SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A12
         (413 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P63220 Cluster: 40S ribosomal protein S21; n=8; Bilater...    68   9e-11
UniRef50_Q16H14 Cluster: Putative uncharacterized protein; n=1; ...    67   2e-10
UniRef50_Q9CQR2 Cluster: 40S ribosomal protein S21; n=10; Euther...    66   3e-10
UniRef50_Q9BYK2 Cluster: Ribosomal protein S21; n=6; Coelomata|R...    63   2e-09
UniRef50_Q13666 Cluster: 8.2 kDa differentiation factor; n=2; Ho...    63   2e-09
UniRef50_Q7ZUG5 Cluster: 40S ribosomal protein S21; n=42; Coelom...    63   2e-09
UniRef50_P49197 Cluster: 40S ribosomal protein S21; n=8; Metazoa...    61   1e-08
UniRef50_UPI0000DA1AA9 Cluster: PREDICTED: similar to 40S riboso...    60   2e-08
UniRef50_Q4RDV7 Cluster: Chromosome undetermined SCAF15610, whol...    59   4e-08
UniRef50_P05764 Cluster: 40S ribosomal protein S21; n=17; Dikary...    56   2e-07
UniRef50_Q2HVJ1 Cluster: Ribosomal protein S21e; n=1; Medicago t...    56   3e-07
UniRef50_A6SK20 Cluster: 40S ribosomal protein S21; n=28; Fungi/...    56   4e-07
UniRef50_P35687 Cluster: 40S ribosomal protein S21; n=14; Eukary...    55   7e-07
UniRef50_Q41852 Cluster: 40S ribosomal protein S21; n=8; Eukaryo...    54   2e-06
UniRef50_Q9SMI2 Cluster: 40S ribosomal protein S21; n=7; Eukaryo...    54   2e-06
UniRef50_P0C0V8 Cluster: 40S ribosomal protein S21-A; n=11; Euka...    52   6e-06
UniRef50_Q3E902 Cluster: 40S ribosomal protein S21-2; n=4; Arabi...    51   1e-05
UniRef50_UPI0000E23711 Cluster: PREDICTED: similar to 8.2 kDa di...    47   1e-04
UniRef50_Q7R2D7 Cluster: GLP_623_72066_72335; n=1; Giardia lambl...    47   1e-04
UniRef50_Q00U69 Cluster: Ribosomal protein S21-maize; n=1; Ostre...    42   0.007
UniRef50_Q4E3L9 Cluster: 40S ribosomal protein S21, putative; n=...    38   0.062
UniRef50_Q98SD3 Cluster: 40S ribosomal protein S21; n=1; Guillar...    38   0.081
UniRef50_A0BWW0 Cluster: Chromosome undetermined scaffold_133, w...    36   0.33 
UniRef50_P93184 Cluster: Lipoxygenase 2.1, chloroplast precursor...    35   0.76 
UniRef50_A0QBT4 Cluster: Putative uncharacterized protein; n=2; ...    33   3.1  
UniRef50_Q128J8 Cluster: Sulfatase; n=5; Burkholderiales|Rep: Su...    32   5.3  
UniRef50_UPI0000499913 Cluster: 40S ribosomal protein S21; n=1; ...    31   7.1  
UniRef50_Q8C1R7 Cluster: Adult male testis cDNA, RIKEN full-leng...    31   7.1  
UniRef50_UPI0000D9D58F Cluster: PREDICTED: similar to olfactory ...    31   9.3  
UniRef50_UPI0000D57151 Cluster: PREDICTED: hypothetical protein;...    31   9.3  
UniRef50_Q9I7U4-3 Cluster: Isoform B of Q9I7U4 ; n=6; Sophophora...    31   9.3  
UniRef50_Q08YQ3 Cluster: Putative uncharacterized protein; n=1; ...    31   9.3  
UniRef50_A3XS22 Cluster: Putative uncharacterized protein; n=1; ...    31   9.3  
UniRef50_A3M7X5 Cluster: Putative uncharacterized protein; n=1; ...    31   9.3  
UniRef50_Q9I7U4 Cluster: Titin; n=7; Endopterygota|Rep: Titin - ...    31   9.3  

>UniRef50_P63220 Cluster: 40S ribosomal protein S21; n=8;
           Bilateria|Rep: 40S ribosomal protein S21 - Homo sapiens
           (Human)
          Length = 83

 Score = 67.7 bits (158), Expect = 9e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 2e-09
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>UniRef50_Q16H14 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 95

 Score = 66.9 bits (156), Expect = 2e-10
 Identities = 29/50 (58%), Positives = 38/50 (76%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKN 298
           Q+ I DV+P TGR  +TS +Y +C  IRR+GESDDCIVRL KK+  ++KN
Sbjct: 45  QINIVDVNPVTGRMLETSTVYAICDVIRRLGESDDCIVRLAKKNLKISKN 94



 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = +1

Query: 37  GRTYKMQNDAGEFVDLYCPRKCSASNRLIHAKDHA 141
           GR+ K  NDAG FVDLYCPRKCS+S R+IHAKDHA
Sbjct: 10  GRSSK--NDAGGFVDLYCPRKCSSSKRIIHAKDHA 42


>UniRef50_Q9CQR2 Cluster: 40S ribosomal protein S21; n=10;
           Eutheria|Rep: 40S ribosomal protein S21 - Mus musculus
           (Mouse)
          Length = 83

 Score = 66.1 bits (154), Expect = 3e-10
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDRTTGRFNGQFKTYGICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 2e-09
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIAAKDHAS 31


>UniRef50_Q9BYK2 Cluster: Ribosomal protein S21; n=6; Coelomata|Rep:
           Ribosomal protein S21 - Homo sapiens (Human)
          Length = 66

 Score = 63.3 bits (147), Expect = 2e-09
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>UniRef50_Q13666 Cluster: 8.2 kDa differentiation factor; n=2; Homo
           sapiens|Rep: 8.2 kDa differentiation factor - Homo
           sapiens (Human)
          Length = 97

 Score = 63.3 bits (147), Expect = 2e-09
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>UniRef50_Q7ZUG5 Cluster: 40S ribosomal protein S21; n=42;
           Coelomata|Rep: 40S ribosomal protein S21 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 81

 Score = 63.3 bits (147), Expect = 2e-09
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31



 Score = 60.9 bits (141), Expect = 1e-08
 Identities = 28/49 (57%), Positives = 35/49 (71%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAK 295
           Q+ IA+VD  TGR     K Y +CGAIRRMGE+DD ++RL K D I+AK
Sbjct: 33  QINIAEVDRVTGRFNGQFKTYAICGAIRRMGEADDSLLRLAKTDSIVAK 81


>UniRef50_P49197 Cluster: 40S ribosomal protein S21; n=8;
           Metazoa|Rep: 40S ribosomal protein S21 - Caenorhabditis
           elegans
          Length = 88

 Score = 60.9 bits (141), Expect = 1e-08
 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 1/51 (1%)
 Frame = +2

Query: 149 QLVIADVDPATGRAAD-TSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKN 298
           Q+   DVDP TGR     S  Y +CGAIRRMGESDD I+RL +KDG++ ++
Sbjct: 33  QIDFVDVDPETGRMIPGKSTRYAICGAIRRMGESDDAILRLAQKDGLVPRD 83



 Score = 54.0 bits (124), Expect = 1e-06
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAG+ V+LY PRKCS+SNR+I  KDHAS
Sbjct: 1   MQNDAGQTVELYVPRKCSSSNRIIGPKDHAS 31


>UniRef50_UPI0000DA1AA9 Cluster: PREDICTED: similar to 40S ribosomal
           protein S21; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to 40S ribosomal protein S21 - Rattus norvegicus
          Length = 326

 Score = 59.7 bits (138), Expect = 2e-08
 Identities = 30/65 (46%), Positives = 37/65 (56%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTASDXXXXXXXXXXXXXI*NVCCLWGYP 231
           +QNDAGEFVDLY PRKCS+SN +I  KDH S   +                N+  L G+ 
Sbjct: 261 VQNDAGEFVDLYVPRKCSSSNHIITVKDHTSIQLNVAKVDRSTGWFNGQFKNLQHLRGHS 320

Query: 232 KDGRV 246
           +DGRV
Sbjct: 321 QDGRV 325


>UniRef50_Q4RDV7 Cluster: Chromosome undetermined SCAF15610, whole
           genome shotgun sequence; n=2; Deuterostomia|Rep:
           Chromosome undetermined SCAF15610, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 51

 Score = 58.8 bits (136), Expect = 4e-08
 Identities = 27/48 (56%), Positives = 32/48 (66%)
 Frame = +2

Query: 152 LVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAK 295
           L +  VD  TGR     K Y +CGAIRRMGESDD I+RL K D ++AK
Sbjct: 4   LHLPQVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKNDSVIAK 51


>UniRef50_P05764 Cluster: 40S ribosomal protein S21; n=17;
           Dikarya|Rep: 40S ribosomal protein S21 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 87

 Score = 56.4 bits (130), Expect = 2e-07
 Identities = 23/31 (74%), Positives = 28/31 (90%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           M+N+AG+ VDLY PRKCSA+NR+I AKDHAS
Sbjct: 1   MENEAGQLVDLYVPRKCSATNRIIQAKDHAS 31



 Score = 41.9 bits (94), Expect = 0.005
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKM-YVVCGAIRRMGESDDCIVRLTKKDGIL 289
           Q+ +  VD A GR     K  Y + G +R  GESDDCI RLT +DG+L
Sbjct: 33  QINVCAVD-AEGRQIPGEKTTYAISGFVRSKGESDDCINRLTTQDGLL 79


>UniRef50_Q2HVJ1 Cluster: Ribosomal protein S21e; n=1; Medicago
           truncatula|Rep: Ribosomal protein S21e - Medicago
           truncatula (Barrel medic)
          Length = 106

 Score = 56.0 bits (129), Expect = 3e-07
 Identities = 24/34 (70%), Positives = 28/34 (82%)
 Frame = +1

Query: 43  TYKMQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           T KMQN+ G+  +LY PRKCSA+NRLI AKDHAS
Sbjct: 23  TLKMQNEEGQITELYIPRKCSATNRLITAKDHAS 56


>UniRef50_A6SK20 Cluster: 40S ribosomal protein S21; n=28;
           Fungi/Metazoa group|Rep: 40S ribosomal protein S21 -
           Botryotinia fuckeliana B05.10
          Length = 88

 Score = 55.6 bits (128), Expect = 4e-07
 Identities = 24/35 (68%), Positives = 27/35 (77%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 156
           M+ND GE VDLY PRKCSA+NR+I AKDH S   S
Sbjct: 1   MENDKGELVDLYVPRKCSATNRIIKAKDHGSVQIS 35



 Score = 50.4 bits (115), Expect = 1e-05
 Identities = 24/47 (51%), Positives = 33/47 (70%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGIL 289
           Q+ IA VD   GRA   +++Y +CG IR MGESDD + RL ++DG+L
Sbjct: 33  QISIAKVDE-NGRATGENQVYALCGFIRAMGESDDSLNRLAQRDGLL 78


>UniRef50_P35687 Cluster: 40S ribosomal protein S21; n=14;
           Eukaryota|Rep: 40S ribosomal protein S21 - Oryza sativa
           subsp. japonica (Rice)
          Length = 82

 Score = 54.8 bits (126), Expect = 7e-07
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQN+ G+ VDLY PRKCSA+NR+I AKDHAS
Sbjct: 1   MQNEEGQMVDLYVPRKCSATNRIITAKDHAS 31


>UniRef50_Q41852 Cluster: 40S ribosomal protein S21; n=8;
           Eukaryota|Rep: 40S ribosomal protein S21 - Zea mays
           (Maize)
          Length = 81

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQN+ G+ VDLY PRKCSA+NR+I AKDHAS
Sbjct: 1   MQNEEGKTVDLYVPRKCSATNRIITAKDHAS 31


>UniRef50_Q9SMI2 Cluster: 40S ribosomal protein S21; n=7;
           Eukaryota|Rep: 40S ribosomal protein S21 - Cyanophora
           paradoxa
          Length = 82

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 23/31 (74%), Positives = 26/31 (83%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQND G+ VDLY PRKCSA+NRLI A DHA+
Sbjct: 1   MQNDEGKIVDLYIPRKCSATNRLISATDHAA 31



 Score = 37.5 bits (83), Expect = 0.11
 Identities = 17/46 (36%), Positives = 25/46 (54%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGI 286
           Q+ +  VDP +G        + +CG +R MGESD  + RL  K G+
Sbjct: 33  QINVGHVDPNSGLYTGDYTTFALCGFVRSMGESDAALNRLCVKHGL 78


>UniRef50_P0C0V8 Cluster: 40S ribosomal protein S21-A; n=11;
           Eukaryota|Rep: 40S ribosomal protein S21-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 87

 Score = 51.6 bits (118), Expect = 6e-06
 Identities = 21/31 (67%), Positives = 26/31 (83%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           M+ND G+ V+LY PRKCSA+NR+I A DHAS
Sbjct: 1   MENDKGQLVELYVPRKCSATNRIIKADDHAS 31



 Score = 34.7 bits (76), Expect = 0.76
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKM-YVVCGAIRRMGESDDCIVRLTKKDGIL 289
           Q+ +A VD   GRA     + Y + G +R  GESDD + RL + DG+L
Sbjct: 33  QINVAKVDEE-GRAIPGEYVTYALSGYVRSRGESDDSLNRLAQNDGLL 79


>UniRef50_Q3E902 Cluster: 40S ribosomal protein S21-2; n=4;
           Arabidopsis thaliana|Rep: 40S ribosomal protein S21-2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 85

 Score = 50.8 bits (116), Expect = 1e-05
 Identities = 21/31 (67%), Positives = 26/31 (83%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQN+ G+  +LY PRKCSA+NRLI +KDHAS
Sbjct: 1   MQNEEGQVTELYIPRKCSATNRLITSKDHAS 31


>UniRef50_UPI0000E23711 Cluster: PREDICTED: similar to 8.2 kDa
           differentiation factor, partial; n=1; Pan
           troglodytes|Rep: PREDICTED: similar to 8.2 kDa
           differentiation factor, partial - Pan troglodytes
          Length = 60

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 20/29 (68%), Positives = 23/29 (79%)
 Frame = +1

Query: 58  NDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           N+A EFVDLY PRKCS S+ +I AKDH S
Sbjct: 1   NNASEFVDLYIPRKCSTSHHVIGAKDHTS 29


>UniRef50_Q7R2D7 Cluster: GLP_623_72066_72335; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_623_72066_72335 - Giardia lamblia
           ATCC 50803
          Length = 89

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 21/35 (60%), Positives = 25/35 (71%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 156
           M+N +G  VD Y PRKCSA+NRLI  KDHA+   S
Sbjct: 8   MKNSSGVVVDAYIPRKCSATNRLIGPKDHAAVQLS 42


>UniRef50_Q00U69 Cluster: Ribosomal protein S21-maize; n=1;
           Ostreococcus tauri|Rep: Ribosomal protein S21-maize -
           Ostreococcus tauri
          Length = 101

 Score = 41.5 bits (93), Expect = 0.007
 Identities = 21/31 (67%), Positives = 22/31 (70%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           M N  GE VDLY PRKCS +NRLI A D AS
Sbjct: 29  MINADGENVDLYIPRKCSWTNRLITATDKAS 59


>UniRef50_Q4E3L9 Cluster: 40S ribosomal protein S21, putative; n=4;
           Trypanosoma cruzi|Rep: 40S ribosomal protein S21,
           putative - Trypanosoma cruzi
          Length = 251

 Score = 38.3 bits (85), Expect = 0.062
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +1

Query: 58  NDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           N+ G  VDLY PRKC A+N LI + DH++
Sbjct: 8   NEEGVNVDLYIPRKCHATNNLITSYDHSA 36



 Score = 32.3 bits (70), Expect = 4.0
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGIL 289
           Q+ IA+VD A G    T+  + + G +RR  ESD  I  L    GI+
Sbjct: 38  QIAIANVD-ANGVLNGTTTTFCIAGYLRRQAESDHAINHLAISKGII 83


>UniRef50_Q98SD3 Cluster: 40S ribosomal protein S21; n=1; Guillardia
           theta|Rep: 40S ribosomal protein S21 - Guillardia theta
           (Cryptomonas phi)
          Length = 82

 Score = 37.9 bits (84), Expect = 0.081
 Identities = 18/35 (51%), Positives = 22/35 (62%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 156
           M +   + V  Y PRKCS SN+LI+ KDHAS   S
Sbjct: 1   MNSTNKKIVGEYIPRKCSLSNKLINNKDHASIQIS 35


>UniRef50_A0BWW0 Cluster: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 147

 Score = 35.9 bits (79), Expect = 0.33
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           M ND  + VD+Y PRKC  +N ++++ D++S
Sbjct: 1   MINDEKQVVDIYVPRKCQYTNMILNSSDYSS 31


>UniRef50_P93184 Cluster: Lipoxygenase 2.1, chloroplast precursor;
           n=14; Magnoliophyta|Rep: Lipoxygenase 2.1, chloroplast
           precursor - Hordeum vulgare (Barley)
          Length = 936

 Score = 34.7 bits (76), Expect = 0.76
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
 Frame = +2

Query: 11  ASVNSVYRVDVHIKCRTTPVN-SLTCTAR----GNARPATASSTLRTMLQXQLVIADVDP 175
           A+V +V R DVH++ RT       T T         R       L+T L   LV +++DP
Sbjct: 67  AAVGTVTRPDVHVQDRTHATEMKATVTVHMSKAAGVRDFLYDLILKTWLHVDLVSSELDP 126

Query: 176 ATGRAADTSKMYVVCGAIRRMGESDD 253
            TG+  +      + GA++  G  DD
Sbjct: 127 QTGQEREP-----ISGAVKHSGRVDD 147


>UniRef50_A0QBT4 Cluster: Putative uncharacterized protein; n=2;
           Mycobacterium avium|Rep: Putative uncharacterized
           protein - Mycobacterium avium (strain 104)
          Length = 188

 Score = 32.7 bits (71), Expect = 3.1
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 2/75 (2%)
 Frame = +2

Query: 32  RVDVHIKCRTTPVNSLTCTARGNARPATASSTLRTMLQXQLVI--ADVDPATGRAADTSK 205
           RVD    C   P NS  C   G      A++     L   ++I  +DVD   GRAA T  
Sbjct: 92  RVDAAYHC-PHPANSCDCRKPGPGMLLRAAAEHDVDLAASVMIGDSDVDMVAGRAAGTKT 150

Query: 206 MYVVCGAIRRMGESD 250
           + +  GA + + E+D
Sbjct: 151 ILIRPGARQAVAEAD 165


>UniRef50_Q128J8 Cluster: Sulfatase; n=5; Burkholderiales|Rep:
           Sulfatase - Polaromonas sp. (strain JS666 / ATCC
           BAA-500)
          Length = 564

 Score = 31.9 bits (69), Expect = 5.3
 Identities = 24/80 (30%), Positives = 35/80 (43%)
 Frame = +2

Query: 2   LFFASVNSVYRVDVHIKCRTTPVNSLTCTARGNARPATASSTLRTMLQXQLVIADVDPAT 181
           LFF S+ SV R   H++    P+NS     R  A+P   + ++   L     +A  D A 
Sbjct: 174 LFFQSIASVMRNYTHVRYLINPLNSFYALGRVAAQPFQRNESIVLPLGEDARLAASDAA- 232

Query: 182 GRAADTSKMYVVCGAIRRMG 241
             AA    + +V G   R G
Sbjct: 233 --AAKPPLLLLVLGETARSG 250


>UniRef50_UPI0000499913 Cluster: 40S ribosomal protein S21; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S21 - Entamoeba histolytica HM-1:IMSS
          Length = 86

 Score = 31.5 bits (68), Expect = 7.1
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +1

Query: 76  VDLYCPRKCSASNRLIHAKDHAS 144
           ++LY PR CS ++ LI A DHA+
Sbjct: 7   IELYIPRHCSVTHTLIAADDHAA 29


>UniRef50_Q8C1R7 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:1700009P10 product:hypothetical
           Serine-rich region containing protein, full insert
           sequence; n=2; Mus musculus|Rep: Adult male testis cDNA,
           RIKEN full-length enriched library, clone:1700009P10
           product:hypothetical Serine-rich region containing
           protein, full insert sequence - Mus musculus (Mouse)
          Length = 112

 Score = 31.5 bits (68), Expect = 7.1
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = +2

Query: 11  ASVNSVYRVDVHIKCRTTPVNSLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGRA 190
           AS ++ Y       C T P  SLT   RG   P T+S+ LR+       ++    ++ R+
Sbjct: 28  ASASAAYCRLSRAGCSTLPTPSLTVPLRGGRGPRTSSACLRSAFSRSYCVSSCSLSSRRS 87

Query: 191 ADTS 202
           + ++
Sbjct: 88  SSST 91


>UniRef50_UPI0000D9D58F Cluster: PREDICTED: similar to olfactory
           receptor, family 7, subfamily D, member 4; n=1; Macaca
           mulatta|Rep: PREDICTED: similar to olfactory receptor,
           family 7, subfamily D, member 4 - Macaca mulatta
          Length = 400

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = -3

Query: 138 MVLSVDEAVAGRAFPRAVQVNEFTGVVLH 52
           +VL +D AVA  +FP  +Q+++ T ++LH
Sbjct: 247 VVLGIDVAVAIGSFPWHIQIHKLTSIILH 275


>UniRef50_UPI0000D57151 Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 106

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%)
 Frame = +1

Query: 13  ICQFRVPCGRTYKMQNDAGEFVDLYCPRKCSAS--NRLIHAKDHASXTA 153
           ICQ R PCG  + + N    F+D +   KC  +   R +   D  S TA
Sbjct: 45  ICQGRTPCG--WAVYNKMTRFIDYFMRNKCECNKEKRCLRDDDDISITA 91


>UniRef50_Q9I7U4-3 Cluster: Isoform B of Q9I7U4 ; n=6; Sophophora|Rep:
            Isoform B of Q9I7U4 - Drosophila melanogaster (Fruit fly)
          Length = 17903

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 14   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 187
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 2935 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDL---LGC 2991

Query: 188  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 289
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 2992 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 3025


>UniRef50_Q08YQ3 Cluster: Putative uncharacterized protein; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Putative
           uncharacterized protein - Stigmatella aurantiaca DW4/3-1
          Length = 536

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 19/66 (28%), Positives = 33/66 (50%)
 Frame = -3

Query: 285 IPSFFVNLTMQSSDSPILRIAPQTTYILDVSAARPVAGSTSAITSCX*SMVLSVDEAVAG 106
           IP+  V     +++S +  IAPQ  YILD S    +    + +T    ++V++  ++  G
Sbjct: 398 IPAQIVTTVPFANNSRLAAIAPQRVYILDASTGATLNKDQAPLTPTG-ALVVNQVQSGGG 456

Query: 105 RAFPRA 88
             FP A
Sbjct: 457 GQFPEA 462


>UniRef50_A3XS22 Cluster: Putative uncharacterized protein; n=1;
           Vibrio sp. MED222|Rep: Putative uncharacterized protein
           - Vibrio sp. MED222
          Length = 292

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = -2

Query: 253 IIRLSHPSDSPTDNIHFRCVSSTT 182
           IIR   PS +P +NI F+C++ TT
Sbjct: 104 IIREVRPSKTPLENIRFKCINRTT 127


>UniRef50_A3M7X5 Cluster: Putative uncharacterized protein; n=1;
           Acinetobacter baumannii ATCC 17978|Rep: Putative
           uncharacterized protein - Acinetobacter baumannii
           (strain ATCC 17978 / NCDC KC 755)
          Length = 562

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +2

Query: 95  GNARPATASSTLRTMLQXQLVIADVDPATGRAADTSKMYVVCGAIRRM--GESDDCIVRL 268
           GN     ASST + ++Q  LVI+D +    R A +    ++  A  ++  G +D+ I  +
Sbjct: 269 GNTINCQASSTDKAIIQSNLVISDCN----RNATSKLPNILFPANEKLIAGNNDEGICDV 324

Query: 269 TKKDGIL 289
           T+KDG+L
Sbjct: 325 TEKDGLL 331


>UniRef50_Q9I7U4 Cluster: Titin; n=7; Endopterygota|Rep: Titin -
            Drosophila melanogaster (Fruit fly)
          Length = 18074

 Score = 31.1 bits (67), Expect = 9.3
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 14   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 187
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 1299 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDL---LGC 1355

Query: 188  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 289
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 1356 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 1389


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 346,964,772
Number of Sequences: 1657284
Number of extensions: 6064201
Number of successful extensions: 15372
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 15081
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15367
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 19042509735
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -