SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62857 Cluster: 40S ribosomal protein S28; n=137; Eukar...    87   1e-16
UniRef50_Q10421 Cluster: 40S ribosomal protein S28; n=13; Eukary...    74   1e-12
UniRef50_UPI0000E1F4D9 Cluster: PREDICTED: similar to ribosomal ...    73   2e-12
UniRef50_Q9SR73 Cluster: 40S ribosomal protein S28-1; n=13; Magn...    66   2e-10
UniRef50_Q4WGB8 Cluster: Ribosomal protein S28e; n=9; Fungi/Meta...    61   1e-08
UniRef50_Q5EMS8 Cluster: 40S ribosomal protein S28-like protein;...    58   5e-08
UniRef50_Q8TVE7 Cluster: 30S ribosomal protein S28e; n=11; cellu...    55   5e-07
UniRef50_Q57U30 Cluster: 40S ribosomal protein S33, putative; n=...    54   1e-06
UniRef50_P54065 Cluster: 30S ribosomal protein S28e; n=27; Archa...    52   4e-06
UniRef50_A2VEJ7 Cluster: IP17744p; n=1; Drosophila melanogaster|...    51   1e-05
UniRef50_Q3LVV1 Cluster: Ribosomal protein S28; n=1; Bigelowiell...    50   2e-05
UniRef50_Q980Q5 Cluster: 30S ribosomal protein S28e; n=14; Archa...    47   1e-04
UniRef50_Q3V3R3 Cluster: 16 days neonate cerebellum cDNA, RIKEN ...    47   2e-04
UniRef50_UPI0000EC9EE1 Cluster: UPI0000EC9EE1 related cluster; n...    46   3e-04
UniRef50_Q8SQM2 Cluster: 40S RIBOSOMAL PROTEIN S28; n=1; Encepha...    44   9e-04
UniRef50_P57710 Cluster: 30S ribosomal protein S28e; n=9; Euryar...    44   9e-04
UniRef50_Q5THV0 Cluster: OTTHUMP00000028879; n=1; Homo sapiens|R...    43   0.003
UniRef50_Q9IMU3 Cluster: VP1; n=5; Banna virus|Rep: VP1 - Banna ...    34   1.3  
UniRef50_UPI0000DB6B2B Cluster: PREDICTED: similar to CG8561-PA;...    32   3.9  
UniRef50_A3JPB4 Cluster: Phage integrase; n=3; Rhodobacterales b...    32   3.9  
UniRef50_Q21QM6 Cluster: Putative uncharacterized protein precur...    31   8.9  
UniRef50_Q9U2X3 Cluster: Putative uncharacterized protein; n=2; ...    31   8.9  
UniRef50_A7S7T2 Cluster: Predicted protein; n=2; Nematostella ve...    31   8.9  

>UniRef50_P62857 Cluster: 40S ribosomal protein S28; n=137;
           Eukaryota|Rep: 40S ribosomal protein S28 - Homo sapiens
           (Human)
          Length = 69

 Score = 87.4 bits (207), Expect = 1e-16
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>UniRef50_Q10421 Cluster: 40S ribosomal protein S28; n=13;
           Eukaryota|Rep: 40S ribosomal protein S28 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 68

 Score = 74.1 bits (174), Expect = 1e-12
 Identities = 35/49 (71%), Positives = 42/49 (85%)
 Frame = +2

Query: 80  PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 226
           P  LA+V+KVLGRTGS+G  TQV+VEF+ +TSR IIRNVKGPVR+ DIL
Sbjct: 7   PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55


>UniRef50_UPI0000E1F4D9 Cluster: PREDICTED: similar to ribosomal
           protein S28; n=2; Catarrhini|Rep: PREDICTED: similar to
           ribosomal protein S28 - Pan troglodytes
          Length = 356

 Score = 73.3 bits (172), Expect = 2e-12
 Identities = 34/44 (77%), Positives = 39/44 (88%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPV 208
           +P  LARV KVLGRTGSQGQCTQV+V+F+ +TSR IIRNVKGPV
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVKFMDDTSRSIIRNVKGPV 50


>UniRef50_Q9SR73 Cluster: 40S ribosomal protein S28-1; n=13;
           Magnoliophyta|Rep: 40S ribosomal protein S28-1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 64

 Score = 66.5 bits (155), Expect = 2e-10
 Identities = 34/53 (64%), Positives = 42/53 (79%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MD     A VVKV+GRTGS+GQ TQV+V+F  ++ R I+RNVKGPVR+GDILT
Sbjct: 1   MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRYIMRNVKGPVREGDILT 52


>UniRef50_Q4WGB8 Cluster: Ribosomal protein S28e; n=9; Fungi/Metazoa
           group|Rep: Ribosomal protein S28e - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 56

 Score = 60.9 bits (141), Expect = 1e-08
 Identities = 28/43 (65%), Positives = 35/43 (81%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGP 205
           +P  L +V +VLGRTGS+G  TQV+VEF+ +TSR IIRNVKGP
Sbjct: 6   QPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGP 48


>UniRef50_Q5EMS8 Cluster: 40S ribosomal protein S28-like protein;
           n=2; Sordariomycetes|Rep: 40S ribosomal protein S28-like
           protein - Magnaporthe grisea (Rice blast fungus)
           (Pyricularia grisea)
          Length = 85

 Score = 58.4 bits (135), Expect = 5e-08
 Identities = 27/43 (62%), Positives = 34/43 (79%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGP 205
           +P  L +V +VLGRTGS+G  TQV+VEF+ + SR IIRNVKGP
Sbjct: 6   QPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRNVKGP 48


>UniRef50_Q8TVE7 Cluster: 30S ribosomal protein S28e; n=11; cellular
           organisms|Rep: 30S ribosomal protein S28e - Methanopyrus
           kandleri
          Length = 74

 Score = 55.2 bits (127), Expect = 5e-07
 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +2

Query: 92  ARVVKVLGRTGSQGQCTQVKVEFI--GETSRQIIRNVKGPVRDGDIL 226
           A VV++LGRTG  G+ TQVKV  +   +  R I RNVKGPVR+GDIL
Sbjct: 15  AEVVEILGRTGMAGEVTQVKVRILEGPDKGRIITRNVKGPVREGDIL 61


>UniRef50_Q57U30 Cluster: 40S ribosomal protein S33, putative; n=1;
           Trypanosoma brucei|Rep: 40S ribosomal protein S33,
           putative - Trypanosoma brucei
          Length = 103

 Score = 54.0 bits (124), Expect = 1e-06
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 5/49 (10%)
 Frame = +2

Query: 98  VVKVLGRTGSQGQCTQVKVEFIG-----ETSRQIIRNVKGPVRDGDILT 229
           ++KVLGRTGS+G  TQV+V  +      E +R I+RNVKGP ++GD+L+
Sbjct: 43  IIKVLGRTGSRGNVTQVRVRLMAEEGSPEANRTIVRNVKGPCKEGDMLS 91


>UniRef50_P54065 Cluster: 30S ribosomal protein S28e; n=27;
           Archaea|Rep: 30S ribosomal protein S28e - Methanococcus
           jannaschii
          Length = 75

 Score = 52.0 bits (119), Expect = 4e-06
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 2/52 (3%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIG--ETSRQIIRNVKGPVRDGDIL 226
           K  V A V++V+GRTG  G   QV+ + +G  +T R ++RNVKGPV+ GDI+
Sbjct: 8   KEAVAAEVIEVIGRTGVTGGIIQVRCKILGGKDTGRVLVRNVKGPVKVGDII 59


>UniRef50_A2VEJ7 Cluster: IP17744p; n=1; Drosophila
           melanogaster|Rep: IP17744p - Drosophila melanogaster
           (Fruit fly)
          Length = 73

 Score = 50.8 bits (116), Expect = 1e-05
 Identities = 21/44 (47%), Positives = 32/44 (72%)
 Frame = +2

Query: 92  ARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 223
           ARV+K+L R G++G  T+V+V+ + +   Q +R VKGPVR GD+
Sbjct: 7   ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDV 50


>UniRef50_Q3LVV1 Cluster: Ribosomal protein S28; n=1; Bigelowiella
           natans|Rep: Ribosomal protein S28 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 65

 Score = 49.6 bits (113), Expect = 2e-05
 Identities = 22/43 (51%), Positives = 31/43 (72%)
 Frame = +2

Query: 98  VVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 226
           V K+L + G +GQ TQV+V+ I    + +IRN+KGPVR GDI+
Sbjct: 13  VTKILKKVGKRGQGTQVRVKSITNIKKTLIRNIKGPVRIGDIV 55


>UniRef50_Q980Q5 Cluster: 30S ribosomal protein S28e; n=14;
           Archaea|Rep: 30S ribosomal protein S28e - Sulfolobus
           solfataricus
          Length = 83

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +2

Query: 92  ARVVKVLGRTGSQGQCTQVKVEFIG--ETSRQIIRNVKGPVRDGDIL 226
           A V+++L RTG  G+ TQV+V  +   +  R + RNVKGPVR GDIL
Sbjct: 21  AEVIQILDRTGVTGEVTQVRVRVLEGRDKGRILTRNVKGPVRVGDIL 67


>UniRef50_Q3V3R3 Cluster: 16 days neonate cerebellum cDNA, RIKEN
           full-length enriched library, clone:9630014M24
           product:hypothetical protein, full insert sequence; n=2;
           Mus musculus|Rep: 16 days neonate cerebellum cDNA, RIKEN
           full-length enriched library, clone:9630014M24
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 148

 Score = 46.8 bits (106), Expect = 2e-04
 Identities = 26/43 (60%), Positives = 28/43 (65%)
 Frame = -2

Query: 219 SPSRTGPFTFLMI*RLVSPMNSTFT*VHWP*EPVRPSTFTTRA 91
           SP RTGP TF M  RLVS ++ST T  H P EPV PST  T A
Sbjct: 84  SPFRTGPLTFQMKERLVSFIDSTPTCAHCPCEPVLPSTLVTLA 126


>UniRef50_UPI0000EC9EE1 Cluster: UPI0000EC9EE1 related cluster; n=1;
           Gallus gallus|Rep: UPI0000EC9EE1 UniRef100 entry -
           Gallus gallus
          Length = 112

 Score = 46.0 bits (104), Expect = 3e-04
 Identities = 22/53 (41%), Positives = 30/53 (56%)
 Frame = -1

Query: 265 SQPPSFTFRFKKSEDVSVTDGSFHVSDDLTAGLPNELDLHLSTLALRTSTAKH 107
           +QPP    R ++ EDVS+     HV+DD  A + +EL  HLS L L    A+H
Sbjct: 56  AQPPRLALRLEQGEDVSLPHRPLHVADDGAARVVHELHAHLSALPLGAGPAQH 108


>UniRef50_Q8SQM2 Cluster: 40S RIBOSOMAL PROTEIN S28; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S28
           - Encephalitozoon cuniculi
          Length = 65

 Score = 44.4 bits (100), Expect = 9e-04
 Identities = 24/51 (47%), Positives = 29/51 (56%)
 Frame = +2

Query: 74  DKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 226
           ++      V  VLGRTG  G  TQVK+E +    R I R VKGPV  GDI+
Sbjct: 3   EQQEFFGEVTHVLGRTGGSGLLTQVKMELM-HNKRTIQRAVKGPVAVGDII 52


>UniRef50_P57710 Cluster: 30S ribosomal protein S28e; n=9;
           Euryarchaeota|Rep: 30S ribosomal protein S28e -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 74

 Score = 44.4 bits (100), Expect = 9e-04
 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 2/47 (4%)
 Frame = +2

Query: 92  ARVVKVLGRTGSQGQCTQVK--VEFIGETSRQIIRNVKGPVRDGDIL 226
           A V++V+G+TG  G+  QVK  ++  G   R I RNV GPVR GD++
Sbjct: 13  AEVIEVVGKTGMHGEAMQVKCRIQEGGNQGRIITRNVLGPVRVGDVI 59


>UniRef50_Q5THV0 Cluster: OTTHUMP00000028879; n=1; Homo sapiens|Rep:
           OTTHUMP00000028879 - Homo sapiens (Human)
          Length = 57

 Score = 42.7 bits (96), Expect = 0.003
 Identities = 20/37 (54%), Positives = 26/37 (70%)
 Frame = +2

Query: 80  PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIR 190
           P  L +  KVLGRT SQGQCT+V VEF+   S+++ R
Sbjct: 8   PVKLVKATKVLGRTSSQGQCTRVCVEFMVSQSKRLRR 44


>UniRef50_Q9IMU3 Cluster: VP1; n=5; Banna virus|Rep: VP1 - Banna virus
          Length = 1219

 Score = 33.9 bits (74), Expect = 1.3
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = -1

Query: 238  FKKSEDVSVTDGSFHVSDDLTAGLPNELDLHLSTLALRTSTAKHFHDTSKNV 83
            FK+  DV+   G  H+S+ L   +P   + HL+ L  +T   K   D + ++
Sbjct: 963  FKRKNDVNPDGGGIHISEGLKRLMPEYCERHLNELVYKTLDDKVIRDYTSDI 1014


>UniRef50_UPI0000DB6B2B Cluster: PREDICTED: similar to CG8561-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG8561-PA
           - Apis mellifera
          Length = 623

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = -1

Query: 175 AGLPNELDLHLSTLALRTSTAKHFHDTSKNVGFIH 71
           +GL N  DL+LS+  L+  TA  F D  +N+G++H
Sbjct: 455 SGLENLKDLNLSSNKLQKITADMFADLPQNLGYLH 489


>UniRef50_A3JPB4 Cluster: Phage integrase; n=3; Rhodobacterales
           bacterium HTCC2150|Rep: Phage integrase -
           Rhodobacterales bacterium HTCC2150
          Length = 298

 Score = 32.3 bits (70), Expect = 3.9
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 3/75 (4%)
 Frame = +2

Query: 8   RNTPALVARVLIALSSILQAKMDKPNVLARVVKV--LGRTGSQGQ-CTQVKVEFIGETSR 178
           R+ P +      AL  +L AK D P +  R      L  TG+    C  +K  F G+T+ 
Sbjct: 185 RSLPVVSDSATKALQKLLGAKSDSPYLFPRYASCGYLNNTGASATLCKHLKKSFNGKTTH 244

Query: 179 QIIRNVKGPVRDGDI 223
            +  + +  +RD D+
Sbjct: 245 CLRHSFRDRLRDCDV 259


>UniRef50_Q21QM6 Cluster: Putative uncharacterized protein
           precursor; n=1; Rhodoferax ferrireducens T118|Rep:
           Putative uncharacterized protein precursor - Rhodoferax
           ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)
          Length = 240

 Score = 31.1 bits (67), Expect = 8.9
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = -1

Query: 235 KKSEDVSVTDGSFHVSDDLTAGLPNELDLHLSTLALRTSTAK 110
           K   D+ VT   + V+D +T GLP+   +H+S ++ + S  K
Sbjct: 113 KMRHDILVTAVYWRVNDHVTNGLPSSQPIHMSQMSRKASEPK 154


>UniRef50_Q9U2X3 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 158

 Score = 31.1 bits (67), Expect = 8.9
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%)
 Frame = +1

Query: 1   CFSKHASFGCTC---AYCIKLDITSQNG*TQRSC 93
           C S H+ +   C   +YC+   ITS+NG  QRSC
Sbjct: 27  CLSGHSQYATQCTSQSYCVS--ITSKNGPVQRSC 58


>UniRef50_A7S7T2 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 238

 Score = 31.1 bits (67), Expect = 8.9
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +2

Query: 98  VVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           V+  LG T S    T++ V+F+ ET RQ++   K P+   D+ T
Sbjct: 173 VIAALGNTWSHAVNTRLIVQFLDETYRQVM-IAKSPIAPFDVFT 215


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 386,244,992
Number of Sequences: 1657284
Number of extensions: 6675683
Number of successful extensions: 15758
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 15453
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15750
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 18196175969
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -