 49/155 (31%), Positives = 88/155 (56%), Gaps = 2/155 (1%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAF-SFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPIL 310
           PV+ +++ D   ++SL F +       RLLA +++G+VY ++L+TNR+Q K  +G++  +
Sbjct: 8   PVFCLKS-DMGHIHSLCFPTTTEDYASRLLAATESGFVYFWDLETNRLQHKQSMGES--I 64

Query: 311 HLIHTDSH-LITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKD 487
             +H+ SH +ITQEK G +K + +TNS Y+          G+CR  +     +L VP++D
Sbjct: 65  QAVHSISHDIITQEKVGMVKFWTITNSSYQLSTSYTC-RGGYCR--SILLNDNLIVPQED 121

Query: 488 YKINIYNFNGEKLGSLEYDDASVKLGDVMCLKFIE 592
             ++I +       +        +LG+VMCL+ +E
Sbjct: 122 STLDIISIK-TMSKTARLVPLKHQLGNVMCLQKVE 155


>UniRef50_A7RV82 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 322

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 3/106 (2%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAFSFLP-GGLERLLAGSKNGYVYAYNLQTNRVQQKI--QVGQAP 304
           PVY +R      V +L F   P    E L++GS NG +  +NL+T RVQ  I    G+A 
Sbjct: 9   PVYVLRGTIG-SVNALKFVPKPISNDEMLVSGSSNGIISLWNLKTKRVQSSIDNHHGKAV 67

Query: 305 ILHLIHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRF 442
           I   +    +LI+  + GK+ ++++++S     + +E    GFC+F
Sbjct: 68  IELGLTNKPNLISHGRDGKIFIWDISSSEPRLLSQMEGPVLGFCKF 113


>UniRef50_Q51714 Cluster: Prolyl endopeptidase; n=6;
           Thermococcaceae|Rep: Prolyl endopeptidase - Pyrococcus
           furiosus
          Length = 616

 Score = 39.9 bits (89), Expect = 0.052
 Identities = 24/112 (21%), Positives = 52/112 (46%), Gaps = 2/112 (1%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPI--LHLIHTDSHLITQEKGGKLKVFELTNS 388
           L  G   G VY   +   +  +K+     P+  + +++   +++T+E  G  K+  + N 
Sbjct: 210 LTYGWNQGEVYIGPIDNPQEWKKVYSASVPVEAIDVVNGKLYILTKEGKGLGKIIAIKN- 268

Query: 389 GYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDYKINIYNFNGEKLGSLEYD 544
           G  ++ + E ++P         K+ +  +    YK+ +Y  NGEK+  + +D
Sbjct: 269 GKIDEVIPEGEFPLEWAVIVRDKILAGRLVHASYKLEVYTLNGEKIKEITFD 320


>UniRef50_UPI00015BACF2 Cluster: 4Fe-4S ferredoxin, iron-sulfur
           binding domain protein; n=1; Ignicoccus hospitalis
           KIN4/I|Rep: 4Fe-4S ferredoxin, iron-sulfur binding
           domain protein - Ignicoccus hospitalis KIN4/I
          Length = 244

 Score = 39.5 bits (88), Expect = 0.069
 Identities = 18/43 (41%), Positives = 27/43 (62%)
 Frame = +2

Query: 359 KLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKD 487
           ++K FEL ++GYE DA + V+  G   F+ NT L   Y+P K+
Sbjct: 185 QVKEFELRSTGYERDAAVVVNV-GLGDFDVNTSLKKFYMPHKE 226


>UniRef50_Q7RG25 Cluster: Guanine nucleotide-binding protein beta SU
           like protein; n=1; Plasmodium yoelii yoelii|Rep: Guanine
           nucleotide-binding protein beta SU like protein -
           Plasmodium yoelii yoelii
          Length = 296

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHL-IHTDSHLITQEKGGKLKVFELTNSG 391
           L++ S +GY+Y YNL  N    K+++ ++PI ++ I+ D ++    K   +K++ L N  
Sbjct: 174 LISSSYDGYIYFYNLNKNESPNKLEL-KSPIEYIHIYKDKYIFVAVK-NVIKIYSLENFD 231

Query: 392 YEEDAVI 412
           + +D  I
Sbjct: 232 FIKDITI 238


>UniRef50_A2F8Z8 Cluster: EF hand family protein; n=1; Trichomonas
           vaginalis G3|Rep: EF hand family protein - Trichomonas
           vaginalis G3
          Length = 876

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 4/87 (4%)
 Frame = +2

Query: 161 NVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPI---LHLIHT-D 328
           +VPV     S LP      L G +NGY+Y  +L+  +      V    +   +  I T +
Sbjct: 590 SVPVKITCISDLPNNETNFLVGCENGYIYVMDLEVEKPVSSFNVFHMTVPNKITCISTFE 649

Query: 329 SHLITQEKGGKLKVFELTNSGYEEDAV 409
             +      G +K F L N+G+EE +V
Sbjct: 650 GEIAVSNDRGYIKTFAL-NNGFEEISV 675


>UniRef50_A2EWI4 Cluster: Putative uncharacterized protein; n=2;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 476

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 20/81 (24%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +2

Query: 140 YTIRNVDNVPVYSLAFSFLPGGLE-RLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHL 316
           Y + ++ ++   S  F+ L   ++ +LL G+    +  +++    V Q+IQVG API+ +
Sbjct: 181 YNLSHLTSILGGSAQFTALDQTIDNKLLIGTSESSIAIFDVHLKSVVQQIQVGSAPIVSI 240

Query: 317 IHT-DSHLITQEKGGKLKVFE 376
            ++ D H +  +  G + ++E
Sbjct: 241 HNSRDYHYLVSDSDGVIYIYE 261


>UniRef50_Q6C0A7 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 367

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGGKLKVFELTNSGY 394
           LL  S++G VY Y++Q   V+         I+ L   D+ ++T    G +K+FEL     
Sbjct: 264 LLHASEDGRVYVYDIQDRTVRGSFDAHPGVIISLDVIDNKIVTCSLDGSVKLFELVEENS 323

Query: 395 EED 403
             D
Sbjct: 324 PSD 326


>UniRef50_UPI0000D56A87 Cluster: PREDICTED: similar to zinc finger
           protein 106 homolog; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to zinc finger protein 106 homolog -
           Tribolium castaneum
          Length = 789

 Score = 35.9 bits (79), Expect = 0.85
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 5/61 (8%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIH-----TDSHLITQEKGGKLKVFEL 379
           LLA S++G ++  N QT   +  +QV Q PI  L H      +SHL+       L+V+  
Sbjct: 515 LLAASESGRIFYINTQTGATEATLQVSQTPITCLCHIKTPSNESHLLVGSFEPWLRVYHY 574

Query: 380 T 382
           T
Sbjct: 575 T 575


>UniRef50_Q6CDF6 Cluster: Similar to sp|Q12220 Saccharomyces
           cerevisiae DOM34 interacting protein 2; n=1; Yarrowia
           lipolytica|Rep: Similar to sp|Q12220 Saccharomyces
           cerevisiae DOM34 interacting protein 2 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 912

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 15/60 (25%), Positives = 35/60 (58%)
 Frame = +2

Query: 209 ERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGGKLKVFELTNS 388
           ++++A + NG +  +NL+T    + +  G A  +  +  DS +I   K G++++F++ +S
Sbjct: 391 DKMVASTSNGQLKIWNLRTTNCIRSMDCGYALCVKFLPGDSLVIVGTKSGQIQLFDVASS 450


>UniRef50_A0DGC8 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_5,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 317

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 26/130 (20%), Positives = 60/130 (46%), Gaps = 6/130 (4%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPI--LHLIHTDSHLITQEKGGKLKVFELTNS 388
           L +G ++G++  ++L+  ++ + +Q+    +  ++      +  T +  G +K ++  + 
Sbjct: 123 LASGGQDGHLILWDLRKLKLIKDLQISMDIVYNINFSQQSKYFFTGDSMGVIKAYD--SQ 180

Query: 389 GYEEDAVIEVDYPGFCRFEANTKLAS----LYVPEKDYKINIYNFNGEKLGSLEYDDASV 556
             EE    +      C    + K++     L+V  K+  I+ YNF+G+K    + + + V
Sbjct: 181 KIEEIQNTKATQKNKCYAIQSLKISEDNYKLFVASKNQSISEYNFDGKKKELTKINQSPV 240

Query: 557 KLGDVMCLKF 586
               V CL F
Sbjct: 241 HCDSVHCLNF 250


>UniRef50_A0BVL6 Cluster: Chromosome undetermined scaffold_13, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_13,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 352

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = -2

Query: 364 KLSTFLLGYKVAVSVYKMKNRSLTNLYLLLN 272
           K +  L+G+K A+ V+K+KNR+L  L LL N
Sbjct: 28  KYNFLLVGHKYAIKVFKLKNRALITLNLLFN 58


>UniRef50_Q6FLI3 Cluster: Candida glabrata strain CBS138 chromosome
           L complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome L complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 579

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGGKLKVFEL 379
           L+ G+K+G VY ++L+  RV   ++  + PI  L +  S LIT       ++++L
Sbjct: 448 LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDL 502


>UniRef50_Q9LXF4 Cluster: Putative uncharacterized protein
           F8M21_170; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein F8M21_170 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 1227

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +2

Query: 374 ELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPE---KDYKINIYNFN 514
           EL + G+++D V      G+C +E + K A LY+ E   K YK ++Y++N
Sbjct: 348 ELEHLGFKQDEVTFGILIGWCCYEGDIKRAVLYLSEIMSKGYKPDVYSYN 397


>UniRef50_O16318 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 311

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +2

Query: 212 RLLAGSKNGYVYAYNLQTNRVQQKIQVGQAP----ILHLIHTDSHLITQEKGG-KLKVFE 376
           +LL GS+NG V A+ L++  ++  + V +       + +   D+ +  +     +L+  E
Sbjct: 27  QLLVGSQNGMVQAFGLESKIMEHIVYVDEEERRIQSIEISGNDTFVYIRSYAVLQLRKPE 86

Query: 377 LTNSGYEEDAVIEVDYPGFCRF 442
           ++ S ++    IEVD+ GFC F
Sbjct: 87  MSKSTWKVIRTIEVDHVGFCNF 108


>UniRef50_A6NXK0 Cluster: Putative uncharacterized protein; n=1;
            Bacteroides capillosus ATCC 29799|Rep: Putative
            uncharacterized protein - Bacteroides capillosus ATCC
            29799
          Length = 1886

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query: 188  SFLPGGLERLLAGSKNG---YVYAYNLQTNRVQQKIQVGQAPILHLIHTDSHLITQEKGG 358
            S++  GL RL   S++G     Y Y+  +NRVQ +    ++ +++  + +++ +  E GG
Sbjct: 1629 SYVYDGLGRLTQESESGGTTLTYVYDRNSNRVQMRATGAESYVVNYTYDEANRLLSETGG 1688

Query: 359  KLKVFELTNSGYE 397
            K     +T+  Y+
Sbjct: 1689 KNGSATVTSYTYD 1701


>UniRef50_Q8IB94 Cluster: Ubiquitin-protein ligase 1, putative; n=10;
            cellular organisms|Rep: Ubiquitin-protein ligase 1,
            putative - Plasmodium falciparum (isolate 3D7)
          Length = 8591

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 21/69 (30%), Positives = 29/69 (42%)
 Frame = +2

Query: 371  FELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDYKINIYNFNGEKLGSLEYDDA 550
            F  TN     D  I  D   FC FE N       V + + + N +++N   L SL+Y D 
Sbjct: 2604 FNNTNESLNYDNKINGDQNNFCTFEKNHINNIKEVKDSNNENNTFSYNNNFLFSLDYFDI 2663

Query: 551  SVKLGDVMC 577
               +  V C
Sbjct: 2664 LNTIRSVKC 2672


>UniRef50_Q6L1T8 Cluster: Hypothetical phosphoglycerate kinase; n=2;
           Thermoplasmatales|Rep: Hypothetical phosphoglycerate
           kinase - Picrophilus torridus
          Length = 192

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 35/156 (22%), Positives = 68/156 (43%), Gaps = 5/156 (3%)
 Frame = +2

Query: 122 FLRXPVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQA 301
           FLR   Y    + NV VY     F P   E ++ G        YN     + + ++ G++
Sbjct: 38  FLRS--YLNDEIMNVSVYDAWRFFGPMSNENVIKGYLYQARLMYNGYNKIISRALRNGES 95

Query: 302 PILHLIHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFC-RFEANTKLAS---L 469
            ++  ++ D  L   +   K+KVF +  S  E      +    +  + +   +LA    +
Sbjct: 96  MVIESLYFDPGLFDNDLFNKIKVFYIYISDIEIHRSRLLSRTMYTHKNDPGERLAEQLPV 155

Query: 470 YVPEKDYKI-NIYNFNGEKLGSLEYDDASVKLGDVM 574
           Y   +DY I    ++N +K+ ++ +D+    LGD++
Sbjct: 156 YKIMEDYSIKKCGDYNVKKIDNINFDETMELLGDLI 191


>UniRef50_Q1ZXS5 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 926

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 9/130 (6%)
 Frame = +2

Query: 209 ERLLAGSKNGYVYAYNLQTNRVQQKI-----QVGQAPILHL-IHTDSHLITQEKGGKLKV 370
           + LLAG + G++YAY +  NR   ++        +  ++ L +     L+     G+L  
Sbjct: 28  QTLLAGGRAGHLYAYTISANRRGFELTNICKSFHKKAVMELKVCQREDLLLCVSDGQLMA 87

Query: 371 FELTNSGYEEDAVIEVDYP--GFCRFEANTKLASLYVPEKDYKINIYNFN-GEKLGSLEY 541
            +L++  Y+ + +I    P   F RF   T    LYV     K  +Y F  GEK G  E+
Sbjct: 88  HKLSDPEYKVETLIHKVKPVQTFARFSPKTS-GDLYVIVSSRK-KLYLFKWGEKDGHKEF 145

Query: 542 DDASVKLGDV 571
            + ++    V
Sbjct: 146 IEVALDYNPV 155


>UniRef50_Q5KDH7 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1276

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +2

Query: 176 SLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVG-QAPILHLIHTDSHLITQEK 352
           +LA   LPG  E L   +  G     +L   +++ +++V  +  I+    T    +  +K
Sbjct: 598 TLAAGILPGA-ELLAQVTPRGLSLWSDLSVGQLEAQVEVDKETEIVCAQVTADWAVVAKK 656

Query: 353 GGKLKVFELTNSGYEEDAVIEV 418
           GG L VF ++N+G+     I+V
Sbjct: 657 GGSLVVFHVSNTGFSPQGTIDV 678


>UniRef50_P48234 Cluster: WD repeat-containing protein YGR145W;
           n=11; Saccharomycetales|Rep: WD repeat-containing
           protein YGR145W - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 707

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +2

Query: 137 VYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTN 268
           +Y   N+DN P      SF   GL     G+ NGY Y Y+L+T+
Sbjct: 218 LYLENNIDNRPFQVTTTSFRNDGLT-FACGTSNGYSYIYDLRTS 260


>UniRef50_A4ASD4 Cluster: Putative uncharacterized protein; n=2;
           Bacteria|Rep: Putative uncharacterized protein -
           Flavobacteriales bacterium HTCC2170
          Length = 502

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 21/68 (30%), Positives = 30/68 (44%)
 Frame = +2

Query: 317 IHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDYKI 496
           I TDS  +   K    K+ E+ N G  +DAV E +     R    T   ++YV + D  +
Sbjct: 49  ITTDSTQVASSKEFTGKIIEVKNGGSIQDAVKEANPGDLIRVYPGTYSENVYVDKDDISL 108

Query: 497 NIYNFNGE 520
                NGE
Sbjct: 109 QGVVINGE 116


>UniRef50_Q18403 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 326

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 1/79 (1%)
 Frame = +2

Query: 140 YTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLI 319
           +T+    N     L  SF P     ++ GS +GY+Y Y+++T  +  K         H+ 
Sbjct: 236 FTLEEHQNAQKIPLMASFTPES-SHIMVGSSDGYIYFYDVETGEIALKTLAPNNQTCHIA 294

Query: 320 H-TDSHLITQEKGGKLKVF 373
             +  H +      KL ++
Sbjct: 295 EFSPQHFVAATADTKLTLW 313


>UniRef50_Q6CFV3 Cluster: Similar to tr|Q9UTR9 Schizosaccharomyces
           pombe WD-repeat protein; n=1; Yarrowia lipolytica|Rep:
           Similar to tr|Q9UTR9 Schizosaccharomyces pombe WD-repeat
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 428

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +2

Query: 215 LLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTD-SHLITQEKGGKLKVFEL 379
           L++G ++G+V+ ++L T R     +     IL L+  D +HL+TQ +  KL V+ L
Sbjct: 30  LVSGDESGWVFWWSLVTRRPLAIWKAHHEAILSLVWMDETHLLTQGRDDKLYVWRL 85


>UniRef50_UPI0000F2DBC0 Cluster: PREDICTED: similar to partner and
            localizer of BRCA2; n=1; Monodelphis domestica|Rep:
            PREDICTED: similar to partner and localizer of BRCA2 -
            Monodelphis domestica
          Length = 1141

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 3/57 (5%)
 Frame = +2

Query: 179  LAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVG---QAPILHLIHTDSHLI 340
            LAF+ + G  + LL  +    +  +NL+T ++ +K+Q+G   QA I H  ++D  L+
Sbjct: 969  LAFAEIQGMQDALLGTTLTSNIVIWNLKTGQLLKKMQIGNSYQASICHKAYSDMGLL 1025


>UniRef50_Q9KBI4 Cluster: BH1943 protein; n=1; Bacillus
           halodurans|Rep: BH1943 protein - Bacillus halodurans
          Length = 323

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +2

Query: 224 GSKNGYVYAYNLQTNRVQQKIQVGQAPILHLIHTDSH 334
           G  N  ++AYN++T  + Q+++VG  PI   I+ D H
Sbjct: 206 GDLNKRIFAYNIKTGVIDQEVEVGLMPI--TIYQDQH 240


>UniRef50_Q74C86 Cluster: NHL repeat domain protein; n=2;
           Geobacter|Rep: NHL repeat domain protein - Geobacter
           sulfurreducens
          Length = 354

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 29/126 (23%), Positives = 51/126 (40%), Gaps = 5/126 (3%)
 Frame = +2

Query: 200 GGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQ----API-LHLIHTDSHLITQEKGGKL 364
           GG    ++ S +G V+  +L   +V   ++ G     +P+ L L  +    ++     K+
Sbjct: 100 GGTLLFVSDSSSGVVHRIDLARQKVSYIVRAGDEFLSSPVGLALSPSGDLYVSDSVNAKV 159

Query: 365 KVFELTNSGYEEDAVIEVDYPGFCRFEANTKLASLYVPEKDYKINIYNFNGEKLGSLEYD 544
            VF          A  +VD+        N+K     V    +K+ ++N +G  LG    D
Sbjct: 160 YVFSRDGEFLRVLADGQVDFKRPAGLAVNSKGVLFVVDVLAHKLKVFNVSGRFLGDFPPD 219

Query: 545 DASVKL 562
           D   KL
Sbjct: 220 DIGGKL 225


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 584,724,014
Number of Sequences: 1657284
Number of extensions: 11013642
Number of successful extensions: 28330
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 27447
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28318
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -