SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q969Q0 Cluster: 60S ribosomal protein L36a-like; n=88; ...    82   5e-15
UniRef50_P83881 Cluster: 60S ribosomal protein L36a; n=44; Fungi...    82   5e-15
UniRef50_P48166 Cluster: 60S ribosomal protein L44; n=79; Eukary...    80   2e-14
UniRef50_A7P2V5 Cluster: Chromosome chr1 scaffold_5, whole genom...    71   9e-12
UniRef50_A3BKG6 Cluster: Putative uncharacterized protein; n=1; ...    55   8e-07
UniRef50_Q5KA45 Cluster: Putative uncharacterized protein; n=1; ...    41   0.015
UniRef50_A2DAI6 Cluster: 60S ribosomal protein L44, putative; n=...    38   0.10 
UniRef50_Q3LWA2 Cluster: Ribosomal protein L44; n=1; Bigelowiell...    36   0.31 
UniRef50_A3BKG7 Cluster: Putative uncharacterized protein; n=1; ...    36   0.31 
UniRef50_Q6DCL0 Cluster: Asb15-prov protein; n=4; Tetrapoda|Rep:...    32   5.1  
UniRef50_Q00TJ9 Cluster: Chromosome 17 contig 1, DNA sequence; n...    32   5.1  
UniRef50_Q17E08 Cluster: Putative uncharacterized protein; n=1; ...    32   5.1  
UniRef50_Q9DB68 Cluster: Adult male cerebellum cDNA, RIKEN full-...    32   6.7  
UniRef50_Q5CXE3 Cluster: Transcription factor E2F wHTH only; n=3...    32   6.7  

>UniRef50_Q969Q0 Cluster: 60S ribosomal protein L36a-like; n=88;
           Eukaryota|Rep: 60S ribosomal protein L36a-like - Homo
           sapiens (Human)
          Length = 106

 Score = 82.2 bits (194), Expect = 5e-15
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 2.9
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>UniRef50_P83881 Cluster: 60S ribosomal protein L36a; n=44;
           Fungi/Metazoa group|Rep: 60S ribosomal protein L36a -
           Homo sapiens (Human)
          Length = 106

 Score = 82.2 bits (194), Expect = 5e-15
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 2.9
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>UniRef50_P48166 Cluster: 60S ribosomal protein L44; n=79;
           Eukaryota|Rep: 60S ribosomal protein L44 -
           Caenorhabditis elegans
          Length = 105

 Score = 80.2 bits (189), Expect = 2e-14
 Identities = 33/57 (57%), Positives = 42/57 (73%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KPIF         IVLR+EC +CK + Q+ +KRCKHFELGG KK +GQ+IQF
Sbjct: 49  FGGQTKPIFRKKAKTTKKIVLRMECTECKHKKQLPIKRCKHFELGGQKKSRGQVIQF 105



 Score = 31.9 bits (69), Expect = 6.7
 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = +3

Query: 111 MVNVPKQRRTY-XXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+             +QYKK KE   AQG
Sbjct: 1   MVNVPKARRTFCDGKCRKHTNHKVTQYKKGKESKFAQG 38


>UniRef50_A7P2V5 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=9; Eukaryota|Rep: Chromosome chr1
           scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 151

 Score = 71.3 bits (167), Expect = 9e-12
 Identities = 31/52 (59%), Positives = 36/52 (69%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           YGGQ+KP+F         IVLRL+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 96  YGGQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKGKG 147


>UniRef50_A3BKG6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 89

 Score = 54.8 bits (126), Expect = 8e-07
 Identities = 23/34 (67%), Positives = 27/34 (79%)
 Frame = +2

Query: 308 IVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 409
           IVL+L+C  CK  SQ  +KRCKHFE+GGDKK KG
Sbjct: 52  IVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKG 85


>UniRef50_Q5KA45 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 147

 Score = 40.7 bits (91), Expect = 0.015
 Identities = 26/48 (54%), Positives = 29/48 (60%)
 Frame = +3

Query: 255 TVVSPNPSSKRRQKPLRKLCSVLSVQIAR*DHRLH*RDASTLSSVVTR 398
           TVV P+ SS RR +P R+L SV S   AR        DAST SSVVTR
Sbjct: 55  TVVRPSLSSTRRLRPPRRLSSVSSALSARPSTNSPSSDASTSSSVVTR 102


>UniRef50_A2DAI6 Cluster: 60S ribosomal protein L44, putative; n=1;
           Trichomonas vaginalis G3|Rep: 60S ribosomal protein L44,
           putative - Trichomonas vaginalis G3
          Length = 104

 Score = 37.9 bits (84), Expect = 0.10
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = +2

Query: 248 RXYGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRK 406
           + +GG+ KPI          I LR  C  CK  +   L R + FE   +KK+K
Sbjct: 46  KGFGGRVKPILRRSKKTSKKISLRFTCQSCKKATMYCLGRLRKFEWTVEKKKK 98


>UniRef50_Q3LWA2 Cluster: Ribosomal protein L44; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L44 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 99

 Score = 36.3 bits (80), Expect = 0.31
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFEL 385
           YGGQ+KP+F           ++L C  CK     +LKR K F++
Sbjct: 48  YGGQTKPVFRKQVKNTKKPSIKLSCEICKKEFIKSLKRTKRFQI 91


>UniRef50_A3BKG7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 76

 Score = 36.3 bits (80), Expect = 0.31
 Identities = 13/18 (72%), Positives = 17/18 (94%)
 Frame = +2

Query: 356 ALKRCKHFELGGDKKRKG 409
           +++RCKHFE+GGDKK KG
Sbjct: 55  SVQRCKHFEIGGDKKGKG 72


>UniRef50_Q6DCL0 Cluster: Asb15-prov protein; n=4; Tetrapoda|Rep:
           Asb15-prov protein - Xenopus laevis (African clawed
           frog)
          Length = 586

 Score = 32.3 bits (70), Expect = 5.1
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = -1

Query: 295 FCLLFEDGFGLTTVXPAVYDHNVFXPWAACLSLDFLYCDTLCTLWHLHFLQYVLR 131
           F  +  D FG T   PA+ + +    W +C+  D  +CD +   W  H +  V+R
Sbjct: 443 FDCMHGDMFGGTFTWPAL-EEDALPGWTSCVIKDIPFCDFVTVSWMRHLVGKVVR 496


>UniRef50_Q00TJ9 Cluster: Chromosome 17 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 66

 Score = 32.3 bits (70), Expect = 5.1
 Identities = 16/30 (53%), Positives = 18/30 (60%)
 Frame = -1

Query: 205 LSLDFLYCDTLCTLWHLHFLQYVLRCFGTF 116
           L+L  LYC TLC    LH LQ V   FGT+
Sbjct: 5   LALPVLYCVTLCAECFLHPLQNVFLDFGTY 34


>UniRef50_Q17E08 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 594

 Score = 32.3 bits (70), Expect = 5.1
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -2

Query: 192 FCTVIPCVLCGIYIFCSTSC 133
           F T+IPC  C + +FCST C
Sbjct: 244 FLTLIPCKCCTVTMFCSTKC 263


>UniRef50_Q9DB68 Cluster: Adult male cerebellum cDNA, RIKEN
           full-length enriched library, clone:1500005N04
           product:SIMILAR TO MAMMALIAN INOSITOL HEXAKISPHOSPHATE
           KINASE 2 homolog; n=2; Murinae|Rep: Adult male
           cerebellum cDNA, RIKEN full-length enriched library,
           clone:1500005N04 product:SIMILAR TO MAMMALIAN INOSITOL
           HEXAKISPHOSPHATE KINASE 2 homolog - Mus musculus (Mouse)
          Length = 262

 Score = 31.9 bits (69), Expect = 6.7
 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 3/39 (7%)
 Frame = -2

Query: 420 WIICPFLFL---SPPSSKCLHLFNATCDLTLQSAHSRRS 313
           WI+C FL L   S PS +CLHL    C L   SA  + S
Sbjct: 215 WIVCCFLLLCLPSLPSPQCLHLRAHPCSLQSGSALKQAS 253


>UniRef50_Q5CXE3 Cluster: Transcription factor E2F wHTH only; n=3;
           Cryptosporidium|Rep: Transcription factor E2F wHTH only
           - Cryptosporidium parvum Iowa II
          Length = 666

 Score = 31.9 bits (69), Expect = 6.7
 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
 Frame = -2

Query: 147 CSTSCA-VLV-RSPFLSSFGTISTNVKKRYFNPAMTLDTLTFFC 22
           CS S   VLV R   LSSFGT+  +VK        TLDT+ +FC
Sbjct: 432 CSASVPEVLVERDAVLSSFGTVDMSVKLAPNIDDETLDTIPWFC 475


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 423,307,097
Number of Sequences: 1657284
Number of extensions: 7623815
Number of successful extensions: 19685
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 19235
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19676
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23931581955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -