SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62847 Cluster: 40S ribosomal protein S24; n=212; Eukar...   213   2e-54
UniRef50_Q8LC83 Cluster: 40S ribosomal protein S24-2; n=6; Eukar...   166   5e-40
UniRef50_A3BCP7 Cluster: Putative uncharacterized protein; n=2; ...   131   6e-34
UniRef50_Q8MUB8 Cluster: 40S ribosomal protein S24; n=1; Clonorc...   142   5e-33
UniRef50_Q8I3R6 Cluster: 40S ribosomal subunit protein S24, puta...   132   9e-30
UniRef50_Q5CPN5 Cluster: 40s ribosomal protein s24; n=6; Eukaryo...   129   7e-29
UniRef50_Q00V00 Cluster: 40S ribosomal protein S24; n=1; Ostreoc...   126   6e-28
UniRef50_UPI0000498B4B Cluster: 40S ribosomal protein S24; n=3; ...   122   1e-26
UniRef50_UPI000150A155 Cluster: Ribosomal protein S24e containin...   119   7e-26
UniRef50_Q4Q1D2 Cluster: 40S ribosomal protein S24e; n=4; Leishm...   117   2e-25
UniRef50_A2F0H5 Cluster: 40S ribosomal protein S24; n=3; Trichom...   113   3e-24
UniRef50_A0BWM9 Cluster: Chromosome undetermined scaffold_132, w...   107   2e-22
UniRef50_Q9AW51 Cluster: 40S ribosomal protein S24; n=1; Guillar...   101   2e-20
UniRef50_Q91834 Cluster: Fragment of Xenopus laevis ribosomal pr...    87   5e-16
UniRef50_Q8SR06 Cluster: 40S RIBOSOMAL PROTEIN S24; n=1; Encepha...    73   5e-12
UniRef50_Q9UY20 Cluster: 30S ribosomal protein S24e; n=4; Thermo...    68   2e-10
UniRef50_Q8ZV65 Cluster: 30S ribosomal protein S24e; n=4; Pyroba...    65   1e-09
UniRef50_A3DMS7 Cluster: 30S ribosomal protein S24e; n=1; Staphy...    62   1e-08
UniRef50_A1RXC7 Cluster: 30S ribosomal protein S24e; n=1; Thermo...    58   1e-07
UniRef50_A4YIV8 Cluster: Ribosomal protein S24E-like protein; n=...    55   2e-06
UniRef50_Q8TVD8 Cluster: 30S ribosomal protein S24e; n=1; Methan...    54   3e-06
UniRef50_A3H8R4 Cluster: 30S ribosomal protein S24e; n=1; Caldiv...    53   5e-06
UniRef50_O29151 Cluster: 30S ribosomal protein S24e; n=1; Archae...    53   5e-06
UniRef50_Q9YCY0 Cluster: 30S ribosomal protein S24e; n=2; Desulf...    52   9e-06
UniRef50_Q74M50 Cluster: 30S ribosomal protein S24e; n=1; Nanoar...    50   4e-05
UniRef50_O26367 Cluster: 30S ribosomal protein S24e; n=3; Methan...    50   5e-05
UniRef50_Q975Q9 Cluster: 30S ribosomal protein S24e; n=3; Sulfol...    47   3e-04
UniRef50_Q8PZ95 Cluster: 30S ribosomal protein S24e; n=5; Euryar...    46   6e-04
UniRef50_Q6L0P8 Cluster: 30S ribosomal protein S24e; n=4; Thermo...    45   0.002
UniRef50_P19953 Cluster: 30S ribosomal protein S24e; n=6; Haloba...    44   0.004
UniRef50_P34582 Cluster: Uncharacterized protein T26G10.3; n=1; ...    42   0.010
UniRef50_A7I4V3 Cluster: SSU ribosomal protein S24E; n=1; Candid...    40   0.039
UniRef50_P54032 Cluster: 30S ribosomal protein S24e; n=1; Methan...    40   0.039
UniRef50_Q1XFY8 Cluster: Putative uncharacterized protein; n=1; ...    40   0.052
UniRef50_Q2FS46 Cluster: 30S ribosomal protein S24e; n=1; Methan...    38   0.16 
UniRef50_A2SR72 Cluster: Ribosomal protein S24e; n=2; Methanomic...    38   0.16 
UniRef50_Q7QAG9 Cluster: ENSANGP00000021262; n=1; Anopheles gamb...    34   3.4  
UniRef50_A2FEP6 Cluster: Putative uncharacterized protein; n=2; ...    34   3.4  
UniRef50_Q44PW9 Cluster: Putative uncharacterized protein; n=9; ...    33   4.5  
UniRef50_Q08FF6 Cluster: Putative uncharacterized protein; n=2; ...    33   6.0  
UniRef50_Q9VT48 Cluster: CG8177-PA, isoform A; n=13; Diptera|Rep...    33   6.0  
UniRef50_Q5CJF6 Cluster: Delta-COP; n=2; Cryptosporidium|Rep: De...    33   6.0  
UniRef50_Q9IW08 Cluster: Replicase-associated protein; n=10; Tym...    33   7.9  

>UniRef50_P62847 Cluster: 40S ribosomal protein S24; n=212;
           Eukaryota|Rep: 40S ribosomal protein S24 - Homo sapiens
           (Human)
          Length = 133

 Score =  213 bits (521), Expect = 2e-54
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>UniRef50_Q8LC83 Cluster: 40S ribosomal protein S24-2; n=6;
           Eukaryota|Rep: 40S ribosomal protein S24-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 133

 Score =  166 bits (403), Expect = 5e-40
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 1/121 (0%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVT-PDVVFVF 264
           M+E   TIRTR FMTNRLLARKQ V DVLHPG+  VSK E++EKLA+MY+V  P+ +F F
Sbjct: 1   MAEKAVTIRTRNFMTNRLLARKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFCF 60

Query: 265 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVR 444
            F+T+FGGGKS+G+ LIYDT++ AKKFEPK+RL R+GL  K   +RKQ KERKNR KK+R
Sbjct: 61  KFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120

Query: 445 G 447
           G
Sbjct: 121 G 121


>UniRef50_A3BCP7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 166

 Score =  131 bits (316), Expect(2) = 6e-34
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKV-TPDVVFVFGFKTNF 282
           T+RTRKFMTNRLL+RKQ V +VLHPG+  VSK +++EKLAK+Y+V   + +FVF F+T+F
Sbjct: 11  TLRTRKFMTNRLLSRKQFVLEVLHPGRANVSKADLKEKLAKLYEVKDSNCIFVFKFRTHF 70

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLAR 369
           GGGKSTGF LIYD LD AKK+EPK+RL R
Sbjct: 71  GGGKSTGFGLIYDNLDAAKKYEPKYRLIR 99



 Score = 35.9 bits (79), Expect(2) = 6e-34
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = +1

Query: 370 HGLYEKKRPTRKQRKERKNRMKKVRG 447
           +GL  K   +RKQ KERKNR KK+RG
Sbjct: 128 NGLATKVEKSRKQMKERKNRAKKIRG 153


>UniRef50_Q8MUB8 Cluster: 40S ribosomal protein S24; n=1; Clonorchis
           sinensis|Rep: 40S ribosomal protein S24 - Clonorchis
           sinensis
          Length = 139

 Score =  142 bits (345), Expect = 5e-33
 Identities = 65/107 (60%), Positives = 85/107 (79%)
 Frame = +1

Query: 109 IRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGG 288
           IRTRKFM+NRLL R+QMV D+LHPG+  +S  +IRE+LAK YK +PD+VF FGF+T+FGG
Sbjct: 7   IRTRKFMSNRLLFRRQMVVDILHPGRCVLSLKDIRERLAKTYKTSPDMVFAFGFRTHFGG 66

Query: 289 GKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNR 429
           GKSTGFAL+YD+LD AKKFEP++RL R      + P R++ +ER  +
Sbjct: 67  GKSTGFALVYDSLDHAKKFEPRYRLIRVKWVAGRHPQRQKVEERTQK 113


>UniRef50_Q8I3R6 Cluster: 40S ribosomal subunit protein S24,
           putative; n=1; Plasmodium falciparum 3D7|Rep: 40S
           ribosomal subunit protein S24, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 133

 Score =  132 bits (318), Expect = 9e-30
 Identities = 63/117 (53%), Positives = 85/117 (72%), Gaps = 2/117 (1%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTP-DVVFVFGFKTNF 282
           TIR +K+M+N LL RKQ   ++LHP K +V+K E++E+LAKMYK+   + + +FGFKT F
Sbjct: 6   TIRVKKYMSNPLLRRKQFALEILHPNKGSVAKKEVKERLAKMYKLNNVNTIVLFGFKTLF 65

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKK-RPTRKQRKERKNRMKKVRGT 450
           GGG++ GF LIY  +D  KKFE K+RL R GL +K+ +  R+  KE KNR KKVRGT
Sbjct: 66  GGGRTKGFGLIYKNVDAVKKFEKKYRLVREGLIDKETKAGRRASKELKNRRKKVRGT 122


>UniRef50_Q5CPN5 Cluster: 40s ribosomal protein s24; n=6;
           Eukaryota|Rep: 40s ribosomal protein s24 -
           Cryptosporidium parvum Iowa II
          Length = 159

 Score =  129 bits (311), Expect = 7e-29
 Identities = 64/117 (54%), Positives = 84/117 (71%), Gaps = 2/117 (1%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTP-DVVFVFGFKTNF 282
           T+R R+F+ N LLARKQ V DV+HP    VSK++++ KLAK+YKV   + + +FGFKT F
Sbjct: 33  TVRVRQFLNNPLLARKQFVVDVIHPSLGGVSKSDLKAKLAKLYKVQDANCIVLFGFKTAF 92

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPT-RKQRKERKNRMKKVRGT 450
           GGG+S+GF +IY+ +   KKFE ++R  R G+ EK   T RK RKE KNR KKVRGT
Sbjct: 93  GGGRSSGFCVIYNNISALKKFEHRYRQVRMGIAEKVTATGRKGRKETKNRRKKVRGT 149


>UniRef50_Q00V00 Cluster: 40S ribosomal protein S24; n=1;
           Ostreococcus tauri|Rep: 40S ribosomal protein S24 -
           Ostreococcus tauri
          Length = 134

 Score =  126 bits (303), Expect = 6e-28
 Identities = 69/127 (54%), Positives = 85/127 (66%), Gaps = 20/127 (15%)
 Frame = +1

Query: 127 MTNRLLARKQMV-----------CDVLHPGKPTVSK--------TEIREKLAKMYKVTPD 249
           MTNRLL R+Q V           CDVLHPG+  VSK         E++EK+AKMY V+ +
Sbjct: 1   MTNRLLQRRQFVRLTNVFHQSQICDVLHPGRANVSKVRYIRGAGAELQEKIAKMYNVSDE 60

Query: 250 -VVFVFGFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKN 426
             V +FGF+T FGGGKSTGF LIYD +D  KKFEPKHRL R GL +  + +RK  KE+KN
Sbjct: 61  KCVSIFGFRTAFGGGKSTGFGLIYDNIDAFKKFEPKHRLIRAGLKDAVQKSRKNIKEKKN 120

Query: 427 RMKKVRG 447
           R+KK+RG
Sbjct: 121 RVKKLRG 127


>UniRef50_UPI0000498B4B Cluster: 40S ribosomal protein S24; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S24 - Entamoeba histolytica HM-1:IMSS
          Length = 140

 Score =  122 bits (293), Expect = 1e-26
 Identities = 61/111 (54%), Positives = 75/111 (67%), Gaps = 1/111 (0%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTP-DVVFVFGFKTNF 282
           TIRTR  + N LL RKQ+V D+ HPG      TEI+EKLAKMYKV     + + GF T +
Sbjct: 9   TIRTRNLIVNPLLCRKQVVVDIYHPGIVQPKFTEIKEKLAKMYKVKDVQTIVLNGFVTKY 68

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMK 435
           GGGK++GFALIYDTL   KKF PKH+L R GL +K +  RK RKE K + +
Sbjct: 69  GGGKTSGFALIYDTLSALKKFVPKHQLIRAGLDKKTKAPRKARKEHKKKWR 119


>UniRef50_UPI000150A155 Cluster: Ribosomal protein S24e containing
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ribosomal protein S24e containing protein - Tetrahymena
           thermophila SB210
          Length = 149

 Score =  119 bits (286), Expect = 7e-26
 Identities = 57/116 (49%), Positives = 76/116 (65%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T  IRT+K + N LL+R+Q+  DVLHP  PT SK +IRE+LAK  KV    V V+GF T 
Sbjct: 2   TIVIRTKKILVNPLLSRRQLSLDVLHPDSPTASKEKIREELAKQLKVDARNVVVYGFSTQ 61

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
           +GGGKSTGFAL+YD      K+EP +RL +  +  +K  TR+  KE K ++K+  G
Sbjct: 62  YGGGKSTGFALVYDNQQYLLKYEPNYRLRKVKILGEKPNTRRSFKELKRKIKRTSG 117


>UniRef50_Q4Q1D2 Cluster: 40S ribosomal protein S24e; n=4;
           Leishmania|Rep: 40S ribosomal protein S24e - Leishmania
           major
          Length = 137

 Score =  117 bits (282), Expect = 2e-25
 Identities = 64/125 (51%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = +1

Query: 82  FKMSEGTATIRTRKFMTNRLLARKQMVCDVLHPGK-PTVSKTEIREKLAKMYKVTPDV-- 252
           F+  +    IRT +F  N+LL RKQ + +V HP    TV    IR+KLA +YKV PD   
Sbjct: 3   FQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQLIRKKLATLYKV-PDASQ 61

Query: 253 VFVFGFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRM 432
           V +FGFKT FGGGK+TGF LIYD L   K+FEP +R  R G  + + P RK  KER+NR 
Sbjct: 62  VSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMGFGKARLPARKSVKERRNRN 121

Query: 433 KKVRG 447
           KK+RG
Sbjct: 122 KKLRG 126


>UniRef50_A2F0H5 Cluster: 40S ribosomal protein S24; n=3;
           Trichomonas vaginalis G3|Rep: 40S ribosomal protein S24
           - Trichomonas vaginalis G3
          Length = 140

 Score =  113 bits (272), Expect = 3e-24
 Identities = 51/115 (44%), Positives = 75/115 (65%)
 Frame = +1

Query: 106 TIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFG 285
           ++  RK++ N+LL RKQ V D+ H G    ++ EI++++A   K   D+V +FG +T FG
Sbjct: 5   SVHIRKYIVNKLLDRKQFVIDMQHLGAKAPTRDEIKDEVASRLKANKDLVVIFGLETKFG 64

Query: 286 GGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           GG +TGF  +YD+LD  KK EPKHRL + GL EK + TR+ RK  + +  KV G+
Sbjct: 65  GGHTTGFGFVYDSLDALKKTEPKHRLIKAGLAEKGKVTRRMRKNARRQKVKVWGS 119


>UniRef50_A0BWM9 Cluster: Chromosome undetermined scaffold_132,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_132,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 182

 Score =  107 bits (257), Expect = 2e-22
 Identities = 53/117 (45%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLA-RKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKT 276
           T  ++TRK +  + L  R+Q+  ++LHP KPT S+  + ++LA  YK     V V+G +T
Sbjct: 34  TFIVKTRKVLLKQSLEIRRQLSVELLHPNKPTPSQESVVKELASKYKADERNVVVYGLRT 93

Query: 277 NFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
            FGG ++TGFALIYDT     KFEPK RL R G+  K+  +RK  KE K+++KK RG
Sbjct: 94  TFGGNRTTGFALIYDTQQYLLKFEPKFRLRRRGIIPKRDGSRKGWKEVKSKLKKTRG 150


>UniRef50_Q9AW51 Cluster: 40S ribosomal protein S24; n=1; Guillardia
           theta|Rep: 40S ribosomal protein S24 - Guillardia theta
           (Cryptomonas phi)
          Length = 129

 Score =  101 bits (241), Expect = 2e-20
 Identities = 49/114 (42%), Positives = 73/114 (64%), Gaps = 1/114 (0%)
 Frame = +1

Query: 109 IRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVT-PDVVFVFGFKTNFG 285
           ++T+KF  N LL RKQ +  +    K  +SK  +R +L+K Y++  P ++F+FG K NFG
Sbjct: 10  LKTKKFKNNPLLKRKQFLLSIDRKKKFNISKEWLRIELSKYYRIKDPSLIFIFGLKNNFG 69

Query: 286 GGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
           G K + F  IY  L+ A+  EPKHRL ++ L + +  + KQRKE+KN+MKK  G
Sbjct: 70  GFKCSAFVYIYYNLEAARVNEPKHRLIKNNLMKLELQSSKQRKEKKNKMKKYFG 123


>UniRef50_Q91834 Cluster: Fragment of Xenopus laevis ribosomal
           protein S19; n=1; Xenopus laevis|Rep: Fragment of
           Xenopus laevis ribosomal protein S19 - Xenopus laevis
           (African clawed frog)
          Length = 142

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 51/128 (39%), Positives = 76/128 (59%)
 Frame = -3

Query: 483 LLGGRTYFRFLGTADLLHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSE 304
           LL   T+  F  T   LHSVL FFTL +    LL++ + G  V  L L   ++ VVD ++
Sbjct: 5   LLFTSTHICFGCTPYFLHSVLAFFTLLSGSLFLLIKPMLGKSVFRLILFCIVKRVVDHAK 64

Query: 303 SS*LATSEVCLETEYEHYIGSNLVHFGELLTDLGLADGWFSWM*NIANHLLARQQSVGHE 124
           +   ATS+V  +T++++ I   LVH  +L +D  L D  F+WM  I +HLLA Q+SV H+
Sbjct: 65  ACSFATSKVSPKTKHKNNIWGCLVHLCQLFSDFSLGDSSFAWMKYINDHLLALQKSVCHK 124

Query: 123 LASANSRC 100
           L+ ++S C
Sbjct: 125 LSCSDSHC 132


>UniRef50_Q8SR06 Cluster: 40S RIBOSOMAL PROTEIN S24; n=1;
           Encephalitozoon cuniculi|Rep: 40S RIBOSOMAL PROTEIN S24
           - Encephalitozoon cuniculi
          Length = 126

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 38/106 (35%), Positives = 60/106 (56%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           NRLL+RK++     HPG P  SK EIREK++++Y+   D V V   K  +G  ++T  A 
Sbjct: 8   NRLLSRKELDVVAYHPGMPIPSKEEIREKISELYQTKKDNVVVMDLKNRYGTHRTTLKAK 67

Query: 313 IYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           IY ++++    E KH +A+    E     R+ RK+ + +  K+ GT
Sbjct: 68  IYSSIEVLSNIEKKHIVAKLTGKEFHVTPRRVRKDERKKRYKIFGT 113


>UniRef50_Q9UY20 Cluster: 30S ribosomal protein S24e; n=4;
           Thermococcaceae|Rep: 30S ribosomal protein S24e -
           Pyrococcus abyssi
          Length = 99

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 31/94 (32%), Positives = 53/94 (56%)
 Frame = +1

Query: 109 IRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGG 288
           I+  +   N+L+ RK++  ++ HPG+PT S+ +++ KL  M  + P+   +   ++ FG 
Sbjct: 3   IKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGS 62

Query: 289 GKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKK 390
            KS G+A  Y   D     EP++ L R G+ EKK
Sbjct: 63  YKSKGYAKYYYDKDRMLYIEPEYILIRDGIIEKK 96


>UniRef50_Q8ZV65 Cluster: 30S ribosomal protein S24e; n=4;
           Pyrobaculum|Rep: 30S ribosomal protein S24e -
           Pyrobaculum aerophilum
          Length = 121

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 36/108 (33%), Positives = 60/108 (55%), Gaps = 6/108 (5%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N+LLAR++++ + +H    T ++  +RE +AK   +    VFV   KT FG G+S     
Sbjct: 14  NKLLARRELLVEAVHQNASTPTRQSVREWVAKQLGIDISNVFVRRIKTEFGRGRSLAEVH 73

Query: 313 IYDTLDLAKKFEPKHRLARH------GLYEKKRPTRKQRKERKNRMKK 438
           +Y+   +A+  EP + LAR+       L E+ +  R +R+E+K R KK
Sbjct: 74  VYNDSKIARVIEPLYILARNLGEEGKKLLEEAKKRRNERREKKKRKKK 121


>UniRef50_A3DMS7 Cluster: 30S ribosomal protein S24e; n=1;
           Staphylothermus marinus F1|Rep: 30S ribosomal protein
           S24e - Staphylothermus marinus (strain ATCC 43588 / DSM
           3639 / F1)
          Length = 118

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 37/112 (33%), Positives = 60/112 (53%)
 Frame = +1

Query: 85  KMSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVF 264
           K+ E T  I   K+  N L+ R+++V  + H GK T S+  IR + AK+Y V  + V+V 
Sbjct: 6   KIGEFTGEIVVDKY--NPLVKRREVVIRIAHIGKSTPSRGLIRHETAKIYGVEVEKVYVR 63

Query: 265 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKER 420
              T +G G S     IYD+++ AK+FEP + + R+    +     +  KE+
Sbjct: 64  EINTEYGLGVSNATIHIYDSVERAKQFEPPYVIKRNEYASQSYQLEQMMKEQ 115


>UniRef50_A1RXC7 Cluster: 30S ribosomal protein S24e; n=1;
           Thermofilum pendens Hrk 5|Rep: 30S ribosomal protein
           S24e - Thermofilum pendens (strain Hrk 5)
          Length = 106

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +1

Query: 103 ATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNF 282
           +++R  +   N+L+ R++++ ++ H G  T S+ ++ E L  M       + V    T +
Sbjct: 4   SSLRIIQEKVNKLVGRRELLVEIHHQGSGTPSRRDVAEALRNMLGTGGSAIVVRKLVTRY 63

Query: 283 GGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQ 408
           G G S     IYD+    K FEPKH L R+GL +++   +++
Sbjct: 64  GQGVSEALIHIYDSDVKMKMFEPKHILRRNGLIQEQEAKKQE 105


>UniRef50_A4YIV8 Cluster: Ribosomal protein S24E-like protein; n=1;
           Metallosphaera sedula DSM 5348|Rep: Ribosomal protein
           S24E-like protein - Metallosphaera sedula DSM 5348
          Length = 113

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 25/79 (31%), Positives = 41/79 (51%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N+++ RK++   V H G PT S+ +IR+ ++       D+V +    T +G G S     
Sbjct: 23  NKVIGRKEIKIKVYHIGSPTPSRADIRKAISSFIGAKEDLVVIRKINTGYGAGISEATIH 82

Query: 313 IYDTLDLAKKFEPKHRLAR 369
           +Y   D+  KFEP H + R
Sbjct: 83  VYSEKDVLSKFEPAHLVNR 101


>UniRef50_Q8TVD8 Cluster: 30S ribosomal protein S24e; n=1;
           Methanopyrus kandleri|Rep: 30S ribosomal protein S24e -
           Methanopyrus kandleri
          Length = 116

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/80 (33%), Positives = 45/80 (56%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL RK++   V H    T  K+E+  KLA +  V  +VV +   ++ FG  ++ G+A 
Sbjct: 11  NPLLYRKEVKFVVRHEDSGTPQKSEVLRKLAAILDVDKEVVLIDRMESEFGKRETKGYAK 70

Query: 313 IYDTLDLAKKFEPKHRLARH 372
           IY +++  +  EP+H + RH
Sbjct: 71  IYKSMEHLEDIEPEHMVERH 90


>UniRef50_A3H8R4 Cluster: 30S ribosomal protein S24e; n=1;
           Caldivirga maquilingensis IC-167|Rep: 30S ribosomal
           protein S24e - Caldivirga maquilingensis IC-167
          Length = 155

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 32/114 (28%), Positives = 55/114 (48%)
 Frame = +1

Query: 97  GTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKT 276
           G   ++  +   N LL RK++   V H G PT  + ++RE+LAK     P++ +V    T
Sbjct: 36  GKVQVKVIEQFNNPLLQRKEVKAIVYHVGLPTPQRLQLREELAKALGSNPELTYVTHVYT 95

Query: 277 NFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
            +G G S     +Y   + A+  EP +   R+   ++ +  R + K R+   KK
Sbjct: 96  QYGVGVSRIEVHVYFDKNTAELVEPLYVRLRNMPKDQAKKIRDELKSRRKSEKK 149


>UniRef50_O29151 Cluster: 30S ribosomal protein S24e; n=1;
           Archaeoglobus fulgidus|Rep: 30S ribosomal protein S24e -
           Archaeoglobus fulgidus
          Length = 110

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 29/85 (34%), Positives = 49/85 (57%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL R+++ C +   GK T S+ E+R K+A +    P+ V V   KT FG  ++  +  
Sbjct: 14  NPLLRRREVYCRLSFEGK-TPSRKEVRGKIAGLMNAEPERVVVDYIKTEFGKTEAKCYVK 72

Query: 313 IYDTLDLAKKFEPKHRLARHGLYEK 387
           IYDT++  +K E +H + R+ + E+
Sbjct: 73  IYDTVEDLQKIEEEHIIERNKVEEQ 97


>UniRef50_Q9YCY0 Cluster: 30S ribosomal protein S24e; n=2;
           Desulfurococcales|Rep: 30S ribosomal protein S24e -
           Aeropyrum pernix
          Length = 118

 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 27/81 (33%), Positives = 47/81 (58%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N L+ R+++V  + H  KPT  +  +R+KLA++  V    +++   KT +G G S     
Sbjct: 28  NPLVKRREIVMILHHELKPTPMRIMLRQKLAEVLGVDIKRIYIRYIKTGYGAGLSKVRVH 87

Query: 313 IYDTLDLAKKFEPKHRLARHG 375
           +YD+ + A  FEPK+ + R+G
Sbjct: 88  VYDSPERALSFEPKYIIERNG 108


>UniRef50_Q74M50 Cluster: 30S ribosomal protein S24e; n=1;
           Nanoarchaeum equitans|Rep: 30S ribosomal protein S24e -
           Nanoarchaeum equitans
          Length = 94

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 26/82 (31%), Positives = 45/82 (54%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N+L  R + +  V HP + T ++ E +EK+A+M  V  + + +    + +G   S  +A 
Sbjct: 12  NKLFDRTEYIIQVEHPKEKTPTREEAKEKIAEMLNVDKNKLVIKKIVSKYGLPYSFIYAR 71

Query: 313 IYDTLDLAKKFEPKHRLARHGL 378
           +YD +D AK+ E K  L R+ L
Sbjct: 72  VYDNIDTAKRVELKQILRRNNL 93


>UniRef50_O26367 Cluster: 30S ribosomal protein S24e; n=3;
           Methanobacteriaceae|Rep: 30S ribosomal protein S24e -
           Methanobacterium thermoautotrophicum
          Length = 100

 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/80 (30%), Positives = 44/80 (55%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL RK++  + L+ G+ T    E++ KL  M     D++ V      FG  ++TG+A 
Sbjct: 11  NPLLNRKEIRFECLYEGESTPKVLEVKNKLVAMLDADKDLLVVDKIDQGFGEPRATGYAK 70

Query: 313 IYDTLDLAKKFEPKHRLARH 372
           IY++ +   + EP+H + ++
Sbjct: 71  IYESAEKLTEIEPEHVIKKN 90


>UniRef50_Q975Q9 Cluster: 30S ribosomal protein S24e; n=3;
           Sulfolobus|Rep: 30S ribosomal protein S24e - Sulfolobus
           tokodaii
          Length = 120

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/111 (26%), Positives = 56/111 (50%)
 Frame = +1

Query: 85  KMSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVF 264
           K+SE    I  R  + N ++ R+++   V H G  T+S+ ++ + +A  Y    D+V + 
Sbjct: 10  KISEKAEGIVERD-IKNNVIGRRELYIKVFHIGSGTISRKDMIKAIASSYGAQEDLVVIK 68

Query: 265 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKE 417
              T +G G S   A IY+     ++FEP++ + R    + K+  +  +K+
Sbjct: 69  KIHTLYGAGISYVRANIYNDKKTLQEFEPQYLIGRDTGQKVKKGGKGAQKQ 119


>UniRef50_Q8PZ95 Cluster: 30S ribosomal protein S24e; n=5;
           Euryarchaeota|Rep: 30S ribosomal protein S24e -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 101

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 27/90 (30%), Positives = 49/90 (54%)
 Frame = +1

Query: 109 IRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGG 288
           I+  K   N LL R+++   V + G  T S+ ++R KLA M     +++ +   KT +G 
Sbjct: 3   IKIIKDKKNPLLNRRELDFIVKYEGS-TPSRNDVRNKLAAMLNAPLELLVIQRIKTEYGM 61

Query: 289 GKSTGFALIYDTLDLAKKFEPKHRLARHGL 378
            +S G+A +Y+  D  K+ E ++ L R+ +
Sbjct: 62  QESKGYAKLYEDADRMKQVEQEYVLKRNAV 91


>UniRef50_Q6L0P8 Cluster: 30S ribosomal protein S24e; n=4;
           Thermoplasmatales|Rep: 30S ribosomal protein S24e -
           Picrophilus torridus
          Length = 102

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/86 (31%), Positives = 44/86 (51%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N+LL RK++   +      T S+ +IR+ LA  Y     ++ V   +   G  +  G+A 
Sbjct: 14  NKLLFRKEINYTIKFENDKTPSREDIRKLLANNYGSDESLIIVDKNRQETGKHEIKGYAK 73

Query: 313 IYDTLDLAKKFEPKHRLARHGLYEKK 390
           IYDT + A  +EP + L R+ L  K+
Sbjct: 74  IYDTKEHAMLYEPDYELFRNKLKVKE 99


>UniRef50_P19953 Cluster: 30S ribosomal protein S24e; n=6;
           Halobacteriaceae|Rep: 30S ribosomal protein S24e -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 102

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/80 (30%), Positives = 40/80 (50%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N +L R  +  +V+H  + T S+  +R+ LA       + V +    T FG  K+ G+A 
Sbjct: 11  NPMLHRTDVRFEVVHD-EATPSRLSVRDSLAATLNKDAEEVVIHKLDTKFGMRKTVGYAK 69

Query: 313 IYDTLDLAKKFEPKHRLARH 372
           +YD  + A+  E  H L R+
Sbjct: 70  VYDNPEYARDVEQDHMLERN 89


>UniRef50_P34582 Cluster: Uncharacterized protein T26G10.3; n=1;
           Caenorhabditis elegans|Rep: Uncharacterized protein
           T26G10.3 - Caenorhabditis elegans
          Length = 91

 Score = 42.3 bits (95), Expect = 0.010
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +1

Query: 157 MVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVV 255
           MV +V+ PG+PT  K +IREK+A  Y + PD +
Sbjct: 1   MVAEVILPGRPTTLKADIREKIANFYNINPDTM 33


>UniRef50_A7I4V3 Cluster: SSU ribosomal protein S24E; n=1;
           Candidatus Methanoregula boonei 6A8|Rep: SSU ribosomal
           protein S24E - Methanoregula boonei (strain 6A8)
          Length = 99

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL+R+++   + + G  T S+ +I  KL  +      +V +   K+NFG     G A 
Sbjct: 11  NELLSRREIAFTLTYDGA-TPSRLQIIGKLCALLNTKDPLVVLDSLKSNFGKMVIVGKAR 69

Query: 313 IYDTLDLAKKFEPKHRLAR 369
           IYD+ D  KK E  +  AR
Sbjct: 70  IYDSEDAKKKTEHPYLSAR 88


>UniRef50_P54032 Cluster: 30S ribosomal protein S24e; n=1;
           Methanocaldococcus jannaschii|Rep: 30S ribosomal protein
           S24e - Methanococcus jannaschii
          Length = 101

 Score = 40.3 bits (90), Expect = 0.039
 Identities = 25/85 (29%), Positives = 44/85 (51%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL RK+    V H G PT +  +++ KLA +     D++ V       G  ++ G+A 
Sbjct: 11  NPLLKRKEYRFIVDHDG-PTPTFKDVKLKLAAILNANKDLLIVEKIVEEAGMQRARGYAK 69

Query: 313 IYDTLDLAKKFEPKHRLARHGLYEK 387
           +YD  ++ K  E +H L ++ + E+
Sbjct: 70  LYDNEEMLKLVEREHILRKNKIEEE 94


>UniRef50_Q1XFY8 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 204

 Score = 39.9 bits (89), Expect = 0.052
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = +1

Query: 301 GFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNR 429
           GF L+YDT D A K++P+H  + H      R +  +RKE++ R
Sbjct: 54  GFTLVYDTFDFANKYQPEHS-SNHDGASTSRTSISRRKEKRRR 95


>UniRef50_Q2FS46 Cluster: 30S ribosomal protein S24e; n=1;
           Methanospirillum hungatei JF-1|Rep: 30S ribosomal
           protein S24e - Methanospirillum hungatei (strain JF-1 /
           DSM 864)
          Length = 112

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 23/75 (30%), Positives = 36/75 (48%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL RK++   +   G  T S+  +  KLA M     D + +      FG  + TG A 
Sbjct: 11  NVLLNRKEIGFSITFTGA-TPSRKMVHAKLAAMLSAPKDQLVIGSLHNRFGLTEITGDAR 69

Query: 313 IYDTLDLAKKFEPKH 357
           +Y + +  KK EP++
Sbjct: 70  VYTSAEYLKKIEPEY 84


>UniRef50_A2SR72 Cluster: Ribosomal protein S24e; n=2;
           Methanomicrobiales|Rep: Ribosomal protein S24e -
           Methanocorpusculum labreanum (strain ATCC 43576 / DSM
           4855 / Z)
          Length = 97

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = +1

Query: 133 NRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFAL 312
           N LL+R ++     + G  T ++++I  K+A M     + + +   K  FG    TG A 
Sbjct: 11  NELLSRNELAFTASYDGA-TPARSDIGAKIAAMQNTPVENLILSPLKGRFGTRAVTGVAR 69

Query: 313 IYDTLDLAKKFEPKHRLAR 369
           IYDT +  K  E +  +AR
Sbjct: 70  IYDTPEALKATEREFLIAR 88


>UniRef50_Q7QAG9 Cluster: ENSANGP00000021262; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000021262 - Anopheles gambiae
           str. PEST
          Length = 1960

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 20/73 (27%), Positives = 37/73 (50%)
 Frame = -1

Query: 314 IKANPVDLPPPKFVLKPNTNTTSGVTLYILASFSRISVLLTVGFPGCKTSQTICLRANNL 135
           + A  V   PP+ V KP TN +   TL +L  F+  + ++  G P  K+++ + +  N  
Sbjct: 1   MSAFEVSCTPPRAVAKPRTNESREPTLVLLGPFTPKATVVFEGVPVGKSARRLLIVRNTN 60

Query: 134 LVMNLRVRIVAVP 96
             + ++V +  VP
Sbjct: 61  KTL-VQVNLTRVP 72


>UniRef50_A2FEP6 Cluster: Putative uncharacterized protein; n=2;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 326

 Score = 33.9 bits (74), Expect = 3.4
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 306 RFDLRHTRSGQEVRAQAQVSPPRPVREEEAHAQTA*RT*EQNEEGPRYQE 455
           +  +RH R+ +  +    + PP+PV+E E   + A    EQ EE P  +E
Sbjct: 110 KITVRHPRNTEPFKELNPLLPPKPVKEGEEEEEKAEEEEEQKEEEPENEE 159


>UniRef50_Q44PW9 Cluster: Putative uncharacterized protein; n=9;
           Chlorobiaceae|Rep: Putative uncharacterized protein -
           Chlorobium limicola DSM 245
          Length = 139

 Score = 33.5 bits (73), Expect = 4.5
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -1

Query: 257 NTTSGVTLYILASFSRISVLLTVGFPGCKTSQTICLRANNLLVMNLRVRIVAVPSLILNY 78
           NT +G  L+  A     SV  TV F G    + + L A  L+ + L    VAV   +L++
Sbjct: 57  NTLAGYLLFEYAIDRESSVFTTVVFGGLAL-RLLLLMA--LVALILIRNFVAVYDFVLSF 113

Query: 77  FQ*FGVYTHVSLLKQEKKN 21
           F  + +Y  V +L  +KKN
Sbjct: 114 FAFYCIYVIVEILGYQKKN 132


>UniRef50_Q08FF6 Cluster: Putative uncharacterized protein; n=2;
           Mule deer poxvirus|Rep: Putative uncharacterized protein
           - Deerpox virus W-1170-84
          Length = 129

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 23/81 (28%), Positives = 37/81 (45%)
 Frame = +1

Query: 184 KPTVSKTEIREKLAKMYKVTPDVVFVFGFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRL 363
           KPT+ + ++ EKL K YK    + F+      F     T F +I    D  K+F  K+  
Sbjct: 37  KPTMDRIDLAEKLIKKYKDIRSLYFLLNI---FREMPDTEF-VIKQLSDYIKRFNRKYLE 92

Query: 364 ARHGLYEKKRPTRKQRKERKN 426
                + K +PT K++   +N
Sbjct: 93  QNDTTFGKTQPTIKRKHRFRN 113


>UniRef50_Q9VT48 Cluster: CG8177-PA, isoform A; n=13; Diptera|Rep:
           CG8177-PA, isoform A - Drosophila melanogaster (Fruit
           fly)
          Length = 1268

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>UniRef50_Q5CJF6 Cluster: Delta-COP; n=2; Cryptosporidium|Rep:
           Delta-COP - Cryptosporidium hominis
          Length = 535

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 247 DVVFVFGFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKN 426
           DV+F F    +FG  +S   + I   L++  + E  H+L R     K+   +++R+   N
Sbjct: 113 DVIFAFDEIVSFGYRESINLSQIKTCLEMESQEEKLHKLIRQ---NKENEEKERRRHIAN 169

Query: 427 RMKKVRGT 450
           R+ K R T
Sbjct: 170 RLDKERVT 177


>UniRef50_Q9IW08 Cluster: Replicase-associated protein; n=10;
           Tymoviridae|Rep: Replicase-associated protein -
           Poinsettia mosaic virus
          Length = 1987

 Score = 32.7 bits (71), Expect = 7.9
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = -3

Query: 240 NLVHFGELLTDLGLADGWFSWM*NIANHLLARQQSVGHEL-ASANSRCSFTHFELFSIIR 64
           NL HF  LLT        +SW  ++    ++R Q+V  EL +SA    S T F LFS++ 
Sbjct: 332 NLQHFS-LLTASNRPSNSYSWNGSLWQRFISRLQTVAAELKSSAIFTSSITTF-LFSLLF 389

Query: 63  RLHARVSAKTR 31
           +   R SA +R
Sbjct: 390 QYFRRKSAASR 400


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 639,110,978
Number of Sequences: 1657284
Number of extensions: 13028663
Number of successful extensions: 37848
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 36032
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37701
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -