SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O18640 Cluster: Guanine nucleotide-binding protein subu...   206   3e-52
UniRef50_Q5NCC6 Cluster: Guanine nucleotide binding protein (G p...   186   3e-46
UniRef50_P63244 Cluster: Guanine nucleotide-binding protein subu...   186   3e-46
UniRef50_Q6C591 Cluster: Yarrowia lipolytica chromosome E of str...   143   4e-33
UniRef50_Q6FW89 Cluster: Similar to sp|P38011 Saccharomyces cere...   142   6e-33
UniRef50_Q6PRD4 Cluster: G-protein beta subunit; n=2; Paramecium...   114   2e-24
UniRef50_Q24D42 Cluster: Putative uncharacterized protein; n=1; ...   110   2e-23
UniRef50_Q4DTN2 Cluster: Activated protein kinase C receptor, pu...   102   8e-21
UniRef50_A2ELV7 Cluster: Guanine nucleotide-binding protein beta...    97   3e-19
UniRef50_Q25306 Cluster: Guanine nucleotide-binding protein subu...    95   1e-18
UniRef50_Q9AVW0 Cluster: Guanine nucleotide-binding protein beta...    91   2e-17
UniRef50_A7EU93 Cluster: Putative uncharacterized protein; n=2; ...    75   2e-12
UniRef50_Q5AT75 Cluster: Putative uncharacterized protein; n=1; ...    74   3e-12
UniRef50_Q46F15 Cluster: WD-repeat protein; n=1; Methanosarcina ...    73   4e-12
UniRef50_Q2UR60 Cluster: WD40 repeat; n=1; Aspergillus oryzae|Re...    73   6e-12
UniRef50_A7EMT8 Cluster: Putative uncharacterized protein; n=2; ...    72   1e-11
UniRef50_Q3MCV7 Cluster: WD-40 repeat; n=2; Nostocaceae|Rep: WD-...    72   1e-11
UniRef50_Q3M2E2 Cluster: Serine/Threonine protein kinase with WD...    71   3e-11
UniRef50_A7BZX0 Cluster: Serine/Threonine protein kinase with WD...    70   4e-11
UniRef50_A6S2T5 Cluster: Putative uncharacterized protein; n=1; ...    70   4e-11
UniRef50_A0YUC6 Cluster: Serine/threonine kinase with WD-40 repe...    70   5e-11
UniRef50_A7EJN8 Cluster: Putative uncharacterized protein; n=2; ...    70   5e-11
UniRef50_A7EAT8 Cluster: Putative uncharacterized protein; n=2; ...    70   5e-11
UniRef50_A6S2Q5 Cluster: Putative uncharacterized protein; n=1; ...    70   5e-11
UniRef50_A7IQV8 Cluster: NWD2 protein; n=5; Sordariales|Rep: NWD...    69   7e-11
UniRef50_A5V0G7 Cluster: NB-ARC domain protein; n=2; Chloroflexa...    69   9e-11
UniRef50_A0YTJ7 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. ...    69   9e-11
UniRef50_A7F664 Cluster: Putative uncharacterized protein; n=2; ...    69   1e-10
UniRef50_A5UYN6 Cluster: Protein kinase; n=1; Roseiflexus sp. RS...    68   2e-10
UniRef50_Q8YRI1 Cluster: Uncharacterized WD repeat-containing pr...    68   2e-10
UniRef50_Q2U9S0 Cluster: Predicted NTPase; n=4; Pezizomycotina|R...    68   2e-10
UniRef50_Q4WH43 Cluster: Vegetative incompatibility WD repeat pr...    67   3e-10
UniRef50_Q00808 Cluster: Vegetative incompatibility protein HET-...    67   3e-10
UniRef50_Q7ND05 Cluster: WD-repeat protein; n=1; Gloeobacter vio...    67   4e-10
UniRef50_A0D039 Cluster: Chromosome undetermined scaffold_33, wh...    67   4e-10
UniRef50_Q8YZL9 Cluster: Serine/threonine kinase with WD-40 repe...    66   5e-10
UniRef50_A0EDI8 Cluster: Chromosome undetermined scaffold_90, wh...    66   5e-10
UniRef50_A2QX40 Cluster: Contig An11c0260, complete genome; n=1;...    66   5e-10
UniRef50_Q9D7H2 Cluster: WD repeat-containing protein 5B; n=15; ...    66   5e-10
UniRef50_UPI0000F2C889 Cluster: PREDICTED: similar to Chain A, S...    66   6e-10
UniRef50_A5URP9 Cluster: WD-40 repeat protein; n=1; Roseiflexus ...    66   6e-10
UniRef50_A3IST7 Cluster: Peptidase C14, caspase catalytic subuni...    66   6e-10
UniRef50_Q54N37 Cluster: Putative uncharacterized protein; n=1; ...    66   6e-10
UniRef50_Q115C0 Cluster: Serine/threonine protein kinase with WD...    66   9e-10
UniRef50_A0DBT2 Cluster: Chromosome undetermined scaffold_444, w...    66   9e-10
UniRef50_A7IQW2 Cluster: HNWD1 protein; n=2; Podospora anserina|...    66   9e-10
UniRef50_Q8Z0R1 Cluster: WD-40 repeat protein; n=2; Nostocaceae|...    65   1e-09
UniRef50_A0YYY9 Cluster: Serine/Threonine protein kinase with WD...    65   1e-09
UniRef50_A0YQZ5 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC...    65   1e-09
UniRef50_Q5ATB2 Cluster: Putative uncharacterized protein; n=1; ...    65   1e-09
UniRef50_UPI00006D0027 Cluster: hypothetical protein TTHERM_0076...    64   2e-09
UniRef50_Q7NJ67 Cluster: WD-repeat protein; n=1; Gloeobacter vio...    64   2e-09
UniRef50_Q10ZJ8 Cluster: WD-40 repeat; n=2; Cyanobacteria|Rep: W...    64   2e-09
UniRef50_A7BVG4 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp...    64   2e-09
UniRef50_UPI00006CB0EE Cluster: Vegetatible incompatibility prot...    64   3e-09
UniRef50_Q3MB33 Cluster: Peptidase C14, caspase catalytic subuni...    64   3e-09
UniRef50_A3IX04 Cluster: WD-40 repeat protein; n=3; Chroococcale...    64   3e-09
UniRef50_A6RKZ7 Cluster: Putative uncharacterized protein; n=1; ...    64   3e-09
UniRef50_UPI000023E54C Cluster: hypothetical protein FG08955.1; ...    64   3e-09
UniRef50_A5UYN9 Cluster: Protein kinase; n=1; Roseiflexus sp. RS...    64   3e-09
UniRef50_Q5AZ95 Cluster: Putative uncharacterized protein; n=1; ...    64   3e-09
UniRef50_Q5AXM0 Cluster: Putative uncharacterized protein; n=1; ...    64   3e-09
UniRef50_UPI000038C710 Cluster: COG2319: FOG: WD40 repeat; n=1; ...    63   5e-09
UniRef50_Q8Z019 Cluster: WD-40 repeat protein; n=4; cellular org...    63   5e-09
UniRef50_Q4C005 Cluster: G-protein beta WD-40 repeat; n=1; Croco...    63   5e-09
UniRef50_Q10V31 Cluster: WD-40 repeat; n=1; Trichodesmium erythr...    63   5e-09
UniRef50_A0YWB3 Cluster: Serine/Threonine protein kinase with WD...    63   5e-09
UniRef50_A0YLR0 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC...    63   6e-09
UniRef50_A0DA29 Cluster: Chromosome undetermined scaffold_42, wh...    63   6e-09
UniRef50_A6S2U0 Cluster: Putative uncharacterized protein; n=1; ...    63   6e-09
UniRef50_Q8YTC2 Cluster: Uncharacterized WD repeat-containing pr...    63   6e-09
UniRef50_P61964 Cluster: WD repeat-containing protein 5; n=34; B...    63   6e-09
UniRef50_Q4P9P9 Cluster: Nuclear distribution protein PAC1; n=4;...    63   6e-09
UniRef50_P49695 Cluster: Probable serine/threonine-protein kinas...    62   8e-09
UniRef50_Q1D4W8 Cluster: WD domain, G-beta repeat protein; n=1; ...    62   1e-08
UniRef50_Q11AA2 Cluster: Serine/threonine protein kinase with WD...    62   1e-08
UniRef50_A0YXI8 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. ...    62   1e-08
UniRef50_Q54N36 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_Q0C7G0 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_UPI000045C045 Cluster: COG2319: FOG: WD40 repeat; n=1; ...    62   1e-08
UniRef50_Q7ND80 Cluster: WD-repeat protein; n=5; Cyanobacteria|R...    62   1e-08
UniRef50_Q6C0A7 Cluster: Yarrowia lipolytica chromosome F of str...    62   1e-08
UniRef50_Q2GT52 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_A0H1H8 Cluster: WD-40 repeat; n=2; Chloroflexus|Rep: WD...    61   2e-08
UniRef50_A0DB07 Cluster: Chromosome undetermined scaffold_436, w...    61   2e-08
UniRef50_A0CVT5 Cluster: Chromosome undetermined scaffold_299, w...    61   2e-08
UniRef50_UPI000038C5C2 Cluster: COG2319: FOG: WD40 repeat; n=1; ...    61   2e-08
UniRef50_Q1J328 Cluster: WD-40 repeat precursor; n=1; Deinococcu...    61   2e-08
UniRef50_A7BZD6 Cluster: Serine/Threonine protein kinase with WD...    61   2e-08
UniRef50_A7BLC5 Cluster: WD-40 repeat protein; n=2; Bacteria|Rep...    61   2e-08
UniRef50_A0YPZ3 Cluster: WD-40 repeat protein; n=2; Lyngbya sp. ...    61   2e-08
UniRef50_A0DL78 Cluster: Chromosome undetermined scaffold_55, wh...    61   2e-08
UniRef50_Q8YSC0 Cluster: All3169 protein; n=2; Nostocaceae|Rep: ...    60   3e-08
UniRef50_Q5EUI2 Cluster: WD-repeat protein; n=1; Gemmata sp. Wa1...    60   3e-08
UniRef50_Q10YD2 Cluster: Serine/threonine protein kinase with WD...    60   3e-08
UniRef50_A1BER4 Cluster: WD-40 repeat protein; n=1; Chlorobium p...    60   3e-08
UniRef50_Q550I6 Cluster: Putative uncharacterized protein; n=2; ...    60   3e-08
UniRef50_A0CRE9 Cluster: Chromosome undetermined scaffold_25, wh...    60   3e-08
UniRef50_O43017 Cluster: Set1 complex component swd3; n=1; Schiz...    60   3e-08
UniRef50_A4S646 Cluster: Predicted protein; n=2; Ostreococcus|Re...    58   3e-08
UniRef50_Q47A03 Cluster: WD-40 repeat; n=1; Dechloromonas aromat...    60   4e-08
UniRef50_A7BQY9 Cluster: WD-40 repeat protein; n=3; Beggiatoa sp...    60   4e-08
UniRef50_A3FPQ2 Cluster: Pleiotropic regulator 1; n=2; Cryptospo...    60   4e-08
UniRef50_A0DXJ0 Cluster: Chromosome undetermined scaffold_69, wh...    60   4e-08
UniRef50_A2QT36 Cluster: Function: seems to be a general transcr...    60   4e-08
UniRef50_A0YQM3 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC...    60   6e-08
UniRef50_A7RUR9 Cluster: Predicted protein; n=1; Nematostella ve...    60   6e-08
UniRef50_A2R251 Cluster: Function: co-expression of het-e and he...    60   6e-08
UniRef50_UPI000038C572 Cluster: COG2319: FOG: WD40 repeat; n=1; ...    59   7e-08
UniRef50_Q39WC4 Cluster: NACHT nucleoside triphosphatase; n=1; G...    59   7e-08
UniRef50_A7C0D3 Cluster: Beta transducin-like protein; n=1; Begg...    59   7e-08
UniRef50_A7BQ86 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp...    59   7e-08
UniRef50_A0YUK7 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC...    59   7e-08
UniRef50_A0YUE4 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC...    59   7e-08
UniRef50_A0YT97 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. ...    59   7e-08
UniRef50_A0CQ08 Cluster: Chromosome undetermined scaffold_238, w...    59   7e-08
UniRef50_Q4WH28 Cluster: Pfs, NACHT and WD domain protein; n=4; ...    59   7e-08
UniRef50_A6RMS9 Cluster: Putative uncharacterized protein; n=1; ...    59   7e-08
UniRef50_UPI000023D3AB Cluster: hypothetical protein FG08952.1; ...    59   1e-07
UniRef50_Q3MB32 Cluster: Peptidase C14, caspase catalytic subuni...    59   1e-07
UniRef50_A0ZIJ6 Cluster: Serine/Threonine protein kinase with WD...    59   1e-07
UniRef50_Q8YL09 Cluster: WD-repeat protein; n=3; Cyanobacteria|R...    58   1e-07
UniRef50_Q9X4P4 Cluster: Putative regulatory protein WdlA; n=1; ...    58   1e-07
UniRef50_Q16SH0 Cluster: Striatin, putative; n=2; Bilateria|Rep:...    58   1e-07
UniRef50_A0CH87 Cluster: Chromosome undetermined scaffold_18, wh...    58   1e-07
UniRef50_Q10Y55 Cluster: WD-40 repeat; n=1; Trichodesmium erythr...    58   2e-07
UniRef50_A7C2D9 Cluster: Serine/Threonine protein kinase with WD...    58   2e-07
UniRef50_A0YUL3 Cluster: Peptidase C14, caspase catalytic subuni...    58   2e-07
UniRef50_Q9LV27 Cluster: Gb|AAD25820.1; n=10; Viridiplantae|Rep:...    58   2e-07
UniRef50_A0CRW5 Cluster: Chromosome undetermined scaffold_25, wh...    58   2e-07
UniRef50_Q09715 Cluster: Transcriptional repressor tup11; n=2; S...    58   2e-07
UniRef50_Q9BVA0 Cluster: Katanin p80 WD40-containing subunit B1;...    58   2e-07
UniRef50_UPI0000498AC0 Cluster: WD repeat protein; n=2; Entamoeb...    58   2e-07
UniRef50_Q8YMQ6 Cluster: WD-repeat protein; n=3; Nostocaceae|Rep...    58   2e-07
UniRef50_Q3M9A6 Cluster: WD-40 repeat; n=1; Anabaena variabilis ...    58   2e-07
UniRef50_Q3L9F7 Cluster: Putative WD-40 repeat protein; n=1; Rho...    58   2e-07
UniRef50_A5UV81 Cluster: WD-40 repeat protein; n=2; Roseiflexus|...    58   2e-07
UniRef50_A3ZW90 Cluster: Putative WD-repeat containing protein; ...    58   2e-07
UniRef50_Q10DN8 Cluster: Will die slowly protein, putative, expr...    58   2e-07
UniRef50_A2XLK4 Cluster: Putative uncharacterized protein; n=2; ...    58   2e-07
UniRef50_Q4N2R1 Cluster: Putative uncharacterized protein; n=2; ...    58   2e-07
UniRef50_A0CR02 Cluster: Chromosome undetermined scaffold_247, w...    58   2e-07
UniRef50_Q5KKN8 Cluster: Nuclear matrix protein NMP200, putative...    58   2e-07
UniRef50_Q5BBQ9 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q4P1X6 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q12417 Cluster: Pre-mRNA-splicing factor PRP46; n=6; Sa...    58   2e-07
UniRef50_UPI00006CBE41 Cluster: Will die slowly protein, putativ...    57   3e-07
UniRef50_Q98J75 Cluster: Probable transcriptional repressor; n=1...    57   3e-07
UniRef50_Q9XBD8 Cluster: Putative WD-repeat containing protein; ...    57   3e-07
UniRef50_Q11NX0 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_Q23YA8 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_A0EFN4 Cluster: Chromosome undetermined scaffold_93, wh...    57   3e-07
UniRef50_Q8NA23 Cluster: WD repeat-containing protein 31; n=23; ...    57   3e-07
UniRef50_Q7NLE9 Cluster: WD-repeat protein; n=1; Gloeobacter vio...    57   4e-07
UniRef50_Q3MCN9 Cluster: WD-40 repeat; n=3; Nostocaceae|Rep: WD-...    57   4e-07
UniRef50_Q3M8V4 Cluster: WD-40 repeat; n=2; Nostocaceae|Rep: WD-...    57   4e-07
UniRef50_A7BTI4 Cluster: G-protein beta WD-40 repeat; n=1; Beggi...    57   4e-07
UniRef50_A0YMI4 Cluster: WD-40 repeat protein; n=2; Cyanobacteri...    57   4e-07
UniRef50_A4U9X8 Cluster: Lissencephaly protein 1-like; n=1; Chla...    57   4e-07
UniRef50_A4S1E8 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    57   4e-07
UniRef50_Q5AY27 Cluster: Putative uncharacterized protein; n=1; ...    57   4e-07
UniRef50_A5AB88 Cluster: Contig An08c0230, complete genome. prec...    57   4e-07
UniRef50_A7PUB2 Cluster: Chromosome chr7 scaffold_31, whole geno...    56   5e-07
UniRef50_Q54HF5 Cluster: Putative uncharacterized protein; n=1; ...    56   5e-07
UniRef50_Q237C6 Cluster: Putative uncharacterized protein; n=1; ...    56   5e-07
UniRef50_A0DE90 Cluster: Chromosome undetermined scaffold_47, wh...    56   5e-07
UniRef50_A0DAZ5 Cluster: Chromosome undetermined scaffold_43, wh...    56   5e-07
UniRef50_O74184 Cluster: WD repeat-containing protein pop3; n=5;...    56   5e-07
UniRef50_Q7NID9 Cluster: WD-repeat protein; n=1; Gloeobacter vio...    56   7e-07
UniRef50_Q2JM75 Cluster: WD-repeat/protein kinase domain protein...    56   7e-07
UniRef50_Q3W4E8 Cluster: G-protein beta WD-40 repeat; n=3; Frank...    56   7e-07
UniRef50_Q119Z9 Cluster: Serine/threonine protein kinase with WD...    56   7e-07
UniRef50_A7C479 Cluster: Serine/Threonine protein kinase with WD...    56   7e-07
UniRef50_A0ZIS9 Cluster: WD-40 repeat protein; n=1; Nodularia sp...    56   7e-07
UniRef50_Q6AWF2 Cluster: AT26369p; n=8; Diptera|Rep: AT26369p - ...    56   7e-07
UniRef50_Q4QIC8 Cluster: Putative uncharacterized protein; n=3; ...    56   7e-07
UniRef50_A7RFR6 Cluster: Predicted protein; n=1; Nematostella ve...    56   7e-07
UniRef50_A7AP41 Cluster: WD domain, G-beta repeat containing pro...    56   7e-07
UniRef50_A0DMB8 Cluster: Chromosome undetermined scaffold_56, wh...    56   7e-07
UniRef50_Q5B810 Cluster: Putative uncharacterized protein; n=1; ...    56   7e-07
UniRef50_Q8YV57 Cluster: Uncharacterized WD repeat-containing pr...    56   7e-07
UniRef50_UPI000045BE0A Cluster: COG2319: FOG: WD40 repeat; n=1; ...    56   9e-07
UniRef50_UPI0000ECB020 Cluster: PQQ repeat and WD repeat domain ...    56   9e-07
UniRef50_Q3M407 Cluster: WD-40 repeat; n=1; Anabaena variabilis ...    56   9e-07
UniRef50_Q113P7 Cluster: Serine/threonine protein kinase with WD...    56   9e-07
UniRef50_A3IXZ8 Cluster: WD-40 repeat; n=3; Chroococcales|Rep: W...    56   9e-07
UniRef50_A0YIY4 Cluster: WD-40 repeat protein; n=3; Bacteria|Rep...    56   9e-07
UniRef50_Q389W0 Cluster: Putative uncharacterized protein; n=2; ...    56   9e-07
UniRef50_Q17H46 Cluster: Wd-repeat protein; n=2; Culicidae|Rep: ...    56   9e-07
UniRef50_A0D5I2 Cluster: Chromosome undetermined scaffold_388, w...    56   9e-07
UniRef50_A0BP95 Cluster: Chromosome undetermined scaffold_12, wh...    56   9e-07
UniRef50_Q4P561 Cluster: Putative uncharacterized protein; n=1; ...    56   9e-07
UniRef50_UPI000038D597 Cluster: COG2319: FOG: WD40 repeat; n=2; ...    55   1e-06
UniRef50_UPI000038D4E2 Cluster: COG0515: Serine/threonine protei...    55   1e-06
UniRef50_Q3M307 Cluster: Pentapeptide repeat; n=1; Anabaena vari...    55   1e-06
UniRef50_Q10XQ9 Cluster: WD-40 repeat; n=2; Trichodesmium erythr...    55   1e-06
UniRef50_Q10XF2 Cluster: Serine/threonine protein kinase with WD...    55   1e-06
UniRef50_A0C2Z9 Cluster: Chromosome undetermined scaffold_145, w...    55   1e-06
UniRef50_Q5KGF2 Cluster: General transcriptional repressor, puta...    55   1e-06
UniRef50_Q0U6J1 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_A1CF18 Cluster: Wd40 protein; n=1; Aspergillus clavatus...    55   1e-06
UniRef50_O14170 Cluster: WD repeat-containing protein pop2; n=1;...    55   1e-06
UniRef50_Q6CG48 Cluster: Nuclear distribution protein PAC1; n=1;...    55   1e-06
UniRef50_Q7ZUV2 Cluster: Katanin p80 WD40-containing subunit B1;...    55   1e-06
UniRef50_P90648 Cluster: Myosin heavy chain kinase B; n=2; Dicty...    55   1e-06
UniRef50_P49177 Cluster: Guanine nucleotide-binding protein subu...    55   1e-06
UniRef50_UPI0001509BB6 Cluster: hypothetical protein TTHERM_0049...    55   2e-06
UniRef50_Q8DLK2 Cluster: WD-40 repeat protein; n=1; Synechococcu...    55   2e-06
UniRef50_Q7NM62 Cluster: WD-repeat protein; n=1; Gloeobacter vio...    55   2e-06
UniRef50_Q112W9 Cluster: WD-40 repeat; n=1; Trichodesmium erythr...    55   2e-06
UniRef50_A6BZA5 Cluster: WD40-repeat containing protein; n=1; Pl...    55   2e-06
UniRef50_O61585 Cluster: Katanin p80 WD40-containing subunit B1;...    55   2e-06
UniRef50_Q8Z020 Cluster: WD-40 repeat protein; n=2; Nostocaceae|...    54   2e-06
UniRef50_A0YQ70 Cluster: Serine/Threonine protein kinase with WD...    54   2e-06
UniRef50_Q010G1 Cluster: C86239 protein T10O24.21; n=1; Ostreoco...    54   2e-06
UniRef50_Q4N1R3 Cluster: Putative uncharacterized protein; n=3; ...    54   2e-06
UniRef50_Q232S8 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q1EQ29 Cluster: Beta prime-COP; n=2; Entamoeba histolyt...    54   2e-06
UniRef50_A0E7C7 Cluster: Chromosome undetermined scaffold_81, wh...    54   2e-06
UniRef50_A0D1X6 Cluster: Chromosome undetermined scaffold_34, wh...    54   2e-06
UniRef50_Q6CEN7 Cluster: Yarrowia lipolytica chromosome B of str...    54   2e-06
UniRef50_Q6C7K4 Cluster: Similar to sp|P40968 Saccharomyces cere...    54   2e-06
UniRef50_Q0C8M7 Cluster: Predicted protein; n=1; Aspergillus ter...    54   2e-06
UniRef50_A7TGM1 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_A1CUE3 Cluster: Cell division control protein Cdc4, put...    54   2e-06
UniRef50_UPI0000DB7FEE Cluster: PREDICTED: similar to HIRA prote...    54   3e-06
UniRef50_Q8YZ23 Cluster: WD-40 repeat protein; n=4; Cyanobacteri...    54   3e-06
UniRef50_Q8YNK6 Cluster: WD-40 repeat-protein; n=4; Nostocaceae|...    54   3e-06
UniRef50_A7BW04 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp...    54   3e-06
UniRef50_A3IT74 Cluster: Serine/Threonine protein kinase with WD...    54   3e-06
UniRef50_A0YUH5 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC...    54   3e-06
UniRef50_Q013I4 Cluster: PRL1; n=3; Viridiplantae|Rep: PRL1 - Os...    54   3e-06
UniRef50_Q5CG32 Cluster: Notchless; n=2; Cryptosporidium|Rep: No...    54   3e-06
UniRef50_Q4DSS0 Cluster: Putative uncharacterized protein; n=4; ...    54   3e-06
UniRef50_A0DSM3 Cluster: Chromosome undetermined scaffold_618, w...    54   3e-06
UniRef50_A0D9H6 Cluster: Chromosome undetermined scaffold_42, wh...    54   3e-06
UniRef50_A0CQ30 Cluster: Chromosome undetermined scaffold_24, wh...    54   3e-06
UniRef50_A0BC62 Cluster: Chromosome undetermined scaffold_1, who...    54   3e-06
UniRef50_A7F6N8 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q9NDC9 Cluster: Lissencephaly-1 homolog; n=4; Eukaryota...    54   3e-06
UniRef50_UPI0000D5607F Cluster: PREDICTED: similar to Katanin p8...    54   4e-06
UniRef50_Q8YN14 Cluster: WD-repeat protein; n=2; Nostocaceae|Rep...    54   4e-06
UniRef50_Q7NMP0 Cluster: WD-40 repeat protein; n=1; Gloeobacter ...    54   4e-06
UniRef50_A4TDV7 Cluster: WD-40 repeat protein; n=1; Mycobacteriu...    54   4e-06
UniRef50_A2X2A5 Cluster: Putative uncharacterized protein; n=5; ...    54   4e-06
UniRef50_Q54YD8 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_Q22D06 Cluster: Putative uncharacterized protein; n=4; ...    54   4e-06
UniRef50_A2G3K8 Cluster: WD repeat protein, putative; n=2; Trich...    54   4e-06
UniRef50_Q6PE01 Cluster: WD repeat-containing protein 57; n=16; ...    54   4e-06
UniRef50_Q96DI7 Cluster: WD repeat-containing protein 57; n=47; ...    54   4e-06
UniRef50_O13615 Cluster: Pre-mRNA-splicing factor prp46; n=15; D...    54   4e-06
UniRef50_Q6BU94 Cluster: Pre-mRNA-splicing factor PRP46; n=3; Sa...    54   4e-06
UniRef50_UPI000023EBCC Cluster: hypothetical protein FG00414.1; ...    53   5e-06
UniRef50_Q5EUI1 Cluster: WD-repeat protein; n=1; Gemmata sp. Wa1...    53   5e-06
UniRef50_Q7R5H9 Cluster: GLP_487_146397_149408; n=2; Giardia int...    53   5e-06
UniRef50_Q54CB5 Cluster: Putative uncharacterized protein; n=3; ...    53   5e-06
UniRef50_A7SYV4 Cluster: Predicted protein; n=1; Nematostella ve...    53   5e-06
UniRef50_A6S2R3 Cluster: Putative uncharacterized protein; n=2; ...    53   5e-06
UniRef50_A1DP24 Cluster: Cell division control protein Cdc4, put...    53   5e-06
UniRef50_Q55563 Cluster: Uncharacterized WD repeat-containing pr...    53   5e-06
UniRef50_Q8N136 Cluster: WD repeat-containing protein 69; n=44; ...    53   5e-06
UniRef50_O43071 Cluster: Pre-mRNA-processing factor 17; n=1; Sch...    53   5e-06
UniRef50_UPI0000D56BEE Cluster: PREDICTED: similar to WD repeat ...    53   6e-06
UniRef50_UPI00006CFD9E Cluster: conserved hypothetical protein; ...    53   6e-06
UniRef50_UPI00006CB709 Cluster: hypothetical protein TTHERM_0049...    53   6e-06
UniRef50_Q9SXA3 Cluster: T28P6.17 protein; n=2; Arabidopsis thal...    53   6e-06
UniRef50_Q019Y2 Cluster: WD-40 repeat protein; n=5; Viridiplanta...    53   6e-06
UniRef50_Q6WWJ3 Cluster: COPI protein; n=9; Plasmodium|Rep: COPI...    53   6e-06
UniRef50_Q54VP0 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_Q238W3 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_A0DGC8 Cluster: Chromosome undetermined scaffold_5, who...    53   6e-06
UniRef50_A0CTQ2 Cluster: Chromosome undetermined scaffold_27, wh...    53   6e-06
UniRef50_A0CFJ7 Cluster: Chromosome undetermined scaffold_176, w...    53   6e-06
UniRef50_Q4WDL4 Cluster: Transcriptional repressor TupA/RocA, pu...    53   6e-06
UniRef50_Q4P590 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_A6R6G0 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_A5DSZ2 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_A3LNI4 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...    53   6e-06
UniRef50_A2QSE6 Cluster: Contig An08c0280, complete genome; n=1;...    53   6e-06
UniRef50_UPI000051A267 Cluster: PREDICTED: similar to katanin p8...    52   9e-06
UniRef50_UPI000038CAEF Cluster: COG2319: FOG: WD40 repeat; n=1; ...    52   9e-06
UniRef50_Q98HK1 Cluster: WD-repeart protein, beta transducin-lik...    52   9e-06
UniRef50_Q3WJF6 Cluster: Protein kinase:G-protein beta WD-40 rep...    52   9e-06
UniRef50_Q3W6W7 Cluster: G-protein beta WD-40 repeat; n=1; Frank...    52   9e-06
UniRef50_A6GB61 Cluster: WD-40 repeat; n=1; Plesiocystis pacific...    52   9e-06
UniRef50_A1ZKM8 Cluster: WD-40 repeat-protein; n=2; Flexibactera...    52   9e-06
UniRef50_A5BV00 Cluster: Putative uncharacterized protein; n=1; ...    52   9e-06
UniRef50_Q22D03 Cluster: Putative uncharacterized protein; n=4; ...    52   9e-06
UniRef50_A7SKD9 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    52   9e-06
UniRef50_A2E2R1 Cluster: Wd-repeat protein, putative; n=1; Trich...    52   9e-06
UniRef50_A2DMY5 Cluster: Pre-mRNA splicing protein, putative; n=...    52   9e-06
UniRef50_A0CQ85 Cluster: Chromosome undetermined scaffold_24, wh...    52   9e-06
UniRef50_Q6FXU2 Cluster: Similar to sp|P53196 Saccharomyces cere...    52   9e-06
UniRef50_Q4P8F4 Cluster: Putative uncharacterized protein; n=1; ...    52   9e-06
UniRef50_A6RDT8 Cluster: Putative uncharacterized protein; n=2; ...    52   9e-06
UniRef50_P25382 Cluster: WD repeat-containing protein YCR072C; n...    52   9e-06
UniRef50_Q7S7L4 Cluster: Nuclear distribution protein pac-1b; n=...    52   9e-06
UniRef50_Q9NVX2 Cluster: Notchless protein homolog 1; n=56; Euka...    52   9e-06
UniRef50_UPI000150A863 Cluster: conserved hypothetical protein; ...    52   1e-05
UniRef50_UPI0000D8A059 Cluster: wd40 protein ciao1 variant (frag...    52   1e-05
UniRef50_Q4C796 Cluster: Protein kinase:G-protein beta WD-40 rep...    52   1e-05
UniRef50_Q10XR9 Cluster: WD-40 repeat; n=2; Oscillatoriales|Rep:...    52   1e-05
UniRef50_A7BM33 Cluster: Beta transducin-like protein; n=1; Begg...    52   1e-05
UniRef50_A1ZL34 Cluster: WD-40 repeat; n=1; Microscilla marina A...    52   1e-05
UniRef50_Q9XIJ3 Cluster: T10O24.21; n=5; Viridiplantae|Rep: T10O...    52   1e-05
UniRef50_Q84MU4 Cluster: Putative pre-mRNA splicing factor; n=2;...    52   1e-05
UniRef50_A5BNB0 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q9XWU3 Cluster: Putative uncharacterized protein; n=3; ...    52   1e-05
UniRef50_A0E2Z8 Cluster: Chromosome undetermined scaffold_75, wh...    52   1e-05
UniRef50_A0DXI0 Cluster: Chromosome undetermined scaffold_681, w...    52   1e-05
UniRef50_A0DWY1 Cluster: Chromosome undetermined scaffold_673, w...    52   1e-05
UniRef50_A6S1I4 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q9USN3 Cluster: Probable U3 small nucleolar RNA-associa...    52   1e-05
UniRef50_O13282 Cluster: Transcription initiation factor TFIID s...    52   1e-05
UniRef50_O43660 Cluster: Pleiotropic regulator 1; n=54; Eukaryot...    52   1e-05
UniRef50_P43034 Cluster: Platelet-activating factor acetylhydrol...    52   1e-05
UniRef50_UPI00015B6344 Cluster: PREDICTED: similar to WD repeat ...    52   1e-05
UniRef50_UPI00006CDA21 Cluster: hypothetical protein TTHERM_0040...    52   1e-05
UniRef50_Q8Z054 Cluster: WD-40 repeat protein; n=4; Nostocaceae|...    52   1e-05
UniRef50_Q8YZ16 Cluster: WD-repeat protein; n=3; Nostocaceae|Rep...    52   1e-05
UniRef50_Q0REB4 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_A0YTN5 Cluster: WD-40 repeat protein; n=2; Bacteria|Rep...    52   1e-05
UniRef50_O22725 Cluster: F11P17.7 protein; n=5; core eudicotyled...    52   1e-05
UniRef50_A5AVC7 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q5CQF7 Cluster: WD repeat containing protein; n=3; Cryp...    52   1e-05
UniRef50_Q4UH32 Cluster: U4/u6 small nuclear ribonucleoprotein, ...    52   1e-05
UniRef50_A0E1U2 Cluster: Chromosome undetermined scaffold_74, wh...    52   1e-05
UniRef50_A0CBM4 Cluster: Chromosome undetermined scaffold_164, w...    52   1e-05
UniRef50_A0C305 Cluster: Chromosome undetermined scaffold_146, w...    52   1e-05
UniRef50_A0BLB0 Cluster: Chromosome undetermined scaffold_114, w...    52   1e-05
UniRef50_Q2HGA5 Cluster: Putative uncharacterized protein; n=2; ...    52   1e-05
UniRef50_A7F223 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_A3LV62 Cluster: WD domain protein; n=3; Saccharomycetac...    52   1e-05
UniRef50_A2QVJ5 Cluster: Similarity: shows similarity only to th...    52   1e-05
UniRef50_Q42384 Cluster: PP1/PP2A phosphatases pleiotropic regul...    52   1e-05
UniRef50_Q08TC1 Cluster: WD-repeat protein; n=2; Bacteria|Rep: W...    51   2e-05
UniRef50_A7DB84 Cluster: Cytochrome c, class I; n=2; Methylobact...    51   2e-05
UniRef50_A7BNW9 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp...    51   2e-05
UniRef50_A0YVE2 Cluster: WD repeat protein; n=1; Lyngbya sp. PCC...    51   2e-05
UniRef50_A7P5W9 Cluster: Chromosome chr4 scaffold_6, whole genom...    51   2e-05
UniRef50_Q17G94 Cluster: Wd-repeat protein; n=1; Aedes aegypti|R...    51   2e-05
UniRef50_A0CCV4 Cluster: Chromosome undetermined scaffold_169, w...    51   2e-05
UniRef50_Q59S83 Cluster: Potential COMPASS histone methyltransfe...    51   2e-05
UniRef50_A7TLK2 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_A2QY86 Cluster: Function: the human small nuclear ribon...    51   2e-05
UniRef50_A2QSW7 Cluster: Contig An08c0340, complete genome; n=2;...    51   2e-05
UniRef50_P35606 Cluster: Coatomer subunit beta'; n=66; Eukaryota...    51   2e-05
UniRef50_UPI000049A0D8 Cluster: WD repeat protein; n=1; Entamoeb...    51   3e-05
UniRef50_Q8YZI2 Cluster: WD-40 repeat protein; n=3; Nostocaceae|...    51   3e-05
UniRef50_Q8YTD1 Cluster: WD-repeat protein; n=3; Cyanobacteria|R...    51   3e-05
UniRef50_Q2J7X9 Cluster: Serine/threonine protein kinase with WD...    51   3e-05
UniRef50_Q3LW47 Cluster: MRNA splicing factor PRL1; n=1; Bigelow...    51   3e-05
UniRef50_Q01HH1 Cluster: OSIGBa0142I02-OSIGBa0101B20.18 protein;...    51   3e-05
UniRef50_Q55E07 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_Q4Q0T1 Cluster: Putative uncharacterized protein; n=3; ...    51   3e-05
UniRef50_O44729 Cluster: Yeast prp (Splicing factor) related pro...    51   3e-05
UniRef50_O15627 Cluster: GTP-binding protein beta chain; n=4; En...    51   3e-05
UniRef50_A0D989 Cluster: Chromosome undetermined scaffold_42, wh...    51   3e-05
UniRef50_A0D2W2 Cluster: Chromosome undetermined scaffold_355, w...    51   3e-05
UniRef50_A0CGB8 Cluster: Chromosome undetermined scaffold_18, wh...    51   3e-05
UniRef50_Q758K7 Cluster: AEL246Cp; n=3; Saccharomycetales|Rep: A...    51   3e-05
UniRef50_Q5KD56 Cluster: Ubiquitin-protein ligase, putative; n=2...    51   3e-05
UniRef50_Q1DY46 Cluster: Putative uncharacterized protein; n=3; ...    51   3e-05
UniRef50_A5E5I5 Cluster: Coatomer beta' subunit; n=5; Saccharomy...    51   3e-05
UniRef50_A1DGY5 Cluster: COPI vesicle coat beta' subunit, putati...    51   3e-05
UniRef50_UPI00015B4D51 Cluster: PREDICTED: similar to ENSANGP000...    50   3e-05
UniRef50_UPI000066080F Cluster: WD repeat protein 37.; n=1; Taki...    50   3e-05
UniRef50_Q11FK1 Cluster: WD-40 repeat precursor; n=2; Rhizobiale...    50   3e-05
UniRef50_A7PA93 Cluster: Chromosome chr14 scaffold_9, whole geno...    50   3e-05
UniRef50_Q57X86 Cluster: Putative uncharacterized protein; n=3; ...    50   3e-05
UniRef50_Q54JL9 Cluster: Putative uncharacterized protein; n=1; ...    50   3e-05
UniRef50_Q4Q3L5 Cluster: Beta prime cop protein, putative; n=7; ...    50   3e-05
UniRef50_A7ATK2 Cluster: WD-repeat protein, putative; n=1; Babes...    50   3e-05
UniRef50_A3FPY1 Cluster: Coatomer protein complex subunit alpha,...    50   3e-05
UniRef50_A2F5Q7 Cluster: WD repeat protein, putative; n=1; Trich...    50   3e-05
UniRef50_A2D9Y9 Cluster: WD repeat protein, putative; n=1; Trich...    50   3e-05
UniRef50_A0CJ89 Cluster: Chromosome undetermined scaffold_199, w...    50   3e-05
UniRef50_A0CE40 Cluster: Chromosome undetermined scaffold_17, wh...    50   3e-05
UniRef50_Q5KLV2 Cluster: WD-repeat protein, putative; n=2; Filob...    50   3e-05
UniRef50_Q59P13 Cluster: Putative uncharacterized protein MAK11;...    50   3e-05
UniRef50_Q6C709 Cluster: Pre-mRNA-splicing factor PRP46; n=1; Ya...    50   3e-05
UniRef50_Q8W1K8 Cluster: Protein Mut11; n=1; Chlamydomonas reinh...    50   3e-05
UniRef50_UPI00015B472D Cluster: PREDICTED: similar to GA15597-PA...    50   5e-05
UniRef50_UPI00006CB067 Cluster: hypothetical protein TTHERM_0024...    50   5e-05
UniRef50_UPI0000498771 Cluster: conserved hypothetical protein; ...    50   5e-05
UniRef50_UPI000065EF8C Cluster: WD repeat protein 37.; n=1; Taki...    50   5e-05
UniRef50_A0L4C2 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_Q7RNL1 Cluster: Arabidopsis thaliana T10O24.21-related;...    50   5e-05
UniRef50_Q5CXT5 Cluster: Coatomer complex beta; n=3; Apicomplexa...    50   5e-05
UniRef50_Q583P8 Cluster: Putative uncharacterized protein; n=3; ...    50   5e-05
UniRef50_A7SB92 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    50   5e-05
UniRef50_A0DWY8 Cluster: Chromosome undetermined scaffold_679, w...    50   5e-05
UniRef50_A0BMM3 Cluster: Chromosome undetermined scaffold_116, w...    50   5e-05
UniRef50_Q0TX52 Cluster: Putative uncharacterized protein; n=1; ...    50   5e-05
UniRef50_A1D8S6 Cluster: Wd-repeat protein; n=2; Trichocomaceae|...    50   5e-05
UniRef50_Q8N0X2 Cluster: Sperm-associated antigen 16 protein; n=...    50   5e-05
UniRef50_P42527 Cluster: Myosin heavy chain kinase A; n=2; Dicty...    50   5e-05
UniRef50_Q5EUH5 Cluster: WD-repeat protein; n=1; Gemmata sp. Wa1...    50   6e-05
UniRef50_O31261 Cluster: Guanine nucleotide-binding protein beta...    50   6e-05
UniRef50_A0YRJ3 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. ...    50   6e-05
UniRef50_Q259K2 Cluster: H0402C08.11 protein; n=7; Magnoliophyta...    50   6e-05
UniRef50_Q57Z67 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_Q4CSA5 Cluster: Putative uncharacterized protein; n=2; ...    50   6e-05
UniRef50_Q19211 Cluster: Putative uncharacterized protein; n=4; ...    50   6e-05
UniRef50_O76734 Cluster: Transcriptional repressor TUP1; n=2; Di...    50   6e-05
UniRef50_A0DJT6 Cluster: Chromosome undetermined scaffold_53, wh...    50   6e-05
UniRef50_Q6C3U5 Cluster: Similar to tr|Q05946 Saccharomyces cere...    50   6e-05
UniRef50_Q2H5I1 Cluster: Putative uncharacterized protein; n=2; ...    50   6e-05
UniRef50_Q2H4I2 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_A5E4A7 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_Q93794 Cluster: F-box/WD repeat-containing protein sel-...    50   6e-05
UniRef50_P41811 Cluster: Coatomer subunit beta'; n=6; Saccharomy...    50   6e-05
UniRef50_UPI00006A179F Cluster: WD repeat domain 38.; n=2; Eutel...    49   8e-05
UniRef50_UPI00004D2F00 Cluster: PQQ repeat and WD repeat domain ...    49   8e-05
UniRef50_Q0RJE7 Cluster: Putative WD-40 repeat protein; n=1; Fra...    49   8e-05
UniRef50_Q9LVF2 Cluster: Arabidopsis thaliana genomic DNA, chrom...    49   8e-05
UniRef50_Q6S7B0 Cluster: TAF5; n=3; Magnoliophyta|Rep: TAF5 - Ar...    49   8e-05
UniRef50_Q6PLH8 Cluster: Katanin p80 subunit PF15p; n=1; Chlamyd...    49   8e-05
UniRef50_Q54K20 Cluster: WD40 repeat-containing protein; n=1; Di...    49   8e-05
UniRef50_Q23K67 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_A7S816 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    49   8e-05
UniRef50_A2G2R6 Cluster: WD repeat protein, putative; n=1; Trich...    49   8e-05
UniRef50_A2DQ27 Cluster: WD repeat protein, putative; n=1; Trich...    49   8e-05
UniRef50_A0EG03 Cluster: Chromosome undetermined scaffold_94, wh...    49   8e-05
UniRef50_A0EEP8 Cluster: Chromosome undetermined scaffold_92, wh...    49   8e-05
UniRef50_Q758V7 Cluster: AEL269Cp; n=1; Eremothecium gossypii|Re...    49   8e-05
UniRef50_A7F278 Cluster: Putative uncharacterized protein; n=1; ...    49   8e-05
UniRef50_A7EJX8 Cluster: Putative uncharacterized protein; n=4; ...    49   8e-05
UniRef50_P78706 Cluster: Transcriptional repressor rco-1; n=4; A...    49   8e-05
UniRef50_UPI0000E490DC Cluster: PREDICTED: similar to pre-mRNA s...    49   1e-04
UniRef50_Q4TC09 Cluster: Chromosome undetermined SCAF7064, whole...    49   1e-04
UniRef50_Q8YMU3 Cluster: WD-repeat protein; n=3; Nostocaceae|Rep...    49   1e-04
UniRef50_Q2JF31 Cluster: Serine/threonine protein kinase with WD...    49   1e-04
UniRef50_A7BNP8 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp...    49   1e-04
UniRef50_A7BNI4 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp...    49   1e-04
UniRef50_A6C5Y9 Cluster: WD40-repeat containing protein; n=1; Pl...    49   1e-04
UniRef50_A3IRL3 Cluster: Peptidase C14, caspase catalytic subuni...    49   1e-04
UniRef50_A0YXM9 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. ...    49   1e-04
UniRef50_A2YJA5 Cluster: Putative uncharacterized protein; n=3; ...    49   1e-04
UniRef50_Q7RQP8 Cluster: AlphaCop gene product; n=6; Plasmodium ...    49   1e-04
UniRef50_Q23H88 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_A0EFN5 Cluster: Chromosome undetermined scaffold_93, wh...    49   1e-04
UniRef50_A0BMM2 Cluster: Chromosome undetermined scaffold_116, w...    49   1e-04
UniRef50_A0BJC2 Cluster: Chromosome undetermined scaffold_11, wh...    49   1e-04
UniRef50_Q6CD60 Cluster: Similar to tr|Q9UT85 Schizosaccharomyce...    49   1e-04
UniRef50_Q4P396 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q0UE16 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q9NYS7 Cluster: WD repeat and SOCS box-containing prote...    49   1e-04
UniRef50_P56093 Cluster: Transcriptional repressor TUP1; n=5; Fu...    49   1e-04
UniRef50_P38129 Cluster: Transcription initiation factor TFIID s...    49   1e-04
UniRef50_Q23ZD6 Cluster: Putative uncharacterized protein; n=1; ...    46   1e-04
UniRef50_UPI0000E497F5 Cluster: PREDICTED: similar to CG15010-PA...    48   1e-04
UniRef50_UPI00006CBC77 Cluster: G protein beta subunit-like, put...    48   1e-04
UniRef50_Q8YUJ4 Cluster: WD-40 repeat protein; n=4; Nostocaceae|...    48   1e-04
UniRef50_Q8YJY6 Cluster: WD repeat protein; n=1; Nostoc sp. PCC ...    48   1e-04
UniRef50_Q7NF65 Cluster: WD-40 repeat protein; n=1; Gloeobacter ...    48   1e-04
UniRef50_Q8GU43 Cluster: Putative heterotrimeric G protein beta ...    48   1e-04
UniRef50_A0DHV1 Cluster: Chromosome undetermined scaffold_501, w...    48   1e-04
UniRef50_A0C173 Cluster: Chromosome undetermined scaffold_141, w...    48   1e-04
UniRef50_Q6CID5 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    48   1e-04
UniRef50_Q1DWB4 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q0CD38 Cluster: Predicted protein; n=1; Aspergillus ter...    48   1e-04
UniRef50_A4RFS8 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_A1C6P1 Cluster: F-box and WD repeat-containing protein;...    48   1e-04
UniRef50_Q9Y2I8 Cluster: WD repeat-containing protein 37; n=33; ...    48   1e-04
UniRef50_UPI0000E49560 Cluster: PREDICTED: similar to Apaf-1; n=...    48   2e-04
UniRef50_UPI000051A68D Cluster: PREDICTED: similar to phospholip...    48   2e-04
UniRef50_UPI0000660647 Cluster: Notchless homolog 1.; n=1; Takif...    48   2e-04
UniRef50_Q8KB12 Cluster: WD-repeat family protein; n=10; Chlorob...    48   2e-04
UniRef50_Q3VXL5 Cluster: G-protein beta WD-40 repeat; n=2; Frank...    48   2e-04
UniRef50_Q1VVP8 Cluster: WD-40 repeat protein; n=1; Psychroflexu...    48   2e-04
UniRef50_A7SG41 Cluster: Predicted protein; n=1; Nematostella ve...    48   2e-04
UniRef50_A2DE21 Cluster: Periodic tryptophan protein 2 homolog-r...    48   2e-04
UniRef50_A0EA80 Cluster: Chromosome undetermined scaffold_86, wh...    48   2e-04
UniRef50_A0DHH4 Cluster: Chromosome undetermined scaffold_50, wh...    48   2e-04
UniRef50_A0CY73 Cluster: Chromosome undetermined scaffold_304, w...    48   2e-04
UniRef50_A0C4Z7 Cluster: Chromosome undetermined scaffold_15, wh...    48   2e-04
UniRef50_Q86TI4 Cluster: WD repeat protein 86; n=10; Amniota|Rep...    48   2e-04
UniRef50_Q6ZUS8 Cluster: CDNA FLJ43357 fis, clone NT2RP7013795, ...    48   2e-04
UniRef50_Q6BIF8 Cluster: Debaryomyces hansenii chromosome G of s...    48   2e-04
UniRef50_A5DHM1 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q9UUG8 Cluster: Transcriptional repressor tup12; n=1; S...    48   2e-04
UniRef50_UPI0000D57096 Cluster: PREDICTED: similar to CG11887-PA...    48   2e-04
UniRef50_UPI00006CCBE2 Cluster: hypothetical protein TTHERM_0043...    48   2e-04
UniRef50_UPI000045BE66 Cluster: COG2319: FOG: WD40 repeat; n=1; ...    48   2e-04
UniRef50_UPI000038D9CD Cluster: COG2319: FOG: WD40 repeat; n=2; ...    48   2e-04
UniRef50_UPI000023D7C3 Cluster: hypothetical protein FG04587.1; ...    48   2e-04
UniRef50_Q4BZV7 Cluster: G-protein beta WD-40 repeat; n=1; Croco...    48   2e-04
UniRef50_A7BVK1 Cluster: WD-40 repeat protein; n=2; Beggiatoa sp...    48   2e-04
UniRef50_Q9FT96 Cluster: Katanin p80 subunit-like protein; n=1; ...    48   2e-04
UniRef50_Q54D08 Cluster: WD40 repeat-containing protein; n=1; Di...    48   2e-04
UniRef50_A7S3I9 Cluster: Predicted protein; n=1; Nematostella ve...    48   2e-04
UniRef50_A0DQS8 Cluster: Chromosome undetermined scaffold_6, who...    48   2e-04
UniRef50_A0D2W5 Cluster: Chromosome undetermined scaffold_356, w...    48   2e-04
UniRef50_A0BQT6 Cluster: Chromosome undetermined scaffold_121, w...    48   2e-04
UniRef50_Q870R6 Cluster: Related to transcription factor SPT8; n...    48   2e-04
UniRef50_Q4WEH9 Cluster: WD repeat protein; n=1; Aspergillus fum...    48   2e-04
UniRef50_Q2PIP7 Cluster: Predicted NTPase; n=1; Aspergillus oryz...    48   2e-04
UniRef50_Q46F16 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_P53196 Cluster: WD repeat-containing protein YGL004C; n...    48   2e-04

>UniRef50_O18640 Cluster: Guanine nucleotide-binding protein subunit
           beta-like protein; n=18; Eukaryota|Rep: Guanine
           nucleotide-binding protein subunit beta-like protein -
           Drosophila melanogaster (Fruit fly)
          Length = 318

 Score =  206 bits (503), Expect = 3e-52
 Identities = 96/107 (89%), Positives = 101/107 (94%), Gaps = 1/107 (0%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-NYGIPQKRL 217
           MSETL+LRGTL GHNGWVTQIATNPK PD I+S+SRDKTLIVWKLTRDE+ NYG PQKRL
Sbjct: 1   MSETLQLRGTLIGHNGWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRL 60

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           YGHSHFISDVVLSSDGNYALSGSWD+TLRLWDLAAGKTTRRFE HTK
Sbjct: 61  YGHSHFISDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTK 107



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLT--RDENNYGIPQKRLYGHSHFISDV 247
           GH  WV+ +  +P + + +I+S   D+T+ VW L   + +NN+       +GH+ +++ V
Sbjct: 147 GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNH-------HGHNGYLNTV 199

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +S DG+   SG  D    LWDL  GK     E
Sbjct: 200 TVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLE 232



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +++ +  +    +  LS S D+TL +W L       G   +R  GH+  +  V 
Sbjct: 60  LYGHSHFISDVVLSSD-GNYALSGSWDQTLRLWDLAA-----GKTTRRFEGHTKDVLSVA 113

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHT 355
            S+D    +SGS DKT++LW+ LA  K T + + HT
Sbjct: 114 FSADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHT 149



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 24/92 (26%), Positives = 45/92 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL+    GHNG++  +  +P    +  S  +D   ++W L   +N Y +       H+  
Sbjct: 184 KLKNNHHGHNGYLNTVTVSPD-GSLCTSGGKDSKALLWDLNDGKNLYTLE------HNDI 236

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           I+ +  S +  Y L  ++  ++++WDLA  KT
Sbjct: 237 INALCFSPN-RYWLCVAYGPSIKIWDLACKKT 267



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL--SGSWDKTLR 304
           I+S SRDKT+ +W  T  E  + I +    GH+ ++S V  S + +  +  S  WD+T++
Sbjct: 121 IVSGSRDKTIKLWN-TLAECKFTIQED---GHTDWVSCVRFSPNHSNPIIVSCGWDRTVK 176

Query: 305 LWDLAAGKTTRRFEDH 352
           +W+LA  K       H
Sbjct: 177 VWNLANCKLKNNHHGH 192


>UniRef50_Q5NCC6 Cluster: Guanine nucleotide binding protein (G
           protein), beta polypeptide 2 like 1 sequence 1; n=6;
           Euteleostomi|Rep: Guanine nucleotide binding protein (G
           protein), beta polypeptide 2 like 1 sequence 1 - Mus
           musculus (Mouse)
          Length = 146

 Score =  186 bits (454), Expect = 3e-46
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/81 (37%), Positives = 43/81 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            SSD    +SGS DKT++LW+
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWN 133


>UniRef50_P63244 Cluster: Guanine nucleotide-binding protein subunit
           beta-2-like 1; n=178; Eukaryota|Rep: Guanine
           nucleotide-binding protein subunit beta-2-like 1 - Homo
           sapiens (Human)
          Length = 317

 Score =  186 bits (454), Expect = 3e-46
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>UniRef50_Q6C591 Cluster: Yarrowia lipolytica chromosome E of strain
           CLIB 122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome E of
           strain CLIB 122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 233

 Score =  143 bits (346), Expect = 4e-33
 Identities = 62/112 (55%), Positives = 78/112 (69%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           LF   +++   L    T  GHNGWVT +AT+   PD++LS SRDK+LIVW LTRD+ NYG
Sbjct: 3   LFTYVARLGANLPRNSTNIGHNGWVTSLATSSNNPDILLSGSRDKSLIVWSLTRDDTNYG 62

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +P+K L GHSH + D  +S DG YA+SGSWDKTLR+WDL  G +  RF  HT
Sbjct: 63  VPRKSLKGHSHIVQDCAISHDGAYAISGSWDKTLRVWDLKTGVSKDRFVGHT 114



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R +L+GH+  V   A +      I S S DKTL VW L       G+ + R  GH+  + 
Sbjct: 65  RKSLKGHSHIVQDCAISHDGAYAI-SGSWDKTLRVWDLKT-----GVSKDRFVGHTGDVL 118

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            V  S D    +S   D+T+++W+
Sbjct: 119 SVSFSPDNRQIVSAGRDRTIKIWN 142


>UniRef50_Q6FW89 Cluster: Similar to sp|P38011 Saccharomyces
           cerevisiae YMR116c ASC1; n=1; Candida glabrata|Rep:
           Similar to sp|P38011 Saccharomyces cerevisiae YMR116c
           ASC1 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 277

 Score =  142 bits (344), Expect = 6e-33
 Identities = 61/103 (59%), Positives = 77/103 (74%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E L LRGTL GHNGWVT +AT+   P+++LS+SRDKTLI WKLT D+  +G+P K   G
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKG 63

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           HSH + D  L+ +G YALSGSWDKTLRLWD+A G+T + F  H
Sbjct: 64  HSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGH 106



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH G V  +A + K   MI+S SRDK++ VW +  D          L GH+ ++S V
Sbjct: 102 TFVGHKGDVMSVAIDKK-ASMIISGSRDKSIKVWSIKGD------CLATLIGHNDWVSQV 154

Query: 248 VL--SSDGN---YALSGSWDKTLR-LWDLAA 322
            +  SSD +     +S   DK ++ LW+ AA
Sbjct: 155 RIANSSDDDDKVTVISAGNDKMVKVLWNSAA 185



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 22/83 (26%), Positives = 39/83 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + +GH+  + Q  T  +     LS S DKTL +W +   E       +   GH   +  V
Sbjct: 60  SFKGHSH-IVQDCTLTENGAYALSGSWDKTLRLWDVATGETF-----QTFVGHKGDVMSV 113

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
            +    +  +SGS DK++++W +
Sbjct: 114 AIDKKASMIISGSRDKSIKVWSI 136


>UniRef50_Q6PRD4 Cluster: G-protein beta subunit; n=2; Paramecium
           tetraurelia|Rep: G-protein beta subunit - Paramecium
           tetraurelia
          Length = 334

 Score =  114 bits (274), Expect = 2e-24
 Identities = 55/105 (52%), Positives = 70/105 (66%), Gaps = 4/105 (3%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATN--PKYPDMILSSSRDKTLIVWKLTR--DENNYGIPQKRLYG 223
           K  G L+GH  WVT I TN  P   D+++S SRDK+++VWKL +  D +  G P+K+L G
Sbjct: 8   KQLGYLKGHGDWVTTIITNQDPTLADLVISGSRDKSILVWKLFKQPDGDLAGQPRKQLKG 67

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           HSHF+SD+VLS+D  Y LS SWDK LR WDL  G  T RF  + K
Sbjct: 68  HSHFVSDLVLSNDNKYLLSASWDKELRFWDLVNGTCTNRFVGNKK 112



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 3/106 (2%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDM---ILSSSRDKTLIVWKLT 178
           G    FK ++  +E  KL  T   H+ W++ +  +P   ++    ++   D  L VW   
Sbjct: 130 GAERKFKLYNVKAEE-KLTQTNHFHSDWISSVRYSPIIKNIQPYFVTVGWDGWLKVWN-- 186

Query: 179 RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
               N+ I + +   H   I+ V ++  G Y  +G  DK L +W++
Sbjct: 187 ---QNFTI-RFQFKAHDSQINSVAINPSGEYIATGGKDKKLYIWNI 228


>UniRef50_Q24D42 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 343

 Score =  110 bits (265), Expect = 2e-23
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 7/104 (6%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPD-----MILSSSRDKTLIVWKLTRDENN--YGIPQKRLY 220
           RG L GH+ WVT I       +     +++S SRDKT+++WKL  +E N  +GIP K L 
Sbjct: 14  RGILEGHSDWVTSIVAGFSQKENEDSPVLISGSRDKTVMIWKLYEEEQNGYFGIPHKALT 73

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+HF+SD+ LS +  +A+S SWDKTLRLWDL  G T +RF  H
Sbjct: 74  GHNHFVSDLALSQENCFAISSSWDKTLRLWDLRTGTTYKRFVGH 117



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/82 (32%), Positives = 41/82 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GHN +V+ +A + +     +SSS DKTL +W L       G   KR  GH   +  V 
Sbjct: 72  LTGHNHFVSDLALSQENC-FAISSSWDKTLRLWDLRT-----GTTYKRFVGHQSEVYSVA 125

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S D    LS   ++ ++LW++
Sbjct: 126 FSPDNRQILSAGAEREIKLWNI 147


>UniRef50_Q4DTN2 Cluster: Activated protein kinase C receptor,
           putative; n=3; Eukaryota|Rep: Activated protein kinase C
           receptor, putative - Trypanosoma cruzi
          Length = 318

 Score =  102 bits (244), Expect = 8e-21
 Identities = 50/105 (47%), Positives = 68/105 (64%), Gaps = 7/105 (6%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMIL---SSSRDKTLIVWKLTRDENN----YGIPQKRLYG 223
           G L+GH GWVT +A  P+  +  +   S+SRD TLI W    D N+    YG P++RL G
Sbjct: 7   GQLKGHRGWVTALAC-PQITETYIKAVSTSRDNTLIAWGSNMDRNSEECEYGFPERRLEG 65

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           HS F+SDV LS++G++A+S SWD +LRLW+L  G    +F  HTK
Sbjct: 66  HSAFVSDVALSNNGDFAVSASWDHSLRLWNLQTGVCQHKFLGHTK 110



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 2/111 (1%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRG-HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKL 175
           + G  +  + ++   E L   G  RG H  WV+ +  +P     +I+S   D  + VW +
Sbjct: 126 SGGRDNALRVWNVKGECLHTLG--RGAHTDWVSCVRFSPSLETPLIVSGGWDNLVKVWDI 183

Query: 176 TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
                  G     L GH+++I+ V +S DG+   S   D   RLWDL  G+
Sbjct: 184 AS-----GRLLTDLKGHTNYITSVTVSPDGSLCASSDKDGVARLWDLTKGE 229



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V+ +A +    D  +S+S D +L +W L       G+ Q +  GH+  +  V 
Sbjct: 63  LEGHSAFVSDVALSNN-GDFAVSASWDHSLRLWNLQT-----GVCQHKFLGHTKDVLSVT 116

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S D    +SG  D  LR+W++
Sbjct: 117 FSPDNRQIVSGGRDNALRVWNV 138



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P     I+S  RD  L VW + + E  + + +     H+ ++S V  S
Sbjct: 107 GHTKDVLSVTFSPDNRQ-IVSGGRDNALRVWNV-KGECLHTLGRG---AHTDWVSCVRFS 161

Query: 257 SDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDHT 355
                 L  SG WD  +++WD+A+G+     + HT
Sbjct: 162 PSLETPLIVSGGWDNLVKVWDIASGRLLTDLKGHT 196


>UniRef50_A2ELV7 Cluster: Guanine nucleotide-binding protein beta
           subunit, putative; n=3; Trichomonas vaginalis G3|Rep:
           Guanine nucleotide-binding protein beta subunit,
           putative - Trichomonas vaginalis G3
          Length = 335

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 44/99 (44%), Positives = 63/99 (63%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R T  GHN  +  I  + ++ + ++S+SRDK+ +VWKL R +  +  P  RL GH+HF+S
Sbjct: 26  RATFVGHNAAIESIEIDNEH-NYLVSASRDKSALVWKLNRTQEQWATPFTRLIGHNHFVS 84

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           DV LS D ++ L+ SWD TLRLWDL+   T + F  H K
Sbjct: 85  DVSLSRDASHLLTSSWDSTLRLWDLSTRTTKKLFLGHKK 123


>UniRef50_Q25306 Cluster: Guanine nucleotide-binding protein subunit
           beta-like protein; n=22; Trypanosomatidae|Rep: Guanine
           nucleotide-binding protein subunit beta-like protein -
           Leishmania major
          Length = 312

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 46/108 (42%), Positives = 68/108 (62%), Gaps = 6/108 (5%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMI--LSSSRDKTLIVWKLTRD----ENNYGIPQKR 214
           +   G L+GH GWVT +A   +    I  +S+SRD T+I WK   D    +++YG+P  R
Sbjct: 1   MNYEGHLKGHRGWVTSLACPQQAGSYIKVVSTSRDGTVISWKANPDRHSVDSDYGLPNHR 60

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           L GH+ F+S V L+   +YAL+ SWD+++R+WDL  G+  R+F  HTK
Sbjct: 61  LEGHTGFVSCVSLAHATDYALTASWDRSIRMWDLRNGQCQRKFLKHTK 108



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           GH  WV+ I  +P     +++S S D T+ VW +     N G  ++ L GHS+++S V +
Sbjct: 148 GHEDWVSSICFSPSLEHPIVVSGSWDNTIKVWNV-----NGGKCERTLKGHSNYVSTVTV 202

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGK 328
           S DG+   SG  D    LWDL+ G+
Sbjct: 203 SPDGSLCASGGKDGAALLWDLSTGE 227



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  +A +P    +I+S+ RD  + VW +  +  +  +      GH  ++S +  S 
Sbjct: 106 HTKDVLAVAFSPD-DRLIVSAGRDNVIRVWNVAGECMHEFLRD----GHEDWVSSICFSP 160

Query: 260 DGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDHT 355
              + +  SGSWD T+++W++  GK  R  + H+
Sbjct: 161 SLEHPIVVSGSWDNTIKVWNVNGGKCERTLKGHS 194


>UniRef50_Q9AVW0 Cluster: Guanine nucleotide-binding protein beta SU
           like protein; n=1; Guillardia theta|Rep: Guanine
           nucleotide-binding protein beta SU like protein -
           Guillardia theta (Cryptomonas phi)
          Length = 311

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 42/94 (44%), Positives = 61/94 (64%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN-YGIPQKRLYGHSHFISDVVLS 256
           H+  +T I+       +  SSSRDKT+++WK+  +E++   I  KRL GHSHF+S V LS
Sbjct: 14  HSDAITSISNCKNNKSLFASSSRDKTILIWKVEDEESDKMVIALKRLKGHSHFVSCVKLS 73

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++G++ +S SWD +LRLWDL + KT R    H K
Sbjct: 74  NNGDFCISSSWDNSLRLWDLMSAKTLRTLNGHKK 107



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/96 (29%), Positives = 50/96 (52%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +G + W+  +       D I+SS+ D  + +W L   +      QK+L GH +++ ++ +
Sbjct: 146 KGSSSWICNVILITNRNDEIISSNWDGEINLWNLRESKI-----QKKLIGHKNYVKELAI 200

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           S DG+   SG  DK++ LWDL  GK     E + ++
Sbjct: 201 SPDGSLCASGGGDKSIILWDLNEGKHLYSLEINDRI 236



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH+ +V+ +  +    D  +SSS D +L +W L   +       + L GH   +  V 
Sbjct: 60  LKGHSHFVSCVKLSNN-GDFCISSSWDNSLRLWDLMSAKT-----LRTLNGHKKSVLSVS 113

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S D    +S S D T+R+W+
Sbjct: 114 FSEDERQIISCSRDCTIRIWN 134


>UniRef50_A7EU93 Cluster: Putative uncharacterized protein; n=2;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1096

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/96 (38%), Positives = 55/96 (57%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV+ +A +P     + S S DKT+ +W  T  E+      + L GHS+++S V
Sbjct: 813  TLEGHSNWVSSVAFSPD-GTKVASGSHDKTIRLWDTTTGES-----LQTLEGHSNWVSSV 866

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D+T+RLWD   G++ +  E H+
Sbjct: 867  AFSPDGTKVASGSIDQTIRLWDTTTGESLQTLEGHS 902



 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 36/97 (37%), Positives = 57/97 (58%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV+ +A +P     + S S D+T+ +W  T  E+      + L GHS+++S V
Sbjct: 897  TLEGHSNWVSSVAFSPD-GTKVASGSIDQTIRLWDTTTGES-----LQTLEGHSNWVSSV 950

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              S DG    SGS+D+T+RLWD   G++ +  E H++
Sbjct: 951  AFSPDGTKVASGSYDQTIRLWDTITGESLQTLEGHSR 987



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 37/96 (38%), Positives = 53/96 (55%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  VT +A +P     + S S DKT+ +W     E+      + L GHS+++S V
Sbjct: 771  TLEGHSNSVTSVAFSPD-GTKVASGSHDKTIRLWDTITGES-----LQTLEGHSNWVSSV 824

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS DKT+RLWD   G++ +  E H+
Sbjct: 825  AFSPDGTKVASGSHDKTIRLWDTTTGESLQTLEGHS 860



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 36/96 (37%), Positives = 53/96 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +P     + SSS D+T+ +W  T  E+      + L GHS+ ++ V
Sbjct: 729 TLEGHSNSVYSVAFSPD-GTKVASSSYDQTIRLWDTTTGES-----LQTLEGHSNSVTSV 782

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS DKT+RLWD   G++ +  E H+
Sbjct: 783 AFSPDGTKVASGSHDKTIRLWDTITGESLQTLEGHS 818



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 35/104 (33%), Positives = 56/104 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV+ +A +P     + S S D+T+ +W     E+      + L GHS  +  V
Sbjct: 939  TLEGHSNWVSSVAFSPD-GTKVASGSYDQTIRLWDTITGES-----LQTLEGHSRSVGSV 992

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F 379
              S DG    SGS D+T+RLWD   G++ +  ++H+ +  +S F
Sbjct: 993  AFSPDGTKVASGSRDETIRLWDTITGESLQSLKNHSGLEASSAF 1036



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++K++R  +N+    + L GHS+ +  V  S DG    S S+D+T+RLWD   G++ +  
Sbjct: 713 IYKISRTRSNWSAALQTLEGHSNSVYSVAFSPDGTKVASSSYDQTIRLWDTTTGESLQTL 772

Query: 344 EDHT 355
           E H+
Sbjct: 773 EGHS 776


>UniRef50_Q5AT75 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 859

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 40/102 (39%), Positives = 57/102 (55%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+ TL GH+GWV  +A +P    ++ S S DKT+ +W     +   G  Q+ L GHS
Sbjct: 666 TGSLQQTLEGHSGWVLSVAFSPD-GRLLASGSFDKTVRLW-----DPATGSLQQTLRGHS 719

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +++  V  S DG    SGS+DKT+RLWD A G   +    H+
Sbjct: 720 NWVRSVAFSPDGRLLASGSFDKTVRLWDPATGSLQQTLRGHS 761



 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 39/92 (42%), Positives = 52/92 (56%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+ TLRGH+ WV  +A +P    ++ S S DKT+ +W     +   G  Q+ L GHS
Sbjct: 708 TGSLQQTLRGHSNWVRSVAFSPD-GRLLASGSFDKTVRLW-----DPATGSLQQTLRGHS 761

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             +  V  S DG    SGS+DKT+RLWD A G
Sbjct: 762 DTVRSVAFSPDGRLLASGSFDKTVRLWDPATG 793



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 22/71 (30%), Positives = 34/71 (47%)
 Frame = +2

Query: 143 SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           S D    + +L +    +G   + L GHS+ +  V+ S        GS D+T+RLWD A 
Sbjct: 615 SEDLPSWICQLPKVNEKWGAELQTLEGHSNSVWAVLAS--------GSDDETVRLWDPAT 666

Query: 323 GKTTRRFEDHT 355
           G   +  E H+
Sbjct: 667 GSLQQTLEGHS 677


>UniRef50_Q46F15 Cluster: WD-repeat protein; n=1; Methanosarcina
           barkeri str. Fusaro|Rep: WD-repeat protein -
           Methanosarcina barkeri (strain Fusaro / DSM 804)
          Length = 505

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 40/102 (39%), Positives = 57/102 (55%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + + TL+GH+G VT     P     I+S S DKTL VW L +           L GH
Sbjct: 205 KTKEEKVTLKGHSGPVTDFVITPD-GKRIISGSSDKTLRVWDLKKGNMT-------LKGH 256

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++ V ++SDG YA+SGS+D+T+++WDL  GK     E H
Sbjct: 257 KREVTSVAITSDGKYAISGSFDRTIKVWDLENGKIKVTLEGH 298



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 37/102 (36%), Positives = 53/102 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K++ TL GH  +++ I+  P   + I+SSS D+TL VW L R     GI    L GH
Sbjct: 287 ENGKIKVTLEGHKNYISTISIIPN-KNCIVSSSHDETLKVWDLDR-----GIDTITLIGH 340

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           S  +S V ++ DG   +S S D T ++W L   +     E H
Sbjct: 341 SGSVSSVAITPDGKSIVSASGDGTHKIWSLENREEIATLEGH 382



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 35/96 (36%), Positives = 50/96 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+G V+ +A  P     I+S+S D T  +W L   EN   I    L GH    S +
Sbjct: 336 TLIGHSGSVSSVAITPDGKS-IVSASGDGTHKIWSL---ENREEIAT--LEGHKSAPSTI 389

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V++ DG YA+S S+D+T+++ DL           HT
Sbjct: 390 VITPDGKYAVSASYDRTIKILDLKKQIVKTSLRGHT 425



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/90 (34%), Positives = 47/90 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET + +   + H+  +T+I   P     + S S D TL VW L + E         L  H
Sbjct: 79  ETGEEKAAFKEHSEPITEIVITPDGKRAV-SGSSDNTLKVWDLEKMEE-----LTTLISH 132

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+ +S + ++  G YA+SGS D TL++WDL
Sbjct: 133 SNSVSKIAITPSGKYAISGSSDNTLKVWDL 162



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR-DENNYGIPQKRLYGHSHFISD 244
           TL  H+  V++IA  P      +S S D TL VW L + DE           GHS  ++ 
Sbjct: 128 TLISHSNSVSKIAITPS-GKYAISGSSDNTLKVWDLKKLDEETIST------GHSKSVNK 180

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +V++ DG  A+S S+D TL++WDL   +     + H+
Sbjct: 181 IVITPDGKLAVSSSYDGTLKVWDLKTKEEKVTLKGHS 217



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 36/98 (36%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL+GH   VT +A  ++ KY    +S S D+T+ VW L   EN  G  +  L GH ++IS
Sbjct: 252 TLKGHKREVTSVAITSDGKYA---ISGSFDRTIKVWDL---EN--GKIKVTLEGHKNYIS 303

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + +  + N  +S S D+TL++WDL  G  T     H+
Sbjct: 304 TISIIPNKNCIVSSSHDETLKVWDLDRGIDTITLIGHS 341



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 33/97 (34%), Positives = 47/97 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH   V  IA  P      +S S D TL VW L +         + L  HS  I+  
Sbjct: 3   TLRGHEK-VFSIAVTPN-GKYAVSGSHDGTLKVWDLEKWREI-----RSLRAHSKSITAF 55

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++SDG   + GS D  L +W+L  G+    F++H++
Sbjct: 56  AITSDGKLVVLGSLDGNLEVWNLETGEEKAAFKEHSE 92



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/92 (30%), Positives = 44/92 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH    + I   P      +S+S D+T+ +  L +      I +  L GH+   + V
Sbjct: 378 TLEGHKSAPSTIVITPD-GKYAVSASYDRTIKILDLKKQ-----IVKTSLRGHTDSATLV 431

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            ++S+  Y +S S D TLR+WDL +      F
Sbjct: 432 AVTSNSRYVVSASRDNTLRVWDLESSSEVSCF 463


>UniRef50_Q2UR60 Cluster: WD40 repeat; n=1; Aspergillus oryzae|Rep:
           WD40 repeat - Aspergillus oryzae
          Length = 301

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 35/98 (35%), Positives = 55/98 (56%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+RGH+ WV  +A +P    ++ S S D T+++W     + N G   + L GHS  +  V
Sbjct: 57  TMRGHSDWVQSVAFSPD-GQLVASGSYDNTIMLW-----DTNTGQHLRTLKGHSSLVGAV 110

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG+   SGS+DKT++LW+   G+  R  E H+ +
Sbjct: 111 AFSPDGHMIASGSYDKTVKLWNTKTGQQLRTLEGHSGI 148



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 35/106 (33%), Positives = 56/106 (52%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+T K   TL GH+  V  +A +P    +++S S D T+ +W     ++N G   + + G
Sbjct: 7   SKTGKQLRTLDGHSDSVVSVAFSPD-SQLVVSGSDDNTIKLW-----DSNTGQQLRTMRG 60

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           HS ++  V  S DG    SGS+D T+ LWD   G+  R  + H+ +
Sbjct: 61  HSDWVQSVAFSPDGQLVASGSYDNTIMLWDTNTGQHLRTLKGHSSL 106



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 33/96 (34%), Positives = 45/96 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+  V  +A +P    MI S S DKT+ +W         G   + L GHS  +  V
Sbjct: 99  TLKGHSSLVGAVAFSPD-GHMIASGSYDKTVKLWN-----TKTGQQLRTLEGHSGIVRSV 152

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               D     SGS+D T++LWD   G   R    H+
Sbjct: 153 TFLPDSQTVASGSYDSTIKLWDTTTGLELRTIRGHS 188



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 32/96 (33%), Positives = 46/96 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+G V  +   P     + S S D T+ +W  T      G+  + + GHS  +  V
Sbjct: 141 TLEGHSGIVRSVTFLPD-SQTVASGSYDSTIKLWDTTT-----GLELRTIRGHSGPVRSV 194

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D     SGS+D T++LWD   G+  R   DH+
Sbjct: 195 SFSPDSPMIASGSYDNTIKLWDTKTGQHLRTLGDHS 230


>UniRef50_A7EMT8 Cluster: Putative uncharacterized protein; n=2;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1249

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 38/96 (39%), Positives = 53/96 (55%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV  +A +P     I S SRD+T+ +W     +   G   +R  GHS  ++ V
Sbjct: 999  TLEGHSSWVYSVAFSPD-GTKIASGSRDRTIRLW-----DTITGELLQRFKGHSDSVNSV 1052

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D+T+RLWD   G+  +RFE H+
Sbjct: 1053 AFSPDGTKIASGSRDRTIRLWDTVTGEPLQRFEGHS 1088



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 37/102 (36%), Positives = 56/102 (54%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L    +GH+  V  +A +P     I S SRD+T+ +W     E     P +R  GHS
Sbjct: 1035 TGELLQRFKGHSDSVNSVAFSPD-GTKIASGSRDRTIRLWDTVTGE-----PLQRFEGHS 1088

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +++  V  S DG    SGS D+T+RLW+   GK+ +RF+ H+
Sbjct: 1089 NWVRSVAFSPDGTKIASGSDDETIRLWNTTTGKSLQRFKGHS 1130



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +2

Query: 164  VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            ++K++R  +++    + L GHS ++  V  S DG    SGS D+T+RLWD   G+  +RF
Sbjct: 983  IYKISRTRSSWSAALQTLEGHSSWVYSVAFSPDGTKIASGSRDRTIRLWDTITGELLQRF 1042

Query: 344  EDHT 355
            + H+
Sbjct: 1043 KGHS 1046



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 32/102 (31%), Positives = 49/102 (48%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH+ WV+           I S S D T+ +W     E       + L G+S +IS +  
Sbjct: 1127 KGHSDWVST---------KIASGSDDDTIRLWDTITGEL-----LQTLEGYSDWISSIAF 1172

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F 379
            S DG    SGS D+ +RLWD   G++ +  E H+ +  +S F
Sbjct: 1173 SPDGTKVASGSGDQMIRLWDTITGESLQTLEYHSSLKASSAF 1214


>UniRef50_Q3MCV7 Cluster: WD-40 repeat; n=2; Nostocaceae|Rep: WD-40
            repeat - Anabaena variabilis (strain ATCC 29413 / PCC
            7937)
          Length = 1652

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 36/96 (37%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV+ +A  P+    + S S DKT+ +W +     N G   K L GHS  +  +
Sbjct: 1039 TLAGHENWVSSVAFAPQ-KRQLASGSGDKTVKIWDI-----NSGKTLKTLSGHSDSVISI 1092

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS DKT+++WD+ +GKT +    H+
Sbjct: 1093 AYSPDGQQLASGSGDKTIKIWDINSGKTLKTLSGHS 1128



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 35/96 (36%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V  IA +P     + S+S DKT+ +W +     N G   K L GHSH +  V
Sbjct: 1123 TLSGHSDSVINIAYSPN-KQQLASASDDKTVKIWDI-----NSGKSLKTLSGHSHAVRSV 1176

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    S S DKT+++WD+ +G+  +    H+
Sbjct: 1177 TYSPDGKRLASASRDKTIKIWDINSGQLLKTLSGHS 1212



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +TLK   TL GH+ WV  I  +P     + S S DKT+ +W ++      G P K L GH
Sbjct: 1371 QTLK---TLSGHSDWVRSITYSPN-GKQLASGSGDKTIKIWDVST-----GQPVKTLLGH 1421

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               +  V  S DG    S S D T+++WD+ +G+  +    H+
Sbjct: 1422 KDRVISVAYSPDGQQLASASGDTTIKIWDVNSGQLLKTLTGHS 1464



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 45/83 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV  +A +P     + S+SRD T+ +W ++      G   K L GHS ++  +
Sbjct: 1541 TLTGHSNWVRSVAYSPD-GQQLASASRDNTIKIWDVSS-----GQVLKTLTGHSDWVRSI 1594

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
            + S DG    S S DKT+  WDL
Sbjct: 1595 IYSPDGKQLASASGDKTIIFWDL 1617



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 32/95 (33%), Positives = 50/95 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V  +  +P     + S+SRDKT+ +W +     N G   K L GHS  +  +
Sbjct: 1165 TLSGHSHAVRSVTYSPD-GKRLASASRDKTIKIWDI-----NSGQLLKTLSGHSDGVISI 1218

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG +  S S DKT+++WD++ G+  +    H
Sbjct: 1219 AYSPDGKHLASASSDKTIKIWDISNGQLLKTLSSH 1253



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 33/95 (34%), Positives = 49/95 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     + S+S D T+ +W +     N G   K L GHS ++  V
Sbjct: 1417 TLLGHKDRVISVAYSPD-GQQLASASGDTTIKIWDV-----NSGQLLKTLTGHSSWVRSV 1470

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    S S DKT+++WD+++GK  +    H
Sbjct: 1471 TYSPDGKQLASASDDKTIKIWDISSGKLLKTLSGH 1505



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 32/96 (33%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V  IA +P     + S S DKT+ +W +     N G   K L GHS  + ++
Sbjct: 1081 TLSGHSDSVISIAYSPD-GQQLASGSGDKTIKIWDI-----NSGKTLKTLSGHSDSVINI 1134

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S +     S S DKT+++WD+ +GK+ +    H+
Sbjct: 1135 AYSPNKQQLASASDDKTVKIWDINSGKSLKTLSGHS 1170



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 31/100 (31%), Positives = 50/100 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL GH   V  +A +P    +  +S   K   +W ++      G P K L GHS++
Sbjct: 1497 KLLKTLSGHQDSVKSVAYSPDGKQLAAASDNIK---IWDVSS-----GKPLKTLTGHSNW 1548

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  V  S DG    S S D T+++WD+++G+  +    H+
Sbjct: 1549 VRSVAYSPDGQQLASASRDNTIKIWDVSSGQVLKTLTGHS 1588



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/100 (31%), Positives = 51/100 (51%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  TL GH+  V  IA +P     + S+S DKT+ +W ++  +     P K L GHS  
Sbjct: 1287 QLLKTLSGHSNSVYSIAYSPD-GKQLASASGDKTIKIWDVSISK-----PLKILSGHSDS 1340

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  +  S       SGS D  +++WD++ G+T +    H+
Sbjct: 1341 VISIAYSPSEKQLASGSGDNIIKIWDVSTGQTLKTLSGHS 1380



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 35/117 (29%), Positives = 58/117 (49%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG  ++      +S+ LK+   L GH+  V  IA +P     + S S D  + +W ++ 
Sbjct: 1314 ASGDKTIKIWDVSISKPLKI---LSGHSDSVISIAYSPS-EKQLASGSGDNIIKIWDVST 1369

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                 G   K L GHS ++  +  S +G    SGS DKT+++WD++ G+  +    H
Sbjct: 1370 -----GQTLKTLSGHSDWVRSITYSPNGKQLASGSGDKTIKIWDVSTGQPVKTLLGH 1421



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/100 (31%), Positives = 51/100 (51%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  TL  H+  V  IA +P    ++ S S DKT+ +W ++  +       K L GHS+ 
Sbjct: 1245 QLLKTLSSHDQPVYSIAYSPNGQQLV-SVSGDKTIKIWDVSSSQL-----LKTLSGHSNS 1298

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  +  S DG    S S DKT+++WD++  K  +    H+
Sbjct: 1299 VYSIAYSPDGKQLASASGDKTIKIWDVSISKPLKILSGHS 1338



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/100 (29%), Positives = 49/100 (49%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  TL GH+ WV  +  +P     + S+S DKT+ +W ++      G   K L GH   
Sbjct: 1455 QLLKTLTGHSSWVRSVTYSPD-GKQLASASDDKTIKIWDISS-----GKLLKTLSGHQDS 1508

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  V  S DG    + S    +++WD+++GK  +    H+
Sbjct: 1509 VKSVAYSPDGKQLAAAS--DNIKIWDVSSGKPLKTLTGHS 1546



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
            TL GH+ WV  I  +P     + S+S DKT+I W L  D
Sbjct: 1583 TLTGHSDWVRSIIYSPD-GKQLASASGDKTIIFWDLDFD 1620


>UniRef50_Q3M2E2 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Anabaena variabilis ATCC 29413|Rep:
           Serine/Threonine protein kinase with WD40 repeats -
           Anabaena variabilis (strain ATCC 29413 / PCC 7937)
          Length = 682

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 38/95 (40%), Positives = 51/95 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   ++ IA +P   +++ S S D T+ +W LT  E         L GHSHF+  V
Sbjct: 480 TLIGHAQGISSIAFSPD-GNILASGSYDTTIKLWNLTTGEQI-----NTLIGHSHFVLSV 533

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG   +SG +D T++LWDL  GK TR    H
Sbjct: 534 AFSPDGKTLVSGCYDATIKLWDLVTGKQTRTITGH 568



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 32/95 (33%), Positives = 49/95 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ +V  +A +P    ++ S   D T+ +W L       G   + + GH   ++ V
Sbjct: 522 TLIGHSHFVLSVAFSPDGKTLV-SGCYDATIKLWDLVT-----GKQTRTITGHGDSVTSV 575

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++S DG    SGS+D+T+ LWDL   K   RF  H
Sbjct: 576 IISPDGETFASGSFDETVILWDLVTAKEIHRFYKH 610



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 2/115 (1%)
 Frame = +2

Query: 20  LFKPFSKMSETL--KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           +F   SK  + +  K + +L GH+ WV+ + T     +M++S S D T+ +W LT ++  
Sbjct: 336 IFPSTSKSQKLIEKKEKNSLIGHSNWVSSV-TFSSDGNMVISGSYDTTIKIWNLTTEKQI 394

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                  L GH+  +  + +S +     SGS DKT++LW+L   +       HTK
Sbjct: 395 C-----TLTGHTDSVLSIAISPNDKIIASGSSDKTIKLWNLVTMQQICTLIGHTK 444



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/96 (33%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   ++ + T     +++ S S D T+ +W LT  E         L GH+  IS +
Sbjct: 438 TLIGHTKGISSV-TFSLNRNILASGSYDTTIKLWNLTTKEEIC-----TLIGHAQGISSI 491

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DGN   SGS+D T++LW+L  G+       H+
Sbjct: 492 AFSPDGNILASGSYDTTIKLWNLTTGEQINTLIGHS 527



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 28/108 (25%), Positives = 52/108 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   T+ GH   VT +  +P   +   S S D+T+I+W L   +  +     R Y H 
Sbjct: 558 TGKQTRTITGHGDSVTSVIISPD-GETFASGSFDETVILWDLVTAKEIH-----RFYKHY 611

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS 373
           + ++ V  S++     SGS D T++++ L++ K   +   +    +N+
Sbjct: 612 NNVNSVAFSTNSKIIASGSDDNTIQIFHLSSQKFNNKISINKNTSKNN 659


>UniRef50_A7BZX0 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Beggiatoa sp. PS|Rep: Serine/Threonine
           protein kinase with WD40 repeats - Beggiatoa sp. PS
          Length = 369

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 39/99 (39%), Positives = 54/99 (54%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR TLRGH GW+  +A +P     + S S D+T+ +W    D +  G   + L GH   
Sbjct: 245 KLR-TLRGHRGWLNTVAFSPD-GKTLASGSLDRTIRLW----DVDKKGKRSRVLRGHRSA 298

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V  S+DG    SGS DKT+RLW++  GK  R  + H
Sbjct: 299 VMSVSFSNDGKILASGSLDKTIRLWNVETGKLERTLKGH 337



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 29/97 (29%), Positives = 51/97 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ HN WVT +  +P Y  ++ S   D  + +W++   +  +      L GH + ++ V
Sbjct: 122 TLKAHNFWVTSVTFSP-YGKILASGGEDHIINLWEVGTGKKLHA-----LKGHKNAVTSV 175

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG +  S SWD+ + LW++A G+  R  + H +
Sbjct: 176 TFSPDGRFLASSSWDRDIHLWEIATGRKVRTLKGHRR 212



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 33/94 (35%), Positives = 46/94 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   VT +  +P     + SSS D+ + +W++       G   + L GH   +  V 
Sbjct: 165 LKGHKNAVTSVTFSPD-GRFLASSSWDRDIHLWEIAT-----GRKVRTLKGHRRNVPFVT 218

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S +G    S SWDKTLRLWD+  GK  R    H
Sbjct: 219 FSPNGKMLASASWDKTLRLWDVRTGKKLRTLRGH 252



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 31/99 (31%), Positives = 48/99 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL+GH   VT IA +P    M+ S S D+T+ +W +     N G   + L  H+ +
Sbjct: 76  KVLRTLKGHGRNVTSIAFSPD-GKMLASGSEDETIKLWNV-----NTGEVLRTLKAHNFW 129

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ V  S  G    SG  D  + LW++  GK     + H
Sbjct: 130 VTSVTFSPYGKILASGGEDHIINLWEVGTGKKLHALKGH 168



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +2

Query: 173 LTRDENNYGIPQK---RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           L   +  + +P K    L GH   ++ +  S DG    SGS D+T++LW++  G+  R  
Sbjct: 64  LADSQKEFQLPSKVLRTLKGHGRNVTSIAFSPDGKMLASGSEDETIKLWNVNTGEVLRTL 123

Query: 344 EDH 352
           + H
Sbjct: 124 KAH 126



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 3/83 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH-SHFISDV 247
           LRGH   V  ++ +     ++ S S DKT+ +W +       G  ++ L GH  H +S  
Sbjct: 292 LRGHRSAVMSVSFSND-GKILASGSLDKTIRLWNVET-----GKLERTLKGHWGHILSVS 345

Query: 248 VLSSDGNYAL--SGSWDKTLRLW 310
              +D + ++  SGS DKT++LW
Sbjct: 346 FNPNDNSRSVLASGSEDKTIKLW 368



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWK 172
           ET KL  TL+GH G +  ++ NP      ++ S S DKT+ +W+
Sbjct: 326 ETGKLERTLKGHWGHILSVSFNPNDNSRSVLASGSEDKTIKLWQ 369


>UniRef50_A6S2T5 Cluster: Putative uncharacterized protein; n=1;
            Botryotinia fuckeliana B05.10|Rep: Putative
            uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1103

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 40/96 (41%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WVT I  +P     I S+S D T+ +W  T      G  QK L GHS +I  V
Sbjct: 870  TLEGHSSWVTAIVFSPD-GKTIASASNDHTVRLWNATT-----GAHQKTLEGHSDWIRAV 923

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V S DG    S S DKT+RLW+  +G   +  E H+
Sbjct: 924  VFSPDGKIIASASDDKTVRLWNATSGAHQKTLEGHS 959



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 36/98 (36%), Positives = 52/98 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ W+  +  +P    +I S+S DKT+ +W  T      G  QK L GHS +++ +
Sbjct: 912  TLEGHSDWIRAVVFSPD-GKIIASASDDKTVRLWNATS-----GAHQKTLEGHSSWVTAI 965

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            V S DG    S S DKT+RLW+   G      E H+ +
Sbjct: 966  VFSPDGKTIASASDDKTIRLWNATTGAHQYTLEVHSTI 1003



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 34/96 (35%), Positives = 49/96 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WVT +  +P     I S+S D T+ +W  T   + Y      L GHS +++ +
Sbjct: 828  TLEGHSDWVTAVVFSPD-SKTIASASDDHTVRLWNATSGAHQY-----TLEGHSSWVTAI 881

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V S DG    S S D T+RLW+   G   +  E H+
Sbjct: 882  VFSPDGKTIASASNDHTVRLWNATTGAHQKTLEGHS 917



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 36/96 (37%), Positives = 48/96 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G VT +  +P     I S+S D T+ +W  T   + Y      L GHS  +  V
Sbjct: 744  TLEGHSGGVTAVVFSPD-SKTIASASDDHTVRLWNATSGAHQY-----TLEGHSGGVRAV 797

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V S DG    S S DKT+RLW+   G   +  E H+
Sbjct: 798  VFSPDGKIIASASDDKTVRLWNATTGAHQKTLEGHS 833



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 36/96 (37%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V  +  +P    +I S+S DKT+ +W  T      G  QK L GHS +++ V
Sbjct: 786  TLEGHSGGVRAVVFSPD-GKIIASASDDKTVRLWNATT-----GAHQKTLEGHSDWVTAV 839

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V S D     S S D T+RLW+  +G      E H+
Sbjct: 840  VFSPDSKTIASASDDHTVRLWNATSGAHQYTLEGHS 875



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + N+   Q+ L GHS  ++ VV S D     S S D T+RLW+  +G      E H+
Sbjct: 735 KENWDAHQQTLEGHSGGVTAVVFSPDSKTIASASDDHTVRLWNATSGAHQYTLEGHS 791


>UniRef50_A0YUC6 Cluster: Serine/threonine kinase with WD-40 repeat;
           n=1; Lyngbya sp. PCC 8106|Rep: Serine/threonine kinase
           with WD-40 repeat - Lyngbya sp. PCC 8106
          Length = 1908

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 39/96 (40%), Positives = 56/96 (58%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WVT +A +P    ++ S S DKTL +W L   +      Q  L  HS +I   
Sbjct: 153 TLEGHSSWVTTLAVSPDGKKLV-SGSCDKTLKIWDLNTRKQ-----QHTLTDHSGWICSA 206

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V+SSDG  A SGS D T++LW+L +GK  +  ++H+
Sbjct: 207 VISSDGIIA-SGSTDNTIKLWNLNSGKLLQTLKEHS 241



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 32/104 (30%), Positives = 51/104 (49%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +L       + WV  +A  P     I++   D  + +W L   E+ +      L G
Sbjct: 103 AETGELLRKFEADSHWVLSVAIAPDNKT-IITGGTDSQIKIWSLQTGESLF-----TLEG 156

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS +++ + +S DG   +SGS DKTL++WDL   K      DH+
Sbjct: 157 HSSWVTTLAVSPDGKKLVSGSCDKTLKIWDLNTRKQQHTLTDHS 200



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/87 (31%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K + TL  H+GW+     +     +I S S D T+ +W L     N G   + L  HS
Sbjct: 189 TRKQQHTLTDHSGWICSAVISSD--GIIASGSTDNTIKLWNL-----NSGKLLQTLKEHS 241

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
            ++  + +SSDG    SGS +  ++ W
Sbjct: 242 DWVQALAISSDGERLFSGSRNGEIKFW 268



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           I+ +V+S D  Y + GSW K +R+WD   G+  R+FE
Sbjct: 78  ITSIVISPDHKYIVGGSW-KIVRVWDAETGELLRKFE 113


>UniRef50_A7EJN8 Cluster: Putative uncharacterized protein; n=2;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1136

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 35/96 (36%), Positives = 53/96 (55%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV  +A +P     + S S D+T+ +W     E+      + L GHS  ++ V
Sbjct: 749  TLEGHSNWVRSVAFSPD-GTKVASGSDDRTIRLWDTATGES-----LQTLEGHSDGVTSV 802

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS+D+T+RLWD A G++ +  E H+
Sbjct: 803  AFSPDGTKVASGSYDQTIRLWDAATGESLQTLEGHS 838



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 35/96 (36%), Positives = 53/96 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +A +P     + S S D+T+ +W     E+      + L GHS+++  V
Sbjct: 707 TLEGHSNWVRSVAFSPD-GTKVASGSDDRTIRLWDAATGES-----LQTLEGHSNWVRSV 760

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS D+T+RLWD A G++ +  E H+
Sbjct: 761 AFSPDGTKVASGSDDRTIRLWDTATGESLQTLEGHS 796



 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 37/95 (38%), Positives = 52/95 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  VT +A +P     + S S D+T+  W     E+      + L GHSH++S V
Sbjct: 917  TLEGHSDGVTSVAFSPD-GTKVASGSYDQTIRFWDAVTGES-----LQTLEGHSHWVSSV 970

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS D+T+RLWD A G++ +  E H
Sbjct: 971  AFSPDGTKVASGSDDRTIRLWDTATGESLQTLEGH 1005



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 35/96 (36%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV+ +A +P     + S S D+T+ +W     E+      + L GH   +S V
Sbjct: 833  TLEGHSNWVSSVAFSPD-GTKVASGSDDRTIRLWDAATGES-----LQTLEGHLDAVSSV 886

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D+T+RLWD A G++ +  E H+
Sbjct: 887  AFSPDGTKVASGSDDRTIRLWDTATGESLQTLEGHS 922



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 36/95 (37%), Positives = 53/95 (55%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  VT +A +P     + S S D+T+ +W     E+      + L GHS+++S V
Sbjct: 791  TLEGHSDGVTSVAFSPD-GTKVASGSYDQTIRLWDAATGES-----LQTLEGHSNWVSSV 844

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS D+T+RLWD A G++ +  E H
Sbjct: 845  AFSPDGTKVASGSDDRTIRLWDAATGESLQTLEGH 879



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 35/96 (36%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV+ +A +P     + S S D+T+ +W     E+      + L GH   +  V
Sbjct: 959  TLEGHSHWVSSVAFSPD-GTKVASGSDDRTIRLWDTATGES-----LQTLEGHLDAVYSV 1012

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D T+RLWD A GK+ +  E H+
Sbjct: 1013 AFSPDGTKVASGSGDWTIRLWDAATGKSLQTLEGHS 1048



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 32/96 (33%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V+ +A +P     + S S D+T+ +W     E+      + L GHS  ++ V
Sbjct: 875  TLEGHLDAVSSVAFSPD-GTKVASGSDDRTIRLWDTATGES-----LQTLEGHSDGVTSV 928

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS+D+T+R WD   G++ +  E H+
Sbjct: 929  AFSPDGTKVASGSYDQTIRFWDAVTGESLQTLEGHS 964



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/96 (35%), Positives = 48/96 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V  +A +P     + S S D+T+ +W     E+      + L GH   +  V
Sbjct: 1043 TLEGHSNAVYSVAFSPD-GTKVASGSYDRTIRLWDTVTGES-----LQTLEGHLDAVYSV 1096

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D T+RLWD A GK+ +  E H+
Sbjct: 1097 AFSPDGTKVASGSGDWTIRLWDAATGKSLQTLEGHS 1132



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/64 (37%), Positives = 40/64 (62%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++K++R  +N+    + L GHS+++  V  S DG    SGS D+T+RLWD A G++ +  
Sbjct: 691 IYKISRVRSNWSAALQTLEGHSNWVRSVAFSPDGTKVASGSDDRTIRLWDAATGESLQTL 750

Query: 344 EDHT 355
           E H+
Sbjct: 751 EGHS 754



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 33/95 (34%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     + S S D T+ +W         G   + L GHS+ +  V
Sbjct: 1001 TLEGHLDAVYSVAFSPD-GTKVASGSGDWTIRLWDAAT-----GKSLQTLEGHSNAVYSV 1054

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS+D+T+RLWD   G++ +  E H
Sbjct: 1055 AFSPDGTKVASGSYDRTIRLWDTVTGESLQTLEGH 1089


>UniRef50_A7EAT8 Cluster: Putative uncharacterized protein; n=2;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 968

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 38/104 (36%), Positives = 57/104 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V+ +A +P     + S S DKT+ +W     E+      + L GHS +++ V
Sbjct: 869  TLEGHSGSVSSVAFSPD-GTKVASGSHDKTIRLWDAMTGES-----LQTLEGHSSWVNSV 922

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F 379
              S DG    SGS DKT+RLWD   G++ +  E H+ +  +S F
Sbjct: 923  AFSPDGTKVASGSHDKTIRLWDAMTGESLQTLEGHSSLQASSAF 966



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 37/96 (38%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V+ +A +P     + S S DKT+ +W     E+      + L GHS  +S V
Sbjct: 785  TLEGHSGSVSSVAFSPD-GTKVASGSHDKTIRLWDAMTGES-----LQTLEGHSGSVSSV 838

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS DKT+RLWD   G++ +  E H+
Sbjct: 839  AFSPDGTKVASGSHDKTIRLWDAMTGESLQTLEGHS 874



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 34/96 (35%), Positives = 50/96 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+G V  +A +P     + S S D T+ +W     E+      + L GHS ++  V
Sbjct: 659 TLEGHSGSVKSVAFSPD-GTKVASGSHDNTIRLWDAMTGES-----LQTLEGHSDWVKSV 712

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS D+T+RLWD   G++ +  E H+
Sbjct: 713 AFSPDGTKVASGSDDETIRLWDAMTGESLQTLEGHS 748



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 35/96 (36%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V+ +A +P     + S S D+T+ +W     E+      + L GHS  +S V
Sbjct: 743  TLEGHSDSVSSVAFSPD-GTKVASGSDDETIRLWDAMTGES-----LQTLEGHSGSVSSV 796

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS DKT+RLWD   G++ +  E H+
Sbjct: 797  AFSPDGTKVASGSHDKTIRLWDAMTGESLQTLEGHS 832



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/64 (35%), Positives = 36/64 (56%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++K++R  +N+    + L GHS  +  V  S DG    SGS D T+RLWD   G++ +  
Sbjct: 643 IYKISRTRSNWSAALQTLEGHSGSVKSVAFSPDGTKVASGSHDNTIRLWDAMTGESLQTL 702

Query: 344 EDHT 355
           E H+
Sbjct: 703 EGHS 706


>UniRef50_A6S2Q5 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 897

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 41/106 (38%), Positives = 58/106 (54%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           S  S TL+   TL GH+  VT +A +P    ++ S S DKT+ +W +   E+      + 
Sbjct: 693 SNWSATLQ---TLEGHSESVTSVAFSPD-GKVVASGSNDKTIRLWDVATGES-----LQT 743

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GHS  +  V  S DG    SGS DKT+RLWD+A G++ +  E H
Sbjct: 744 LEGHSESVRSVAFSPDGKVVASGSDDKTIRLWDVATGESLQTLEGH 789



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/104 (35%), Positives = 57/104 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V  +A +P    ++ S S DKT+ +W +   E+      + L GH  ++  V
Sbjct: 743  TLEGHSESVRSVAFSPD-GKVVASGSDDKTIRLWDVATGES-----LQTLEGHLDWVRSV 796

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F 379
              S DG    SGS DKT+RLWD+A G++ +  E H+ +  +S F
Sbjct: 797  SFSPDGKVVASGSRDKTVRLWDVATGESLQTLEGHSVLEASSVF 840



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 25/65 (38%), Positives = 41/65 (63%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++K++R  +N+    + L GHS  ++ V  S DG    SGS DKT+RLWD+A G++ +  
Sbjct: 685 IYKISRTRSNWSATLQTLEGHSESVTSVAFSPDGKVVASGSNDKTIRLWDVATGESLQTL 744

Query: 344 EDHTK 358
           E H++
Sbjct: 745 EGHSE 749


>UniRef50_A7IQV8 Cluster: NWD2 protein; n=5; Sordariales|Rep: NWD2
           protein - Podospora anserina
          Length = 1118

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 37/103 (35%), Positives = 54/103 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET   + TL GH+GWV  +  +P     I S S D+T+ +W L       G  Q+ L GH
Sbjct: 685 ETGSCQQTLEGHSGWVWSVVFSPD-SKWIASGSGDRTIKIWNLET-----GSCQQTLEGH 738

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  VV S D  +  SGS D+T+++W+L  G   +  E H+
Sbjct: 739 SDSVRSVVFSPDSKWIASGSDDRTIKIWNLETGSCQQTLEGHS 781



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET   + TL GH+  V  +  +P     I S S D+T+ +W L       G  Q+ L GH
Sbjct: 811  ETGSCQQTLEGHSDSVWSVVFSPD-SKWIASGSDDRTIKIWNLET-----GSCQQTLEGH 864

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  VV S D  +  SGS D+T+++W+L  G   +  E H+
Sbjct: 865  SDSVRSVVFSPDSKWIASGSGDRTIKIWNLETGSCQQTLEGHS 907



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET   + TL GH+  V  +  +P     I S S D+T+ +W L       G  Q+ L GH
Sbjct: 853  ETGSCQQTLEGHSDSVRSVVFSPD-SKWIASGSGDRTIKIWNLET-----GSCQQTLEGH 906

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  VV S D  +  SGS D+T+++W+L  G   +  E H+
Sbjct: 907  SDSVRSVVFSPDSKWIASGSDDRTIKIWNLETGSCQQTLEGHS 949



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 35/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET   + TL GH+  V  +  +P     I S S D T+ +W L       G  Q+ L GH
Sbjct: 643 ETGSCQQTLEGHSSSVGSVVFSPD-SKWIASGSGDCTIKIWNLET-----GSCQQTLEGH 696

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S ++  VV S D  +  SGS D+T+++W+L  G   +  E H+
Sbjct: 697 SGWVWSVVFSPDSKWIASGSGDRTIKIWNLETGSCQQTLEGHS 739



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 35/103 (33%), Positives = 51/103 (49%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET   + TL GH+  V  +  +P     I S S D+T+ +W L       G  Q+ L GH
Sbjct: 727  ETGSCQQTLEGHSDSVRSVVFSPD-SKWIASGSDDRTIKIWNLET-----GSCQQTLEGH 780

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  VV S D  +  SGS D T+++W+L  G   +  E H+
Sbjct: 781  SDSVWSVVFSPDSKWIASGSDDHTIKIWNLETGSCQQTLEGHS 823



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET   + TL GH+  V  +         I S S D T+ +W L       G  Q+ L GH
Sbjct: 937  ETGSCQQTLEGHSDSVWSVVFFSPDSKWIASGSDDHTIKIWNLET-----GSCQQTLEGH 991

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  VV S D  +  SGS D+T+++W+L  G   +  E H+
Sbjct: 992  SDSVRSVVFSPDSKWIASGSGDRTIKIWNLETGSCQQTLEGHS 1034



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++++   ++ L GHS  +  VV S D  +  SGS D+T+++W+L  G   +  E H+
Sbjct: 599 QDSWNACRQTLEGHSDSVRSVVFSPDSKWIASGSDDRTIKIWNLETGSCQQTLEGHS 655


>UniRef50_A5V0G7 Cluster: NB-ARC domain protein; n=2;
            Chloroflexaceae|Rep: NB-ARC domain protein - Roseiflexus
            sp. RS-1
          Length = 1523

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 37/104 (35%), Positives = 58/104 (55%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH G V  +A +P     I+S S D+T+ VW     E   G   + L G
Sbjct: 1060 AESGRLLRSLEGHTGSVLAVAVSPD-GRTIVSGSHDRTVKVW-----EAESGRLLRSLEG 1113

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+ ++  V +S DG   +SGSWD T+++W+  +G+  R  E HT
Sbjct: 1114 HTDWVRAVAVSPDGRTIVSGSWDNTVKVWEAESGRLLRSLEGHT 1157



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 37/104 (35%), Positives = 56/104 (53%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH  WV  +A +P     I+S S D T+ VW     E   G   + L G
Sbjct: 1354 AESGRLLRSLEGHTDWVRAVAVSPD-GRTIVSGSWDNTVKVW-----EAESGRLLRSLKG 1407

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  +  V +S DG   +SGSWD T+++W+  +G+  R  E HT
Sbjct: 1408 HTGSVRAVAVSPDGRTIVSGSWDNTVKVWEAESGRLLRSLEGHT 1451



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 37/104 (35%), Positives = 58/104 (55%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH  WV  +A +P     I+S SRD+T+ VW     E   G   + L G
Sbjct: 1018 AESGRLLRSLEGHTDWVLAVAVSPD-GRTIVSGSRDRTVKVW-----EAESGRLLRSLEG 1071

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  +  V +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 1072 HTGSVLAVAVSPDGRTIVSGSHDRTVKVWEAESGRLLRSLEGHT 1115



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 38/104 (36%), Positives = 57/104 (54%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH  WV  +A +P     I+S S D T+ VW     E   G   + L G
Sbjct: 1102 AESGRLLRSLEGHTDWVRAVAVSPD-GRTIVSGSWDNTVKVW-----EAESGRLLRSLEG 1155

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  +  V +S DG   +SGS D+T+++WD A+G+  R  E HT
Sbjct: 1156 HTGSVRAVAVSPDGRTIVSGSHDRTVKVWDAASGRLLRSLEGHT 1199



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 36/100 (36%), Positives = 55/100 (55%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  +L+GH G V  +A +P     I+S S D+T+ VW     E   G   + L GH+  
Sbjct: 896  RLLRSLKGHTGSVLAVAVSPD-GRTIVSGSHDRTVKVW-----EAESGRLLRSLEGHTGS 949

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  V +S DG   +SGSWD T+++W+  +G+  R  E HT
Sbjct: 950  VRAVAVSPDGRTIVSGSWDNTVKVWEAESGRPLRSLEGHT 989



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 36/104 (34%), Positives = 58/104 (55%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH G V  +A +P     I+S S D+T+ VW     E   G   + L G
Sbjct: 1312 AESGRLLRSLEGHTGSVLAVAVSPD-GRTIVSGSDDRTVKVW-----EAESGRLLRSLEG 1365

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+ ++  V +S DG   +SGSWD T+++W+  +G+  R  + HT
Sbjct: 1366 HTDWVRAVAVSPDGRTIVSGSWDNTVKVWEAESGRLLRSLKGHT 1409



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 37/104 (35%), Positives = 58/104 (55%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH G V  +A +P     I+S S D+T+ VW     E   G   + L G
Sbjct: 808  AESGRLLRSLEGHTGSVRAVAVSPD-GRTIVSGSHDRTVKVW-----EAESGRLLRSLEG 861

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  +  V +S DG   +SGS D+T+++WD A+G+  R  + HT
Sbjct: 862  HTGSVRAVAVSPDGRTIVSGSHDRTVKVWDAASGRLLRSLKGHT 905



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 37/104 (35%), Positives = 57/104 (54%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH G V  +A +P     I+S S D T+ VW     E   G P + L G
Sbjct: 934  AESGRLLRSLEGHTGSVRAVAVSPD-GRTIVSGSWDNTVKVW-----EAESGRPLRSLEG 987

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  +  V +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 988  HTGSVRAVAVSPDGRTIVSGSDDRTVKVWEAESGRLLRSLEGHT 1031



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 35/100 (35%), Positives = 55/100 (55%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  +L GH  WV  +A +P     I+S S D+T+ VW     E   G   + L GH+  
Sbjct: 1190 RLLRSLEGHTDWVLAVAVSPD-GRTIVSGSHDRTVKVW-----EAESGRLLRSLEGHTGG 1243

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++ V +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 1244 VNAVAVSPDGRTIVSGSDDRTVKVWEAESGRLLRSLEGHT 1283



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 34/96 (35%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH  WV  +A +P     I+S S D+T+ VW     E   G   + L GH+  +  V
Sbjct: 732  SLEGHTHWVLAVAVSPD-GRTIVSGSHDRTVKVW-----EAESGRLLRSLEGHTGSVRAV 785

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 786  AVSPDGRTIVSGSHDRTVKVWEAESGRLLRSLEGHT 821



 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 35/104 (33%), Positives = 57/104 (54%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH G V  +A +P     I+S S D+T+ VW         G   + L G
Sbjct: 1144 AESGRLLRSLEGHTGSVRAVAVSPD-GRTIVSGSHDRTVKVWDAAS-----GRLLRSLEG 1197

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+ ++  V +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 1198 HTDWVLAVAVSPDGRTIVSGSHDRTVKVWEAESGRLLRSLEGHT 1241



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 36/104 (34%), Positives = 57/104 (54%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L GH G V  +A +P     I+S S D+T+ VW     E   G   + L G
Sbjct: 1228 AESGRLLRSLEGHTGGVNAVAVSPD-GRTIVSGSDDRTVKVW-----EAESGRLLRSLEG 1281

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  +  V +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 1282 HTGSVLAVAVSPDGRTIVSGSDDRTVKVWEAESGRLLRSLEGHT 1325



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 34/96 (35%), Positives = 53/96 (55%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH G V  +A +P     I+S S D+T+ VW     E   G   + L GH+ ++  V
Sbjct: 984  SLEGHTGSVRAVAVSPD-GRTIVSGSDDRTVKVW-----EAESGRLLRSLEGHTDWVLAV 1037

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 1038 AVSPDGRTIVSGSRDRTVKVWEAESGRLLRSLEGHT 1073



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/96 (36%), Positives = 55/96 (57%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +E+ +L  +L+GH G V  +A +P     I+S S D T+ VW     E   G   + L G
Sbjct: 1396 AESGRLLRSLKGHTGSVRAVAVSPD-GRTIVSGSWDNTVKVW-----EAESGRLLRSLEG 1449

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            H+  ++ V +S DG   +SGSWD T+R W+L +G++
Sbjct: 1450 HTGGVNAVAVSPDGRTIVSGSWDHTIRAWNLESGES 1485



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + L GH+H++  V +S DG   +SGS D+T+++W+  +G+  R  E HT
Sbjct: 731 RSLEGHTHWVLAVAVSPDGRTIVSGSHDRTVKVWEAESGRLLRSLEGHT 779


>UniRef50_A0YTJ7 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. PCC
            8106|Rep: WD-40 repeat protein - Lyngbya sp. PCC 8106
          Length = 1795

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 40/99 (40%), Positives = 54/99 (54%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL+GH   +T ++ +P    MI SSS+D+T+ +WKL +D     IP   L GH   
Sbjct: 1158 KLLNTLKGHQKSITSVSFSPN-AQMIASSSQDQTVKLWKLGQDTQIAAIPIT-LRGHGDI 1215

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S V  S DG    S S DKT++LW L  G+  R    H
Sbjct: 1216 VSSVSFSPDGQIIASASEDKTVKLWSL-EGQLLRTITAH 1253



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 35/103 (33%), Positives = 53/103 (51%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG  ++ K +S+  E L+   T  GH   VT ++ +P    ++ SSS DK + +W++  
Sbjct: 1357 ASGDKTV-KLWSRDGELLR---TFEGHGDQVTNVSFSPD-GKILASSSYDKKVKLWRIE- 1410

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
                  IP K L GH   +  V  S DG    S S D+T++LW
Sbjct: 1411 -----DIPLKLLEGHQDRVLGVSFSPDGQILASASQDQTVKLW 1448



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +2

Query: 194  YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            YGI +  RL GH+  + DV  S DGN   SGS DK ++LW    GK     + H K
Sbjct: 1114 YGIHELNRLEGHNEVVWDVSFSPDGNVIASGSVDKAIKLW-TPKGKLLNTLKGHQK 1168



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 2/101 (1%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            +L  TLR  +   +++ T    PD  +I +   D+T+ +W      N  G   K L+GH 
Sbjct: 1286 RLLKTLRHSSSDQSKVYTVTFSPDGELIATVGSDRTIKLW------NRQGRLLKILWGHE 1339

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              I  V  S D     + S DKT++LW    G+  R FE H
Sbjct: 1340 QIIYGVEFSPDSQMIATASGDKTVKLWS-RDGELLRTFEGH 1379



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSH 232
            KL  T+  HN +V  ++ +P     I S+  D T+ +W      +  GI  + L  G S 
Sbjct: 1628 KLLKTIMAHNAYVLGVSFSPD-GHTIASAGYDNTVKLW------SREGILLETLLKGSSD 1680

Query: 233  FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALK 412
             ++ VV S DG+   S S+D  ++LW    G   +    H    QNS      + D    
Sbjct: 1681 SVTSVVFSPDGHLIASASYDGFVKLWSRHNGTLLKTLLGH----QNSVMSISFSPD---S 1733

Query: 413  IILSAYARQKTSVLCLCEAED 475
             +L++ +R +T +L   + +D
Sbjct: 1734 RVLASASRDQTVILWNLDLDD 1754



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 29/112 (25%), Positives = 50/112 (44%)
 Frame = +2

Query: 17   SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY 196
            SL +  + +   L    T   H+  +  ++ +P     I++ S+DKT+ +W         
Sbjct: 1533 SLLQSEASVFHPLSTVNTWTAHSDSLMSVSFSPN-SQFIVTGSKDKTVKLW------TPE 1585

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            G   +   GH  +++ V  S DG    S S D T++LW+L  GK  +    H
Sbjct: 1586 GRLLQTFVGHQGWVNSVSFSPDGRMIASASDDGTVKLWNL-QGKLLKTIMAH 1636



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 23/94 (24%), Positives = 44/94 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  ++ +P    ++ S+S+D+T+ +W  +      G   + L G+   +S + 
Sbjct: 1417 LEGHQDRVLGVSFSPD-GQILASASQDQTVKLWSRS------GTLLQTLKGYQDRVSAIS 1469

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    + S+D  ++LW +       +  DH
Sbjct: 1470 FSPDGQLLATVSYDNRVKLWRITPDPKQAQQRDH 1503


>UniRef50_A7F664 Cluster: Putative uncharacterized protein; n=2;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 809

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 35/98 (35%), Positives = 51/98 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV+ +A +P     + S SRD T+ +W     E+      + L GHS  +  V
Sbjct: 667 TLEGHSSWVSSVAFSPD-GTKVASGSRDNTIRLWDAMTGES-----LQTLEGHSSLVYSV 720

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG    SGS D T+RLWD   G++ +  E H+ +
Sbjct: 721 AFSPDGTKVASGSGDNTIRLWDAMTGESLQTLEGHSSL 758



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 35/98 (35%), Positives = 51/98 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +A +P     + S S D T+ +W     E+      + L GHS ++S V
Sbjct: 625 TLEGHSHWVNSVAFSPD-GTKVASGSEDNTIRLWDAMTGES-----LQTLEGHSSWVSSV 678

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG    SGS D T+RLWD   G++ +  E H+ +
Sbjct: 679 AFSPDGTKVASGSRDNTIRLWDAMTGESLQTLEGHSSL 716



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 35/96 (36%), Positives = 51/96 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +P     + S S DKT+ +W     E+      + L GHSH+++ V
Sbjct: 583 TLEGHSSLVYSVAFSPD-GTKVASGSEDKTIRLWDAMTGES-----LQTLEGHSHWVNSV 636

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS D T+RLWD   G++ +  E H+
Sbjct: 637 AFSPDGTKVASGSEDNTIRLWDAMTGESLQTLEGHS 672



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 24/66 (36%), Positives = 38/66 (57%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++K++R  +N+    + L GHS  +  V  S DG    SGS DKT+RLWD   G++ +  
Sbjct: 525 IYKMSRTRSNWSAALQTLEGHSSLVYSVAFSPDGTKVASGSEDKTIRLWDAMTGESLQTL 584

Query: 344 EDHTKV 361
           E H+ +
Sbjct: 585 EGHSSL 590


>UniRef50_A5UYN6 Cluster: Protein kinase; n=1; Roseiflexus sp.
            RS-1|Rep: Protein kinase - Roseiflexus sp. RS-1
          Length = 1242

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 36/91 (39%), Positives = 53/91 (58%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +  +A +P      LS   D+ + +W++   EN   I   +L GH+  +  VV S 
Sbjct: 881  HTDSIASVAFSPD-GRYALSGGGDRVIRLWEI---ENGRVIC--KLEGHTLAVYSVVFSP 934

Query: 260  DGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG+YALSGSWDKT+RLW++A G+   RF+ H
Sbjct: 935  DGHYALSGSWDKTIRLWEVATGREVNRFDRH 965



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 30/88 (34%), Positives = 46/88 (52%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+G V     +P   + +LS   D  L +W++       G   +   GHSH++  V  S 
Sbjct: 666 HDGTVYSATFSPD-KNHVLSGGGDNILRLWEVET-----GKEVRHFVGHSHWVFSVTFSP 719

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           DG Y LSGS D+T+R+W++  G+  R F
Sbjct: 720 DGEYVLSGSGDQTVRIWEVKTGRELRCF 747



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/85 (35%), Positives = 42/85 (49%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +P      LS S DKT+ +W++       G    R   H +F++ V 
Sbjct: 920  LEGHTLAVYSVVFSPD-GHYALSGSWDKTIRLWEVAT-----GREVNRFDRHVNFVNSVA 973

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAG 325
             S DG Y +S  WD+T+RLWD   G
Sbjct: 974  FSPDGRYIISAGWDETIRLWDTTTG 998



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 22/47 (46%), Positives = 33/47 (70%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH+  ++ V  S DG YALSGS D T+RLWD+A+GK  R+ + + ++
Sbjct: 545 GHTGVVNSVAFSPDGRYALSGSSDGTVRLWDVASGKEVRKVQGYDEL 591



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+ WV  +  +P   + +LS S D+T+ +W++          + R + H   +  V  S
Sbjct: 707 GHSHWVFSVTFSPD-GEYVLSGSGDQTVRIWEVKTGR------ELRCFRHEGAVFSVAFS 759

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            +G YALS S D+T+R+W++
Sbjct: 760 PNGRYALSSSHDRTIRVWEV 779



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  I+ V  S DG YALSG  D+ +RLW++  G+   + E HT
Sbjct: 881  HTDSIASVAFSPDGRYALSGGGDRVIRLWEIENGRVICKLEGHT 924



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            +N WVT    +P     IL  S D TL +  +   E N     K   GH+ ++  + +S 
Sbjct: 1090 NNRWVTPTTFSPD-GRYILIGSDDGTLQL--VNTQEGNAARVFK---GHTDWVFSIAISI 1143

Query: 260  DGNYALSGSWDKTLRLWDL 316
            DG YALSGS D+T+R+W L
Sbjct: 1144 DGQYALSGSKDQTIRVWAL 1162



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 22/74 (29%), Positives = 35/74 (47%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L++  D ++ +W +T  +       +R   H   +     S D N+ LSG  D  LRLW+
Sbjct: 641 LATCEDGSVRLWDVTTKQE-----VRRFGRHDGTVYSATFSPDKNHVLSGGGDNILRLWE 695

Query: 314 LAAGKTTRRFEDHT 355
           +  GK  R F  H+
Sbjct: 696 VETGKEVRHFVGHS 709



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 27/88 (30%), Positives = 42/88 (47%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H  +V  +A +P     I+S+  D+T+ +W  T     Y +        +  I  V  S 
Sbjct: 965  HVNFVNSVAFSPD-GRYIISAGWDETIRLWDTTTGHEMYCLKD------TDVIWSVCFSP 1017

Query: 260  DGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            DG Y LSGS D +++LWD+   +   RF
Sbjct: 1018 DGLYILSGSEDGSVKLWDIKTREVIHRF 1045



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 6/104 (5%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWV---TQIATNPKY-PD--MILSSSRDKTLIVWKLTRDENNYGIPQ 208
            ET++L  T  GH  +    T +  +  + PD   ILS S D ++ +W +   E  +    
Sbjct: 988  ETIRLWDTTTGHEMYCLKDTDVIWSVCFSPDGLYILSGSEDGSVKLWDIKTREVIH---- 1043

Query: 209  KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
             R  G S  I  V  S DG YALSGS    + +WD+   +   +
Sbjct: 1044 -RFTGLSDRIHCVAFSPDGRYALSGSSGGMVMIWDVGTRRVVHQ 1086



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++ +++    S DG Y L GS D TL+L +   G   R F+ HT
Sbjct: 1090 NNRWVTPTTFSPDGRYILIGSDDGTLQLVNTQEGNAARVFKGHT 1133


>UniRef50_Q8YRI1 Cluster: Uncharacterized WD repeat-containing protein
            alr3466; n=2; Nostocaceae|Rep: Uncharacterized WD
            repeat-containing protein alr3466 - Anabaena sp. (strain
            PCC 7120)
          Length = 1526

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/96 (32%), Positives = 54/96 (56%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T +GH  WV  +  NP    M+ S S DKT+ +W ++  +  +        GH+++++ V
Sbjct: 1237 TFQGHTSWVNSVVFNPD-GSMLASGSSDKTVRLWDISSSKCLH-----TFQGHTNWVNSV 1290

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              + DG+   SGS D+T+RLW++++ K    F+ HT
Sbjct: 1291 AFNPDGSMLASGSGDQTVRLWEISSSKCLHTFQGHT 1326



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 33/95 (34%), Positives = 52/95 (54%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV  +  NP     + S S D+T+ +W++     N         GH+ +++ VV
Sbjct: 1196 LQGHTSWVNSVVFNPD-GSTLASGSSDQTVRLWEI-----NSSKCLCTFQGHTSWVNSVV 1249

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + DG+   SGS DKT+RLWD+++ K    F+ HT
Sbjct: 1250 FNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHT 1284



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 39/118 (33%), Positives = 61/118 (51%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG S        +S + K   T +GH  WV  +A NP    M+ S S D+T+ +W+++ 
Sbjct: 1258 ASGSSDKTVRLWDISSS-KCLHTFQGHTNWVNSVAFNPD-GSMLASGSGDQTVRLWEISS 1315

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  +        GH+ ++S V  S DG    SGS D+T+RLW +++G+    F  HT
Sbjct: 1316 SKCLH-----TFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHT 1368



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 31/95 (32%), Positives = 52/95 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T +GH  WV+ +  +P    M+ S S D+T+ +W ++  E  Y        GH++++  V
Sbjct: 1321 TFQGHTSWVSSVTFSPD-GTMLASGSDDQTVRLWSISSGECLY-----TFLGHTNWVGSV 1374

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + S DG    SGS D+T+RLW +++GK     + H
Sbjct: 1375 IFSPDGAILASGSGDQTVRLWSISSGKCLYTLQGH 1409



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 33/87 (37%), Positives = 50/87 (57%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GHN WV  I  +P    ++ S S D+T+ +W ++  E  Y      L+GH + +  V
Sbjct: 1405 TLQGHNNWVGSIVFSPD-GTLLASGSDDQTVRLWNISSGECLY-----TLHGHINSVRSV 1458

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              SSDG    SGS D+T++LWD+  G+
Sbjct: 1459 AFSSDGLILASGSDDETIKLWDVKTGE 1485



 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 33/94 (35%), Positives = 51/94 (54%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH GWV  +A N     M+ + S D+T+ +W ++  +  Y        GH+  +  VV 
Sbjct: 987  QGHTGWVYSVAFNLD-GSMLATGSGDQTVRLWDISSSQCFY-----IFQGHTSCVRSVVF 1040

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            SSDG    SGS D+T+RLWD+++G      + HT
Sbjct: 1041 SSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHT 1074



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 32/96 (33%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T +GHN WV  +  +     M+ S S D+T+ +W ++      G   K   GH+  +  V
Sbjct: 901  TCKGHNSWVNSVGFSQD-GKMLASGSDDQTVRLWDISS-----GQCLKTFKGHTSRVRSV 954

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V S +     SGS D+T+RLWD+++G+    F+ HT
Sbjct: 955  VFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHT 990



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/95 (30%), Positives = 51/95 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH  WV  +  +P    ++ S S D+T+ +W ++  +  Y      L GH++++  +
Sbjct: 1363 TFLGHTNWVGSVIFSPDGA-ILASGSGDQTVRLWSISSGKCLY-----TLQGHNNWVGSI 1416

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            V S DG    SGS D+T+RLW++++G+       H
Sbjct: 1417 VFSPDGTLLASGSDDQTVRLWNISSGECLYTLHGH 1451



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/96 (31%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+G+  WV  +  +P    +   SS D+ + +W ++  +  Y      L GH+++++ V
Sbjct: 1111 TLQGYTSWVRFLVFSPNGVTLANGSS-DQIVRLWDISSKKCLY-----TLQGHTNWVNAV 1164

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D+T+RLWD+++ K     + HT
Sbjct: 1165 AFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHT 1200



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/94 (28%), Positives = 45/94 (47%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH   V  +  +     M+ S S D+T+ +W ++     Y      L GH+  +  VV 
Sbjct: 1029 QGHTSCVRSVVFSSDGA-MLASGSDDQTVRLWDISSGNCLY-----TLQGHTSCVRSVVF 1082

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG    SG  D+ +RLWD+++G      + +T
Sbjct: 1083 SPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYT 1116


>UniRef50_Q2U9S0 Cluster: Predicted NTPase; n=4; Pezizomycotina|Rep:
           Predicted NTPase - Aspergillus oryzae
          Length = 371

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 38/99 (38%), Positives = 53/99 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH GWV  +A +P    +++S S D T+ +W         G  Q+ L GH+  +
Sbjct: 155 LQQTLEGHTGWVKTVAFSPD-GRLLVSGSDDNTVRLWDPVT-----GTLQQTLKGHTDPV 208

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +V S DG    SGS D T+RLWD A G   +  E HT
Sbjct: 209 NSMVFSPDGRLLASGSDDDTVRLWDPATGALQQTLEGHT 247



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 36/99 (36%), Positives = 51/99 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH GWV  +  +P    +++S S D T+ +W         G  Q+ L GH+  +
Sbjct: 71  LQQTLEGHTGWVKTMVFSPD-GRLLVSGSDDNTVRLWDPVT-----GTLQQTLKGHTDPV 124

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +V S DG    SGS D T+RLWD   G   +  E HT
Sbjct: 125 NSMVFSPDGRLLASGSDDNTVRLWDPVTGTLQQTLEGHT 163



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/99 (33%), Positives = 50/99 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL+GH   V  +  +P    ++ S S D T+ +W         G  Q+ L GH+ ++
Sbjct: 29  LQQTLKGHTDPVNSMVFSPD-GRLLASGSDDNTVRLWDPVT-----GTLQQTLEGHTGWV 82

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +V S DG   +SGS D T+RLWD   G   +  + HT
Sbjct: 83  KTMVFSPDGRLLVSGSDDNTVRLWDPVTGTLQQTLKGHT 121



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 33/99 (33%), Positives = 49/99 (49%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL+GH   V  +  +P    ++ S S D T+ +W         G  Q+ L GH+ ++
Sbjct: 113 LQQTLKGHTDPVNSMVFSPD-GRLLASGSDDNTVRLWDPVT-----GTLQQTLEGHTGWV 166

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V  S DG   +SGS D T+RLWD   G   +  + HT
Sbjct: 167 KTVAFSPDGRLLVSGSDDNTVRLWDPVTGTLQQTLKGHT 205



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 35/100 (35%), Positives = 50/100 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL+GH   V  +  +P    ++ S S D T+ +W     +   G  Q+ L GH+  +
Sbjct: 197 LQQTLKGHTDPVNSMVFSPD-GRLLASGSDDDTVRLW-----DPATGALQQTLEGHTDPV 250

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             V  S DG    S S DKT+RLWD A G   +  E HT+
Sbjct: 251 EFVTFSPDGRLLASCSSDKTIRLWDPATGTLQQTLEGHTR 290



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 33/98 (33%), Positives = 49/98 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   V  +  +P    ++ S S DKT+ +W     +   G  Q+ L GH+  +
Sbjct: 239 LQQTLEGHTDPVEFVTFSPD-GRLLASCSSDKTIRLW-----DPATGTLQQTLEGHTRSV 292

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  S++G    SGS DK +RLWD A G   +  + H
Sbjct: 293 VSVAFSTNGRLLASGSRDKIIRLWDPATGTLQQTLKGH 330



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 27/78 (34%), Positives = 40/78 (51%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P  +++ S D T+ +W     +   G  Q+ L GH+  ++ +V S DG    SGS D T+
Sbjct: 7   PARMITHSDDNTVRLW-----DPATGTLQQTLKGHTDPVNSMVFSPDGRLLASGSDDNTV 61

Query: 302 RLWDLAAGKTTRRFEDHT 355
           RLWD   G   +  E HT
Sbjct: 62  RLWDPVTGTLQQTLEGHT 79



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 27/80 (33%), Positives = 39/80 (48%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   V  +A +     ++ S SRDK + +W     +   G  Q+ L GH +++
Sbjct: 281 LQQTLEGHTRSVVSVAFSTN-GRLLASGSRDKIIRLW-----DPATGTLQQTLKGHINWV 334

Query: 239 SDVVLSSDGNYALSGSWDKT 298
             V  S DG    SGS D T
Sbjct: 335 KTVAFSRDGRLLASGSHDNT 354


>UniRef50_Q4WH43 Cluster: Vegetative incompatibility WD repeat
           protein, putative; n=1; Aspergillus fumigatus|Rep:
           Vegetative incompatibility WD repeat protein, putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 553

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 39/102 (38%), Positives = 51/102 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+ TL GH+ WV  +A   K   ++ S S DKT+ +W  T      G  +  L GHS
Sbjct: 126 TGNLKHTLEGHSDWVRSVAFW-KDSQLLASGSDDKTIKLWDPTT-----GALKHTLEGHS 179

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             I  V  S DG +  SGS DKT++LWD   G      E H+
Sbjct: 180 DSILSVAFSQDGQFLASGSHDKTIKLWDPTTGNLKHTLEGHS 221



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 37/102 (36%), Positives = 49/102 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+ TL GH+ WV  +A   K   ++ S S DKT  +W  T      G  +  L GHS
Sbjct: 210 TGNLKHTLEGHSDWVRSVAFW-KDSQLLASGSDDKTTRLWDPTT-----GALKHTLEGHS 263

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             I  V  S DG    SGS D+T++LWD       +  E H+
Sbjct: 264 DSIRSVAFSQDGQLLASGSDDETVKLWDPTTSFLMQTLEGHS 305



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 32/99 (32%), Positives = 50/99 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL GH+  V  +A +     ++ S SRD+T+ +W     +   G  +  L GHS ++
Sbjct: 297 LMQTLEGHSDSVWTVAFSQD-GQLLASGSRDRTIKLW-----DPAIGAVKHTLEGHSDWV 350

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V  S +  +  SGS+DKT++LWD   G      E H+
Sbjct: 351 RSVAFSQNSRFLASGSYDKTIKLWDPTTGNLKHTLEGHS 389



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 34/96 (35%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL G + WV  +A +     ++ S S DKT+ +W  T      G  +  L GHS  I  V
Sbjct: 48  TLGGLSHWVWSVAFSQD-GQLLASGSDDKTIKLWDPTT-----GALKHTLVGHSDSILSV 101

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG +  SGS D+T++LWD   G      E H+
Sbjct: 102 AFSQDGQFLASGSDDETIKLWDPTTGNLKHTLEGHS 137



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 33/99 (33%), Positives = 45/99 (45%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH+  +  +A +      + S S DKT+ +W  T      G  +  L GHS ++
Sbjct: 171 LKHTLEGHSDSILSVAFSQD-GQFLASGSHDKTIKLWDPTT-----GNLKHTLEGHSDWV 224

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V    D     SGS DKT RLWD   G      E H+
Sbjct: 225 RSVAFWKDSQLLASGSDDKTTRLWDPTTGALKHTLEGHS 263



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/57 (36%), Positives = 28/57 (49%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           E N+    + L G SH++  V  S DG    SGS DKT++LWD   G        H+
Sbjct: 39  EENWSPELQTLGGLSHWVWSVAFSQDGQLLASGSDDKTIKLWDPTTGALKHTLVGHS 95


>UniRef50_Q00808 Cluster: Vegetative incompatibility protein HET-E-1;
            n=10; Podospora anserina|Rep: Vegetative incompatibility
            protein HET-E-1 - Podospora anserina
          Length = 1356

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 35/95 (36%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH GWV  +A +P     + S S D T+ +W         G   + L GH  ++  V
Sbjct: 1130 TLEGHGGWVHSVAFSPD-GQRVASGSIDGTIKIWDAAS-----GTCTQTLEGHGGWVQSV 1183

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS DKT+++WD A+G  T+  E H
Sbjct: 1184 AFSPDGQRVASGSSDKTIKIWDTASGTCTQTLEGH 1218



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 33/90 (36%), Positives = 47/90 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH GWV  +A +P     + S S DKT+ +W     +   G   + L GH  ++  V
Sbjct: 1172 TLEGHGGWVQSVAFSPD-GQRVASGSSDKTIKIW-----DTASGTCTQTLEGHGGWVQSV 1225

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
              S DG    SGS D T+++WD A+G  T+
Sbjct: 1226 AFSPDGQRVASGSSDNTIKIWDTASGTCTQ 1255



 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 34/95 (35%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH G V  +A +P     + S S DKT+ +W     +   G   + L GH  ++  V
Sbjct: 1004 TLEGHGGSVWSVAFSPD-GQRVASGSDDKTIKIW-----DTASGTCTQTLEGHGGWVQSV 1057

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            V S DG    SGS D T+++WD  +G  T+  E H
Sbjct: 1058 VFSPDGQRVASGSDDHTIKIWDAVSGTCTQTLEGH 1092



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/95 (34%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH GWV  +  +P     + S S D T+ +W         G   + L GH   +  V
Sbjct: 1046 TLEGHGGWVQSVVFSPD-GQRVASGSDDHTIKIWDAVS-----GTCTQTLEGHGDSVWSV 1099

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS D T+++WD A+G  T+  E H
Sbjct: 1100 AFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGH 1134



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 34/95 (35%), Positives = 46/95 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH G V  +A +P     + S S D T+ +W         G   + L GH   +  V
Sbjct: 920  TLEGHGGRVQSVAFSPD-GQRVASGSDDHTIKIWDAAS-----GTCTQTLEGHGSSVLSV 973

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS DKT+++WD A+G  T+  E H
Sbjct: 974  AFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGH 1008



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 34/95 (35%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH G V  +A +P   + + S S DKT+ +W         G   + L GH   +  V
Sbjct: 878  TLEGHGGSVWSVAFSPDR-ERVASGSDDKTIKIWDAAS-----GTCTQTLEGHGGRVQSV 931

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS D T+++WD A+G  T+  E H
Sbjct: 932  AFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGH 966



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 34/95 (35%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     + S S DKT+ +W     +   G   + L GH   +  V
Sbjct: 962  TLEGHGSSVLSVAFSPD-GQRVASGSGDKTIKIW-----DTASGTCTQTLEGHGGSVWSV 1015

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS DKT+++WD A+G  T+  E H
Sbjct: 1016 AFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGH 1050



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 32/95 (33%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     + S S D T+ +W         G   + L GH  ++  V
Sbjct: 1088 TLEGHGDSVWSVAFSPD-GQRVASGSIDGTIKIWDAAS-----GTCTQTLEGHGGWVHSV 1141

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS D T+++WD A+G  T+  E H
Sbjct: 1142 AFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGH 1176



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/95 (33%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +      + S S DKT+ +W     +   G   + L GH   +  V
Sbjct: 836  TLEGHGSSVLSVAFSAD-GQRVASGSDDKTIKIW-----DTASGTGTQTLEGHGGSVWSV 889

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D     SGS DKT+++WD A+G  T+  E H
Sbjct: 890  AFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGH 924


>UniRef50_Q7ND05 Cluster: WD-repeat protein; n=1; Gloeobacter
           violaceus|Rep: WD-repeat protein - Gloeobacter violaceus
          Length = 1193

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 35/97 (36%), Positives = 54/97 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH GWV  +A +P    ++ S S D+T+ +W+ T      G   + L GH+ +I  VV
Sbjct: 689 LQGHGGWVLSLAFSPD-GSIVASGSSDQTVRLWETTT-----GQCLRILRGHTDWIHSVV 742

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S DG    SG  D+T+RLW+ A G+  + F  H+ +
Sbjct: 743 FSPDGRSIASGGADRTVRLWEAATGECRKSFPGHSSL 779



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 37/102 (36%), Positives = 57/102 (55%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L   L+ H GWV+ +A +     ++ S+S D T+ +W ++      G+    L  HS
Sbjct: 976  TGRLSTVLQAHTGWVSAVAFSAD-GRILASASADGTVRLWNVSN-----GLCVALLAEHS 1029

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +++  VV S DG+   SGS D T+RLWDL + + TR  E HT
Sbjct: 1030 NWVHSVVFSPDGSLLASGSADGTVRLWDLQSNRCTRVIEGHT 1071



 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 36/102 (35%), Positives = 55/102 (53%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T + R TL GH+ WV  +A +P     + S S D T+++W     E   G  +K L GH 
Sbjct: 892  TGECRQTLEGHHSWVFAVAFSPD-GQTLASGSVDHTVLLW-----ETVTGRCRKILEGHH 945

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             ++  VV S DG    +GS D+T+R+W+ A G+ +   + HT
Sbjct: 946  SWVWSVVFSPDGTTIATGSADRTVRIWNAATGRLSTVLQAHT 987



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/97 (31%), Positives = 44/97 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LRGH  W+  +  +P     I S   D+T+ +W+    E     P     GHS  I  V 
Sbjct: 731  LRGHTDWIHSVVFSPDGRS-IASGGADRTVRLWEAATGECRKSFP-----GHSSLIWSVA 784

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG    SG  D  ++LWD+A  +  R  + HT +
Sbjct: 785  FSPDGQSLASGGQDALIKLWDVATAQCRRILQGHTNL 821



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/92 (33%), Positives = 48/92 (52%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH  WV  +  +P    ++ S S D+T+ +W+ T      G   + L GH++ I  V  S
Sbjct: 607 GHTAWVWSVGFSPD-GSIVASGSSDQTVRLWETTT-----GQCLRILQGHANSIWSVGFS 660

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG+   SGS D+T+RLW+   G+  R  + H
Sbjct: 661 PDGSIMASGSSDQTVRLWETTTGQCLRILQGH 692



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 33/101 (32%), Positives = 49/101 (48%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T + R  L+GH   V  +A +P     + S S D+ + +WK      + G  +K + G++
Sbjct: 808  TAQCRRILQGHTNLVYAVAFSPD-GQTLASGSADQAVRLWK-----TDTGQCRKTIQGYT 861

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              I  V  S DG    S S D T+RLWD A G+  +  E H
Sbjct: 862  SGIYSVAFSPDGRTLASASTDHTVRLWDTATGECRQTLEGH 902



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/96 (26%), Positives = 44/96 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L  H+ WV  +  +P    ++ S S D T+ +W L  +        + + GH+  +  V 
Sbjct: 1025 LAEHSNWVHSVVFSPD-GSLLASGSADGTVRLWDLQSNRCT-----RVIEGHTSPVWSVA 1078

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S+DG    S   D+ +R+W  + G   R F  H++
Sbjct: 1079 FSADGTLLASAGEDRIIRIWRTSTGGIHRAFPGHSR 1114



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 24/89 (26%), Positives = 45/89 (50%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G ++ +  +P   +++ +   D  + +W+L      +GI      GH+ ++  V  S DG
Sbjct: 568 GNISSVQFSPNR-NVLATGDADGKVCLWQLP-----HGIQINICEGHTAWVWSVGFSPDG 621

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +   SGS D+T+RLW+   G+  R  + H
Sbjct: 622 SIVASGSSDQTVRLWETTTGQCLRILQGH 650



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 25/102 (24%), Positives = 48/102 (47%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T + R +  GH+  +  +A +P     + S  +D  + +W +   +      ++ L GH+
Sbjct: 766  TGECRKSFPGHSSLIWSVAFSPD-GQSLASGGQDALIKLWDVATAQC-----RRILQGHT 819

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + +  V  S DG    SGS D+ +RLW    G+  +  + +T
Sbjct: 820  NLVYAVAFSPDGQTLASGSADQAVRLWKTDTGQCRKTIQGYT 861



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 22/89 (24%), Positives = 42/89 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            + GH   V  +A +     ++ S+  D+ + +W+ +    +   P     GHS  +  V 
Sbjct: 1067 IEGHTSPVWSVAFSAD-GTLLASAGEDRIIRIWRTSTGGIHRAFP-----GHSRPVWSVA 1120

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
             S DG    SGS D+++ LW+  + + +R
Sbjct: 1121 FSPDGQTLASGSQDESIALWETHSAERSR 1149


>UniRef50_A0D039 Cluster: Chromosome undetermined scaffold_33, whole
            genome shotgun sequence; n=2; cellular organisms|Rep:
            Chromosome undetermined scaffold_33, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2929

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 41/119 (34%), Positives = 60/119 (50%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG   L      + + L++R  L GH+  V  +A  P    ++ S S D+T+I+W +  
Sbjct: 2134 ASGSDDLTIRIWDLKQCLEIR-KLEGHSAPVHSVAFTPD-SQLLASGSFDRTIILWDIKS 2191

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                 G   K+L  H   I  V  S DG +  S S D T+R+WD+ +GK  +R E HTK
Sbjct: 2192 -----GKELKKLTDHDDGIWSVAFSIDGQFLASASNDTTIRIWDVKSGKNIQRLEGHTK 2245



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/96 (34%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH+  V+ +A +P     + S+S D T+ VW     +   G    +L GH+ ++  +
Sbjct: 1987 TLKGHSDSVSSVAFSPD-GQTLASASNDYTVRVW-----DTKSGKEILKLSGHTGWVRSI 2040

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D T+RLWD++ G    + E HT
Sbjct: 2041 AYSPDGLIIASGSSDNTVRLWDVSFGYLILKLEGHT 2076



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/94 (35%), Positives = 48/94 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH GWV  IA +P    +I S S D T+ +W ++     +G    +L GH+  +  V 
Sbjct: 2030 LSGHTGWVRSIAYSPDGL-IIASGSSDNTVRLWDVS-----FGYLILKLEGHTDQVRSVQ 2083

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S DK++RLWD  +G+   +   H
Sbjct: 2084 FSPDGQMIASASNDKSIRLWDPISGQQVNKLNGH 2117



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/94 (31%), Positives = 47/94 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  WV  +A +PK  D++ S S D+++I+W +       G    +L GHS  +  V 
Sbjct: 2367 LEGHLNWVCSVAFSPK-EDLLASGSEDQSIILWHIKT-----GKLITKLLGHSDSVQSVA 2420

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG+   S S D  +++WD   G+      +H
Sbjct: 2421 FSCDGSRLASASGDYLVKIWDTKLGQEILELSEH 2454



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/94 (30%), Positives = 45/94 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH G +T +A +P          +D+++ +W L       G    RL GHS ++  + 
Sbjct: 2282 LEGHLGLITSVAFSPDGLVFASGGGQDQSIRIWDLKS-----GKELCRLDGHSGWVQSIA 2336

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                G    SGS D ++RLWD+ +GK   + E H
Sbjct: 2337 FCPKGQLIASGSSDTSVRLWDVESGKEISKLEGH 2370



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 1/105 (0%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +P    ++ S+S D+++ +W     +   G     L GH   I+ V 
Sbjct: 2240 LEGHTKTVYSVAYSPD-GSILGSASDDQSIRLW-----DTKSGREMNMLEGHLGLITSVA 2293

Query: 251  LSSDGN-YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
             S DG  +A  G  D+++R+WDL +GK   R + H+   Q+  FC
Sbjct: 2294 FSPDGLVFASGGGQDQSIRIWDLKSGKELCRLDGHSGWVQSIAFC 2338



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 6/121 (4%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+GWV  IA  PK   +I S S D ++ +W +       G    +L GH +++  V 
Sbjct: 2325 LDGHSGWVQSIAFCPK-GQLIASGSSDTSVRLWDVES-----GKEISKLEGHLNWVCSVA 2378

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F-C*G-----VNADYALK 412
             S   +   SGS D+++ LW +  GK   +   H+   Q+  F C G      + DY +K
Sbjct: 2379 FSPKEDLLASGSEDQSIILWHIKTGKLITKLLGHSDSVQSVAFSCDGSRLASASGDYLVK 2438

Query: 413  I 415
            I
Sbjct: 2439 I 2439



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 45/95 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +P    MI S+S DK++ +W     +   G    +L GH  +I    
Sbjct: 2072 LEGHTDQVRSVQFSPD-GQMIASASNDKSIRLW-----DPISGQQVNKLNGHDGWIWSAT 2125

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S  G+   SGS D T+R+WDL      R+ E H+
Sbjct: 2126 FSFVGHLLASGSDDLTIRIWDLKQCLEIRKLEGHS 2160



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/74 (32%), Positives = 39/74 (52%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            + S+S D T+ +W +   +N      +RL GH+  +  V  S DG+   S S D+++RLW
Sbjct: 2217 LASASNDTTIRIWDVKSGKNI-----QRLEGHTKTVYSVAYSPDGSILGSASDDQSIRLW 2271

Query: 311  DLAAGKTTRRFEDH 352
            D  +G+     E H
Sbjct: 2272 DTKSGREMNMLEGH 2285



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/91 (25%), Positives = 46/91 (50%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            ++++K    + G   W+  +A +P    + L+   D ++ +W L  ++      +++L G
Sbjct: 2568 TKSIKEMQQINGDTMWIYSVAQSPDQQSLALACI-DYSIRLWDLKSEKE-----RQKLIG 2621

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            HS  +  +  S+DG    S   DK +RLW+L
Sbjct: 2622 HSDQVEVIAFSADGQTMASAGRDKKIRLWNL 2652



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 24/72 (33%), Positives = 36/72 (50%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            + S S D T+ +W + +D N     +K L GH+  I  VV + +G   +S S D T+R W
Sbjct: 2680 LASGSSDTTIRIW-VVKDTNQ----EKVLKGHTEAIQQVVFNPEGKLLVSTSNDNTIRQW 2734

Query: 311  DLAAGKTTRRFE 346
             L  G+     E
Sbjct: 2735 SLDTGEQVELLE 2746



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 15/48 (31%), Positives = 26/48 (54%)
 Frame = +2

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +L GH+  +  +    DG    SGS D ++R+WD+  G   ++ + HT
Sbjct: 2492 KLEGHTDAVQSIAFYPDGKVLASGSSDHSIRIWDITTGTEMQKIDGHT 2539



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            K R  L GH+  V  IA +     M  S+ RDK + +W L        I  + L  HS  
Sbjct: 2614 KERQKLIGHSDQVEVIAFSADGQTMA-SAGRDKKIRLWNLKSQ-----IDVQILIAHSAT 2667

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
            I  +  S+DG    SGS D T+R+W +      +  + HT+  Q
Sbjct: 2668 IWSLRFSNDGLRLASGSSDTTIRIWVVKDTNQEKVLKGHTEAIQ 2711



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            L GH   V  IA    YPD  ++ S S D ++ +W +T      G   +++ GH+  +  
Sbjct: 2493 LEGHTDAVQSIAF---YPDGKVLASGSSDHSIRIWDITT-----GTEMQKIDGHTGCVYS 2544

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  S +G   +S S D ++ LW+  + K  ++    T
Sbjct: 2545 IAFSPNGEALVSASEDNSILLWNTKSIKEMQQINGDT 2581



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 28/108 (25%), Positives = 47/108 (43%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T KL   L GH+  V  +A +      + S+S D  + +W     +   G     L  H
Sbjct: 2401 KTGKLITKLLGHSDSVQSVAFSCD-GSRLASASGDYLVKIW-----DTKLGQEILELSEH 2454

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QN 370
            +  +  V+ S +G    S   D  ++LWD  +G+   + E HT   Q+
Sbjct: 2455 NDSLQCVIFSPNGQILASAGGDYIIQLWDAVSGQDIMKLEGHTDAVQS 2502


>UniRef50_Q8YZL9 Cluster: Serine/threonine kinase with WD-40 repeat;
           n=9; Cyanobacteria|Rep: Serine/threonine kinase with
           WD-40 repeat - Anabaena sp. (strain PCC 7120)
          Length = 677

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 39/102 (38%), Positives = 55/102 (53%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET  L  TL G+   VT IA NP   + + S+SRD+T+ +WK+       G   + L G 
Sbjct: 550 ETGTLTHTLAGNGETVTSIAFNPD-GNTLASASRDRTIKIWKV-----GAGTRVRTLKGS 603

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  I+ +  S DGN   S S D+T++LW+L  GK  R  E H
Sbjct: 604 TETITSIAFSPDGNTLASASRDQTIKLWNLETGKEIRTLEGH 645



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 36/117 (30%), Positives = 54/117 (46%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           SG   L +P      T+ L  TL         +A +P    +I S   D+T+ +W+L   
Sbjct: 368 SGQVVLAQPQKTTLRTISLANTLPDDENAFVSLAISPN-GQIIASCGSDRTIKIWQLATG 426

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           E+        L GHS  ++ VV S DG   +SG  D T+++W+L  GK  R    H+
Sbjct: 427 EDI-----SSLKGHSRKVNAVVFSPDGKTLVSGGDDNTIKIWNLKTGKVIRTITGHS 478



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  TL GH  WV  +A +P   + I S S DKT+ +W L       G     L G+ 
Sbjct: 509 TGRLINTLTGHTFWVRSVAISPDGVN-IASGSFDKTVKIWNLET-----GTLTHTLAGNG 562

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             ++ +  + DGN   S S D+T+++W + AG   R  +  T+
Sbjct: 563 ETVTSIAFNPDGNTLASASRDRTIKIWKVGAGTRVRTLKGSTE 605



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 34/96 (35%), Positives = 52/96 (54%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K+  T+ GH+  V  +A +P    ++ S S D T+ VW L     N G     L GH
Sbjct: 466 KTGKVIRTITGHSDAVHTLAISPNGKTLV-SGSDDNTVKVWNL-----NTGRLINTLTGH 519

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           + ++  V +S DG    SGS+DKT+++W+L  G  T
Sbjct: 520 TFWVRSVAISPDGVNIASGSFDKTVKIWNLETGTLT 555



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 28/81 (34%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+G    +T IA +P   + + S+SRD+T+ +W L       G   + L GH + ++ V
Sbjct: 599 TLKGSTETITSIAFSPD-GNTLASASRDQTIKLWNLET-----GKEIRTLEGHENTVTTV 652

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             + DG   +SGS D T+R+W
Sbjct: 653 AFTPDGANLVSGSGDNTMRIW 673



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 26/96 (27%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH+  V  +  +P    ++ S   D T+ +W L       G   + + GHS  +  +
Sbjct: 431 SLKGHSRKVNAVVFSPDGKTLV-SGGDDNTIKIWNLKT-----GKVIRTITGHSDAVHTL 484

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S +G   +SGS D T+++W+L  G+       HT
Sbjct: 485 AISPNGKTLVSGSDDNTVKVWNLNTGRLINTLTGHT 520


>UniRef50_A0EDI8 Cluster: Chromosome undetermined scaffold_90, whole
           genome shotgun sequence; n=2; Eukaryota|Rep: Chromosome
           undetermined scaffold_90, whole genome shotgun sequence
           - Paramecium tetraurelia
          Length = 803

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 35/102 (34%), Positives = 58/102 (56%), Gaps = 1/102 (0%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW-KLTRDENNYGIPQKRLYGHS 229
           ++ +G L GHN  V Q+  +    + + S S D  + +W   ++ +N Y      LYGH+
Sbjct: 471 VQYKGKLNGHNNSVIQVCFSSD-GNTLASCSYDLLICLWDSKSQLQNGY------LYGHN 523

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +++ V  S DGN   SGS+D++LRLWD+  G+ T +F  H+
Sbjct: 524 DWVNTVCFSPDGNTLASGSYDQSLRLWDIKTGQQTAKFNGHS 565



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/97 (29%), Positives = 48/97 (49%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           G L GHN WV  +  +P   + + S S D++L +W +   +        +  GHS  +  
Sbjct: 517 GYLYGHNDWVNTVCFSPD-GNTLASGSYDQSLRLWDIKTGQQT-----AKFNGHSDTVRS 570

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V  S DG    SGS D+++RLW++   +   + + HT
Sbjct: 571 VCFSPDGKTIASGSDDESIRLWNVKTKQQIAKLDAHT 607


>UniRef50_A2QX40 Cluster: Contig An11c0260, complete genome; n=1;
           Aspergillus niger|Rep: Contig An11c0260, complete genome
           - Aspergillus niger
          Length = 1163

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 36/96 (37%), Positives = 53/96 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +P    ++ S S D+T+++W     +   GI Q+ L GHS  +  V
Sbjct: 536 TLEGHSDSVQSVAFSPD-GHLLASGSEDQTVLLW-----DPESGILQQTLEGHSASVQSV 589

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG+   SGS D+T+RLWD A G   +  E H+
Sbjct: 590 AFSPDGHLLASGSEDQTVRLWDTATGMLQQTLEGHS 625



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/100 (35%), Positives = 53/100 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH+  V  +A +P    ++ S S D+T+ +W     +   G+ Q+ L GHS  +
Sbjct: 575 LQQTLEGHSASVQSVAFSPD-GHLLASGSEDQTVRLW-----DTATGMLQQTLEGHSASV 628

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             V  S DG+   SGS D+T RLWD   G   R  + H++
Sbjct: 629 QSVAFSPDGHLLASGSRDRTARLWDPVTGILQRILKGHSE 668



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 31/89 (34%), Positives = 47/89 (52%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH+  V  +A +P    ++ S SRD+T  +W         GI Q+ L GHS  +
Sbjct: 617 LQQTLEGHSASVQSVAFSPD-GHLLASGSRDRTARLWDPVT-----GILQRILKGHSESV 670

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             V  S D +   SGS D++++LW+   G
Sbjct: 671 QSVAFSPDSHILASGSEDQSVQLWNPVTG 699



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 33/98 (33%), Positives = 48/98 (48%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+  L+GH+  V  +A +P    ++ S S D+++ +W         GI QK L   S  I
Sbjct: 659 LQRILKGHSESVQSVAFSPD-SHILASGSEDQSVQLWNPVT-----GILQKSLAEDSSSI 712

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  SSDG    SGS D  + +WDLA G   +  + H
Sbjct: 713 LSVTFSSDGYLLASGSDDWYVYVWDLATGTLQQTVDGH 750



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++N+    + L GHS  +  V  S DG+   SGS D+T+ LWD  +G   +  E H+
Sbjct: 527 KDNWDAELQTLEGHSDSVQSVAFSPDGHLLASGSEDQTVLLWDPESGILQQTLEGHS 583



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 28/102 (27%), Positives = 40/102 (39%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T  L  T+  H+  V  +A +P    ++ S S D T+ +W          +      G S
Sbjct: 876  TRTLLHTIDSHSESVNSVAFSPN-GQLLASCSDDDTVCIWDFATYTLQQTLTACPHLGDS 934

Query: 230  -HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                  V  S DG    SG++   L +WDLA G   R    H
Sbjct: 935  IGGYKSVTFSPDGKLLASGTYSGLLCVWDLATGAIYRTINAH 976



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 7/77 (9%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH--SHF----ISDVV-LSSDGNYALSGS 286
           ++ S S D  + VW L       G  Q+ + GH  S F     SD V  + DG    S S
Sbjct: 723 LLASGSDDWYVYVWDLAT-----GTLQQTVDGHMSSGFRGSGASDAVAFTPDGKTLASCS 777

Query: 287 WDKTLRLWDLAAGKTTR 337
            D+T+RLWDL A + T+
Sbjct: 778 ADETIRLWDLTASEVTQ 794


>UniRef50_Q9D7H2 Cluster: WD repeat-containing protein 5B; n=15;
           Eukaryota|Rep: WD repeat-containing protein 5B - Mus
           musculus (Mouse)
          Length = 328

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 38/99 (38%), Positives = 58/99 (58%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR TL GH+  ++ +  +P   + + SS+ D  +I+W    D N     +K LYGHS  I
Sbjct: 31  LRLTLAGHSAAISSVKFSPN-GEWLASSAADALIIIWG-AYDGNC----KKTLYGHSLEI 84

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SDV  SSD +  +S S DKTL++WD+ +GK  +  + H+
Sbjct: 85  SDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHS 123



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/94 (34%), Positives = 52/94 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ +V     NP   ++I+S S D+++ +W++       G   K L  HS  IS V
Sbjct: 118 TLKGHSDFVFCCDFNPP-SNLIVSGSFDESVKIWEVKT-----GKCLKTLSAHSDPISAV 171

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             + +G+  +SGS+D   R+WD A+G+  R   D
Sbjct: 172 NFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLAD 205



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  ++ +A +      ++S+S DKTL VW +       G   K L GHS F+   
Sbjct: 76  TLYGHSLEISDVAWSSD-SSRLVSASDDKTLKVWDMRS-----GKCLKTLKGHSDFVFCC 129

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +   N  +SGS+D+++++W++  GK  +    H+
Sbjct: 130 DFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHS 165



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S V  S +G Y L+ + D TL+LWD + G+  + +  H
Sbjct: 211 VSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGH 249


>UniRef50_UPI0000F2C889 Cluster: PREDICTED: similar to Chain A,
           Structure Of Wdr5; n=2; Coelomata|Rep: PREDICTED:
           similar to Chain A, Structure Of Wdr5 - Monodelphis
           domestica
          Length = 328

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 39/110 (35%), Positives = 57/110 (51%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           K F       +L+ TL GH   ++ +  NPK  + + SSS DK + +W++       G  
Sbjct: 22  KSFKLKKPNYQLKFTLDGHTRAISAVKFNPK-GNWLASSSDDKEIKIWEVYS-----GTY 75

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            K L  H+  ISD+  SSD    +S S DKTL++W++ AGK T     HT
Sbjct: 76  MKTLTDHNLGISDIAWSSDSELLVSASDDKTLKIWNVGAGKCTTTLTGHT 125



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/96 (29%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  HN  ++ IA +    ++++S+S DKTL +W +       G     L GH+ F+   
Sbjct: 78  TLTDHNLGISDIAWSSD-SELLVSASDDKTLKIWNV-----GAGKCTTTLTGHTDFVFCC 131

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S   +   SGS+D+ +R+W++  G   R    H+
Sbjct: 132 NFSPQSDIIYSGSFDENVRIWNVKTGGCLRCLSTHS 167



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 27/96 (28%), Positives = 47/96 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   TL GH  +V     +P+  D+I S S D+ + +W +       G   + L  HS  
Sbjct: 116 KCTTTLTGHTDFVFCCNFSPQ-SDIIYSGSFDENVRIWNVKT-----GGCLRCLSTHSAP 169

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++ V  + +G+  +SGS+D   R+WD  + +  + F
Sbjct: 170 VTAVHTNQNGSLLVSGSYDGLCRIWDTVSCQYIKTF 205


>UniRef50_A5URP9 Cluster: WD-40 repeat protein; n=1; Roseiflexus sp.
           RS-1|Rep: WD-40 repeat protein - Roseiflexus sp. RS-1
          Length = 696

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 36/96 (37%), Positives = 52/96 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P    ++ S +RD T+ +W +       G   + L GH+ +++ V
Sbjct: 535 TLEGHTSDVNSVAFSPD-GRLLASGARDSTVRLWDVAS-----GQLLRTLEGHTDWVNSV 588

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS DKT+RLWD A+G+  R  E HT
Sbjct: 589 AFSPDGRLLASGSPDKTVRLWDAASGQLVRTLEGHT 624



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 37/96 (38%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  WV  +A  P    ++ S S DKT+ +W         G   + L GH+  +  V
Sbjct: 237 TLEGHTDWVFSVAFAPD-GRLLASGSLDKTVRLWDAAS-----GQLVRALEGHTDSVLSV 290

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + DG    SGS DKT+RLWD A+G+  R  E HT
Sbjct: 291 AFAPDGRLLASGSPDKTVRLWDAASGQLVRTLEGHT 326



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 37/100 (37%), Positives = 53/100 (53%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL+GH   V  +A  P    ++ S S DKT+ +W +       G   + L GH+ +
Sbjct: 191 RLVRTLKGHGDSVFSVAFAPD-GRLLASGSPDKTVRLWDVAS-----GQLVRTLEGHTDW 244

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  V  + DG    SGS DKT+RLWD A+G+  R  E HT
Sbjct: 245 VFSVAFAPDGRLLASGSLDKTVRLWDAASGQLVRALEGHT 284



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 36/102 (35%), Positives = 50/102 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL GH  WV  +A +P    ++ S S DKT+ +W         G   + L GH+  
Sbjct: 573 QLLRTLEGHTDWVNSVAFSPD-GRLLASGSPDKTVRLWDAAS-----GQLVRTLEGHTGR 626

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  V  S DG    SG  D T+RLWD+  G+  R  E HT +
Sbjct: 627 VLSVAFSPDGRLLASGGRDWTVRLWDVQTGQLVRTLEGHTNL 668



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 35/95 (36%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +A  P    ++ S S DKT+ +W         G   + L GH++++  V 
Sbjct: 280 LEGHTDSVLSVAFAPD-GRLLASGSPDKTVRLWDAAS-----GQLVRTLEGHTNWVRSVA 333

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + DG    SGS DKT+RLWD A+G+  R  E HT
Sbjct: 334 FAPDGRLLASGSSDKTVRLWDAASGQLVRTLEGHT 368



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 35/106 (33%), Positives = 54/106 (50%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           ++  TLK  G+  G + W   +A +P    ++ S S D T+ +W         G   + L
Sbjct: 485 QLLRTLKGHGSSHGSSVW--SVAFSPD-GRLLASGSLDNTIRLWDAAS-----GQLVRTL 536

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GH+  ++ V  S DG    SG+ D T+RLWD+A+G+  R  E HT
Sbjct: 537 EGHTSDVNSVAFSPDGRLLASGARDSTVRLWDVASGQLLRTLEGHT 582



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 34/98 (34%), Positives = 47/98 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  WV  +A  P    ++ S S DKT+ +W         G   + L GH+  ++ V
Sbjct: 321 TLEGHTNWVRSVAFAPD-GRLLASGSSDKTVRLWDAAS-----GQLVRTLEGHTSDVNSV 374

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG    S S D T+RL D A+G+     E HT +
Sbjct: 375 AFSPDGRLLASASADGTIRLRDAASGQRVSALEGHTDI 412



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 31/81 (38%), Positives = 43/81 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH G V  +A +P    ++ S  RD T+ +W +       G   + L GH++ +S V
Sbjct: 619 TLEGHTGRVLSVAFSPD-GRLLASGGRDWTVRLWDVQT-----GQLVRTLEGHTNLVSSV 672

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
           V S DG    SGS D T+RLW
Sbjct: 673 VFSPDGRLLASGSDDGTIRLW 693



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/96 (31%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P    ++ S+S D T+ +    RD  + G     L GH+  ++ +
Sbjct: 363 TLEGHTSDVNSVAFSPD-GRLLASASADGTIRL----RDAAS-GQRVSALEGHTDIVAGL 416

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S DG    S +WD  + L + A G+  R  E HT
Sbjct: 417 SISPDGRLLASAAWDSVISLQEAATGRRVRALEGHT 452



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 8/121 (6%)
 Frame = +2

Query: 14  SSLFKPFSKMSETLKLRGTLRGHNGWVTQ-IATNPKYPDMI--LSSSRDKTLIV---WK- 172
           S  F P  ++  +    GT+R  +    Q ++    + D++  LS S D  L+    W  
Sbjct: 373 SVAFSPDGRLLASASADGTIRLRDAASGQRVSALEGHTDIVAGLSISPDGRLLASAAWDS 432

Query: 173 -LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            ++  E   G   + L GH+  +  V  + DG    SG+ D T+RLWD A+G+  R  + 
Sbjct: 433 VISLQEAATGRRVRALEGHTDAVFSVAFAPDGRLLASGARDSTVRLWDAASGQLLRTLKG 492

Query: 350 H 352
           H
Sbjct: 493 H 493



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + D+  S DG    SGS DKT+RLWD A+G+  R  + H
Sbjct: 161 VFDIAFSPDGRLLASGSPDKTVRLWDAASGRLVRTLKGH 199


>UniRef50_A3IST7 Cluster: Peptidase C14, caspase catalytic subunit
           p20; n=1; Cyanothece sp. CCY 0110|Rep: Peptidase C14,
           caspase catalytic subunit p20 - Cyanothece sp. CCY 0110
          Length = 1060

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 38/86 (44%), Positives = 49/86 (56%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+   +GH+G +T IA +P    +I+SSS DKTL +W L   E    I       H   I
Sbjct: 206 LKPPFQGHDGEITSIAISPD-GQIIVSSSWDKTLRLWNLEGKEIIDPITV-----HQQRI 259

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
             V  S DG Y +SGSWDKT+RLW+L
Sbjct: 260 ESVAFSPDGQYFISGSWDKTIRLWNL 285



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 1/93 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLYGHSHFISDVVL 253
           GH   V+ +A +P    +I+S S D T+ +W      N  G + +  L GH   ++ +  
Sbjct: 86  GHQDKVSTVAVSPD-GSIIVSGSWDGTIRLW------NPQGQLLRDPLLGHGEKVTALAF 138

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           S+DG Y +SGS D+T  +W+      T R E H
Sbjct: 139 SADGRYLISGSSDRTFIIWNRQGEAVTNRIEGH 171



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLYGHSHF 235
           LR  L GH   VT +A +      ++S S D+T I+W      N  G     R+ GH+  
Sbjct: 122 LRDPLLGHGEKVTALAFSAD-GRYLISGSSDRTFIIW------NRQGEAVTNRIEGHNAG 174

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I+ +  S  G+Y ++GS D++L+LWD         F+ H
Sbjct: 175 ITALACSPKGDYFITGSSDRSLKLWDFDGEPLKPPFQGH 213



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLYGHSHFISDV 247
           ++GH  ++  +A +P   +MI S S D+T+      R  N YG +      GH   + D+
Sbjct: 294 IKGHEDYILCVAISPD-GEMIASGSSDRTI------RIHNRYGQMIYDPFLGHQGSVRDI 346

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             + DG   +SGS D  +R WD+
Sbjct: 347 AFTPDGKTLISGSSDHEVRFWDI 369



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 16/32 (50%), Positives = 23/32 (71%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +GH   +S V +S DG+  +SGSWD T+RLW+
Sbjct: 85  FGHQDKVSTVAVSPDGSIIVSGSWDGTIRLWN 116



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           ++ HNG VT +A +P+  D  ++ S D+T+ +W         G P   L   H   ++ +
Sbjct: 420 IQAHNGDVTCMAYSPQ-GDKFVTGSWDETIRIWTAA------GKPLTELIKAHDGDVTCL 472

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
                GNY ++G  D  ++LW
Sbjct: 473 AYHPQGNYIVTGGRDGRVKLW 493



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  H+  ++ +  S  G+  ++GSWD+T+R+W  A    T   + H
Sbjct: 420 IQAHNGDVTCMAYSPQGDKFVTGSWDETIRIWTAAGKPLTELIKAH 465


>UniRef50_Q54N37 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 382

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 10/112 (8%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYP------DMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           KL   L GH+  VT ++  P         +  +S S+D T+I+WK T  ENN  IP   L
Sbjct: 6   KLTDCLIGHSSEVTSLSITPDPQLNTSSINYFVSGSKDGTVIIWKSTMLENN--IPNTTL 63

Query: 218 Y----GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           Y    GHS  +  V +++D  + +SGSWD  + +WD+ +G+  +  +  ++V
Sbjct: 64  YRVLKGHSDVVQKVAITNDQKFVISGSWDCNVCIWDIQSGECIKTIKHQSQV 115


>UniRef50_Q115C0 Cluster: Serine/threonine protein kinase with WD40
           repeats; n=1; Trichodesmium erythraeum IMS101|Rep:
           Serine/threonine protein kinase with WD40 repeats -
           Trichodesmium erythraeum (strain IMS101)
          Length = 630

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYGHSHF 235
           RG   GH+G VT IA +P    +  S+S+DK + VW+L  D  + NYG     L GH   
Sbjct: 415 RGEYFGHSGGVTAIAFHPDGKSLA-SASKDKNVKVWRLGDDIYDPNYGRVIMTLTGHLQQ 473

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           +  +  S DG    SGS D  +++WDL+ G T +
Sbjct: 474 VRAIAFSPDGKTLASGSQDNMIKIWDLSLGNTVK 507



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 34/95 (35%), Positives = 51/95 (53%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+T K   TL GH  WV  +A       ++ S S D+T+ +W++     + G     + G
Sbjct: 317 SKTWKCIDTLTGHRKWVCSVALRNDQK-ILASGSEDETIKLWEV-----DSGREILTIRG 370

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           HS +++ V  S DG    SGS DKT+RLW++  GK
Sbjct: 371 HSGYVNSVAFSPDGKILASGSDDKTIRLWEVQTGK 405



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 29/80 (36%), Positives = 42/80 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  + Q+  +P+  D+I S S D T+ +W     +   G     L GHS +I+ V 
Sbjct: 554 LEGHSSDIRQVVFSPQ-GDIIASGSEDGTIKIW-----DGKTGQEIGNLVGHSKYINSVT 607

Query: 251 LSSDGNYALSGSWDKTLRLW 310
            S DG    SGS D T+R+W
Sbjct: 608 FSRDGKSLASGSSDNTIRIW 627



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/96 (28%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA +P     + S S+D  + +W L+       +     Y  +H+I  V
Sbjct: 466 TLTGHLQQVRAIAFSPD-GKTLASGSQDNMIKIWDLSLGNTVKNLCH--YYQGTHYIYTV 522

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S+DG    SG  D+ +++W++ +G+  +  E H+
Sbjct: 523 AFSTDGKVLASGGRDRNIKIWEIESGEILKILEGHS 558



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/77 (32%), Positives = 38/77 (49%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S  RD+ + +W++   E       K L GHS  I  VV S  G+   SGS D T+++
Sbjct: 530 VLASGGRDRNIKIWEIESGEI-----LKILEGHSSDIRQVVFSPQGDIIASGSEDGTIKI 584

Query: 308 WDLAAGKTTRRFEDHTK 358
           WD   G+       H+K
Sbjct: 585 WDGKTGQEIGNLVGHSK 601



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GH  ++  V L +D     SGS D+T++LW++ +G+       H+
Sbjct: 326 LTGHRKWVCSVALRNDQKILASGSEDETIKLWEVDSGREILTIRGHS 372


>UniRef50_A0DBT2 Cluster: Chromosome undetermined scaffold_444,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_444,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 892

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 32/94 (34%), Positives = 50/94 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GHN  V Q+  +P    ++ S S D ++I+W     + N G  + +L GH   +  + 
Sbjct: 478 LDGHNSGVAQVCFSPDL-SILASCSEDNSIILW-----DANTGQKKSQLNGHDQGVISIC 531

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG    SGSWDKT+R W++ +GK   + + H
Sbjct: 532 FSYDGKGIASGSWDKTIRFWNVKSGKQKSKLDGH 565



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 29/84 (34%), Positives = 48/84 (57%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  +T +  +P   +++ SSS+DKT+I+W + +       P+ +L GH+  +  V  
Sbjct: 645 QGHNHEITSLCFSP-VENILASSSKDKTIILWDIKKRA-----PKIQLCGHTDAVQTVCF 698

Query: 254 SSDGNYALSGSWDKTLRLWDLAAG 325
           S DG    SG  D ++RLWD+  G
Sbjct: 699 SPDGFTLASGGNDNSIRLWDIKTG 722



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/97 (27%), Positives = 45/97 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +  +P     + S   D ++ +W +       G  + +L GH   +S + 
Sbjct: 686 LCGHTDAVQTVCFSPD-GFTLASGGNDNSIRLWDIKT-----GFEKFKLLGHVDLVSSLC 739

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S DG    SGSWDK++RLWD+   +   + + H  +
Sbjct: 740 FSPDGTILASGSWDKSIRLWDIQTQQEKYQLKGHNNL 776



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 25/82 (30%), Positives = 43/82 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V+ +  +P    ++ S S DK++ +W +   +  Y     +L GH++ +  V 
Sbjct: 728 LLGHVDLVSSLCFSPD-GTILASGSWDKSIRLWDIQTQQEKY-----QLKGHNNLVHSVC 781

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            SS+G    S S DK++RLW +
Sbjct: 782 FSSNGTKLASCSKDKSIRLWHI 803



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 29/95 (30%), Positives = 44/95 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           + T + +  L GH+  V  I  +      I S S DKT+  W +       G  + +L G
Sbjct: 511 ANTGQKKSQLNGHDQGVISICFSYDGKG-IASGSWDKTIRFWNVKS-----GKQKSKLDG 564

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H   +S +  S DG    SGS D+++RLW +   K
Sbjct: 565 HEDGVSAICFSRDGKTLASGSLDESIRLWGIKTRK 599



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/75 (29%), Positives = 36/75 (48%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S S DKT+ +W +   E  Y     +L GH+  ++ V  S D +   S S D ++ L
Sbjct: 454 ILASCSSDKTIHLWDVKAREQMY-----QLDGHNSGVAQVCFSPDLSILASCSEDNSIIL 508

Query: 308 WDLAAGKTTRRFEDH 352
           WD   G+   +   H
Sbjct: 509 WDANTGQKKSQLNGH 523


>UniRef50_A7IQW2 Cluster: HNWD1 protein; n=2; Podospora anserina|Rep:
            HNWD1 protein - Podospora anserina
          Length = 1538

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 34/95 (35%), Positives = 49/95 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH  +V  +A +P     I S SRDKT+ +W         G   +   GH H+I  V
Sbjct: 1369 TLKGHRDFVLSVAFSPD-SKWIASGSRDKTIKIWDAAT-----GSCTQTFKGHRHWIMSV 1422

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D  +  SGS DKT+++W+ A G  T+  + H
Sbjct: 1423 AFSPDSKWVASGSRDKTIKIWEAATGSCTQTLKGH 1457



 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V  +A +P     + S S D T+ +W         G+  + L GH + +  V
Sbjct: 949  TLEGHSGSVNSVAFSPD-SKWVASGSGDDTIKIWDAAT-----GLCTQTLEGHGYSVMSV 1002

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D  +  SGS+DKT+++WD A G  T+    H
Sbjct: 1003 AFSPDSKWVASGSYDKTIKIWDAATGSCTQTLAGH 1037



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V  +A +P     + S S D T+ +W         G+  + L GH + +  V
Sbjct: 1159 TLEGHSGSVNSVAFSPD-SKWVASGSGDDTIKIWDAAT-----GLCTQTLEGHRYSVMSV 1212

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D  +  SGS+DKT+++WD A G  T+    H
Sbjct: 1213 AFSPDSKWVASGSYDKTIKIWDAATGSCTQTLAGH 1247



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 34/95 (35%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     + S S DKT+ +W         G   + L GH  F+  V
Sbjct: 1327 TLAGHGDSVMSVAFSPDSKG-VTSGSNDKTIKIWDAAT-----GSCTQTLKGHRDFVLSV 1380

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D  +  SGS DKT+++WD A G  T+ F+ H
Sbjct: 1381 AFSPDSKWIASGSRDKTIKIWDAATGSCTQTFKGH 1415



 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 34/97 (35%), Positives = 48/97 (49%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            R TL GH   V  +A +P     + S SRDKT+ +W         G   + L GH +++ 
Sbjct: 821  RQTLEGHRHPVDSVAFSPD-SKWVASGSRDKTIKIWDAAT-----GSCTQTLAGHRNWVK 874

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  S D  +  SGS D T+++WD A G  T+  E H
Sbjct: 875  SVAFSPDSKWVASGSDDSTIKIWDAATGSYTQTLEGH 911



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 32/96 (33%), Positives = 46/96 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  +A +P     + S S D T+ +W         G   + L GH   ++ V
Sbjct: 865  TLAGHRNWVKSVAFSPD-SKWVASGSDDSTIKIWDAAT-----GSYTQTLEGHGGSVNSV 918

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S D  +  SGS D T+++WD A G  T+  E H+
Sbjct: 919  AFSPDSKWVASGSSDSTIKIWDAATGSYTQTLEGHS 954



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 32/96 (33%), Positives = 46/96 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH G V  +A +P     + S S D T+ +W         G   + L GH   ++ V
Sbjct: 1075 TLEGHGGSVNSVAFSPD-SKWVASGSSDSTIKIWDAAT-----GSYTQTLEGHGGSVNSV 1128

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S D  +  SGS D T+++WD A G  T+  E H+
Sbjct: 1129 AFSPDSKWVASGSSDSTIKIWDAATGSYTQTLEGHS 1164



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 32/95 (33%), Positives = 46/95 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  +A +P     + S S DKT+ +      E   G+  + + GH   +  V
Sbjct: 1243 TLAGHRNWVKSVAFSPD-SKWVASGSGDKTIKI-----REAATGLCTQTIAGHGLSVHSV 1296

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D  +  SGS DKT+++WD A G  T+    H
Sbjct: 1297 AFSPDSKWVASGSGDKTIKIWDAATGSCTQTLAGH 1331



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 32/95 (33%), Positives = 46/95 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     + S S DKT+ +W         G   + L GH +++  V
Sbjct: 991  TLEGHGYSVMSVAFSPD-SKWVASGSYDKTIKIWDAAT-----GSCTQTLAGHRNWVKSV 1044

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D  +  SGS D T+++WD A G  T+  E H
Sbjct: 1045 AFSPDSKWVASGSDDSTIKIWDAATGSYTQTLEGH 1079



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 22/56 (39%), Positives = 31/56 (55%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ENN+   ++ L GH H +  V  S D  +  SGS DKT+++WD A G  T+    H
Sbjct: 814 ENNWNACRQTLEGHRHPVDSVAFSPDSKWVASGSRDKTIKIWDAATGSCTQTLAGH 869


>UniRef50_Q8Z0R1 Cluster: WD-40 repeat protein; n=2; Nostocaceae|Rep:
            WD-40 repeat protein - Anabaena sp. (strain PCC 7120)
          Length = 1227

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 33/94 (35%), Positives = 51/94 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  +  +P     + SSS D+T+ +W     + + G   ++L GHSH++  V
Sbjct: 981  TLTGHTNWVWTVVFSPD-KHTLASSSEDRTIRLW-----DKDTGDCLQKLKGHSHWVWTV 1034

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              S DG    SGS D  +++WD+A+GK  +   D
Sbjct: 1035 AFSPDGRILASGSADSEIKIWDVASGKCLQTLTD 1068



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/95 (31%), Positives = 53/95 (55%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LRGH G +  +A +P    ++ S S D T+ +W ++  + N+    + L GH++++  VV
Sbjct: 937  LRGHQGRIRSVAFHPD-GKILASGSADNTIKLWDIS--DTNHSKYIRTLTGHTNWVWTVV 993

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D +   S S D+T+RLWD   G   ++ + H+
Sbjct: 994  FSPDKHTLASSSEDRTIRLWDKDTGDCLQKLKGHS 1028



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPD---MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            TL GH+ WV  +  +P   D   ++ SSS D+ + +W +       G   K L GH+  +
Sbjct: 723  TLIGHDDWVWSVTFSPVTDDRPLLLASSSADQHIKLWDVAT-----GKCLKTLKGHTREV 777

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              V  S DG    S   D T+RLWD+  G+  + FE H+K
Sbjct: 778  HSVSFSPDGQTLASSGEDSTVRLWDVKTGQCWQIFEGHSK 817



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 32/103 (31%), Positives = 50/103 (48%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+  +LR   +GH  WV   A +P    M+ S S D T+ +W +     + G   K L  
Sbjct: 632 SDNKQLR-IYKGHTAWVWAFAFSPD-SRMLASGSADSTIKLWDV-----HTGECLKTLSK 684

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  S DG    S S D+T++LWD+A G   +    H
Sbjct: 685 NTNKVYSVAFSPDGRILASASQDQTIKLWDIATGNCQQTLIGH 727



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 28/96 (29%), Positives = 44/96 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+ WV  +A +P    ++ S S D  + +W +       G   + L      I  V 
Sbjct: 1024 LKGHSHWVWTVAFSPD-GRILASGSADSEIKIWDVAS-----GKCLQTLTDPQGMIWSVA 1077

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    S S D+T++LW+L  G+     + H K
Sbjct: 1078 FSLDGTLLASASEDQTVKLWNLKTGECVHTLKGHEK 1113



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/83 (32%), Positives = 40/83 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +A +P    +  S S D T+ +W    D +         +GH+  I  V
Sbjct: 1107 TLKGHEKQVYSVAFSPN-GQIAASGSEDTTVKLW----DISTGSCVDTLKHGHTAAIRSV 1161

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              S DG    SGS D+ ++LWD+
Sbjct: 1162 AFSPDGRLLASGSEDEKIQLWDM 1184



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            ++ S+S D+T+ +W L   E  +      L GH   +  V  S +G  A SGS D T++L
Sbjct: 1084 LLASASEDQTVKLWNLKTGECVH-----TLKGHEKQVYSVAFSPNGQIAASGSEDTTVKL 1138

Query: 308  WDLAAG 325
            WD++ G
Sbjct: 1139 WDISTG 1144



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH+  V  +  +P     + S   D+++ +W + R E         L+GHS  +  +  S
Sbjct: 814  GHSKKVYSVRFSPD-GQTLASCGEDRSIKLWDIQRGEC-----VNTLWGHSSQVWAIAFS 867

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             DG   +S S D+T RLWD+  G +      +T+
Sbjct: 868  PDGRTLISCSDDQTARLWDVITGNSLNILRGYTR 901



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 206 QKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           Q R+Y GH+ ++     S D     SGS D T++LWD+  G+  +    +T
Sbjct: 636 QLRIYKGHTAWVWAFAFSPDSRMLASGSADSTIKLWDVHTGECLKTLSKNT 686


>UniRef50_A0YYY9 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Lyngbya sp. PCC 8106|Rep: Serine/Threonine
           protein kinase with WD40 repeats - Lyngbya sp. PCC 8106
          Length = 650

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 33/93 (35%), Positives = 54/93 (58%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T KL  ++  H+ WV  +A +P   +++ S S DKT+ +W L +     GI ++ + GH
Sbjct: 397 QTGKLLYSIAAHSSWVKALAISPD-GEILASGSNDKTIRLWDLKQ-----GIRRRTIEGH 450

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +  ++ +  S DG    SGS D+T+RLWDL  G
Sbjct: 451 TESVNTLAFSPDGQTLASGSDDRTIRLWDLKTG 483



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           L+G+   V Q+ T    PD   L +     + +W L   +  Y I       HS ++  +
Sbjct: 361 LQGYKSAVGQVYTVAISPDGQTLVAGSFGNITIWDLQTGKLLYSIA-----AHSSWVKAL 415

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +S DG    SGS DKT+RLWDL  G   R  E HT+
Sbjct: 416 AISPDGEILASGSNDKTIRLWDLKQGIRRRTIEGHTE 452



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 32/92 (34%), Positives = 48/92 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H+G V  IA +P     + S S D+T+ +W LT+     G  +  + GHS  I+D+
Sbjct: 488 TIPAHDGPVNSIAFSPD-GQTLASGSSDQTIKLWGLTQ-----GTRKLTISGHSGAINDI 541

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             ++DG    S S D T+RLW+   G   R F
Sbjct: 542 AYTTDGQSLGSVSDDGTIRLWNPNTGDQVRLF 573



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/98 (29%), Positives = 43/98 (43%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R T+ GH   V  +A +P     + S S D+T+ +W L        IP      H   ++
Sbjct: 444 RRTIEGHTESVNTLAFSPD-GQTLASGSDDRTIRLWDLKTGARILTIP-----AHDGPVN 497

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  S DG    SGS D+T++LW L  G        H+
Sbjct: 498 SIAFSPDGQTLASGSSDQTIKLWGLTQGTRKLTISGHS 535



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 1/66 (1%)
 Frame = +2

Query: 122 PD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKT 298
           PD   L S  D+ +I+W L   E      +  L+GH+  ++ + LS +G   +SGS DKT
Sbjct: 587 PDGQTLFSGSDR-IIIWDLKTGEQ-----KATLWGHAQTVNALALSPNGEILVSGSEDKT 640

Query: 299 LRLWDL 316
           +++W +
Sbjct: 641 IKIWQV 646


>UniRef50_A0YQZ5 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC
           8106|Rep: WD-repeat protein - Lyngbya sp. PCC 8106
          Length = 580

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 35/103 (33%), Positives = 57/103 (55%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  TL GH   +  +A +P    ++ S S D T+ +W+L   +     P +R+ GH
Sbjct: 454 ETGELIHTLTGHALPILSLAISPD-GKILASGSADSTIALWELQTAQ-----PIRRMSGH 507

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +  VV+S+D    +SGSWD+T++LWDL  G+       H+
Sbjct: 508 TDGVWSVVISADNRTLVSGSWDRTVKLWDLQTGELKGNLTGHS 550



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 1/102 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK-RLYGHSHF 235
           LR T +GHN  + +IA +P    ++ ++S D ++ +W L    N   +P    L  HS+ 
Sbjct: 326 LRKTWKGHNSSINEIAVSPN-GQILATASDDGSIKLWDLMTAINTDTLPLLYTLKEHSNA 384

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  V  S DG    SGSWD  + +WD   G+       H+++
Sbjct: 385 VLSVEFSPDGRKLASGSWDNLIMIWDTQTGELLNTLIGHSQM 426



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 30/103 (29%), Positives = 49/103 (47%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           ++TL L  TL+ H+  V  +  +P     + S S D  +++W     +   G     L G
Sbjct: 369 TDTLPLLYTLKEHSNAVLSVEFSPD-GRKLASGSWDNLIMIW-----DTQTGELLNTLIG 422

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           HS  +S + +S DG    SGS D T+++W+L  G+       H
Sbjct: 423 HSQMVSAIAISPDGKILASGSKDNTIKIWNLETGELIHTLTGH 465



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 22/80 (27%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V  +  +     ++ S S D+T+ +W L   E      +  L GHS +++ V 
Sbjct: 504 MSGHTDGVWSVVISADNRTLV-SGSWDRTVKLWDLQTGEL-----KGNLTGHSSYVNTVD 557

Query: 251 LSSDGNYALSGSWDKTLRLW 310
           +S D    +SG WD  +++W
Sbjct: 558 ISPDEQTIVSGGWDGQVKIW 577


>UniRef50_Q5ATB2 Cluster: Putative uncharacterized protein; n=1;
            Emericella nidulans|Rep: Putative uncharacterized protein
            - Emericella nidulans (Aspergillus nidulans)
          Length = 1364

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 38/103 (36%), Positives = 55/103 (53%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L  TL GH+  V  +A +P     + SSS D T+ +W  T  E      Q+   GH 
Sbjct: 949  TGELLQTLEGHSQSVRSVAFSPD-GKQLASSSSDTTIKLWNSTTGEL-----QQTFKGHD 1002

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +I  V  S DG + +SGS D T++LWDLA  +  +  EDH++
Sbjct: 1003 LWIRAVAFSPDGKHLVSGSDDNTIKLWDLATSELQQSLEDHSR 1045



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 38/103 (36%), Positives = 55/103 (53%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L+ TL G + WV  +A +P     + S   D T+ +W     ++  G   + L GHS
Sbjct: 1117 TGELQQTLTGRSDWVDSVAFSPD-GKQLASGYYDSTIKLW-----DSATGELLQTLEGHS 1170

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              I  VV S DG    SGS+D+T +LWD A G+  + FE H+K
Sbjct: 1171 DRIQSVVFSPDGKLLASGSYDQTAKLWDPATGELLQIFEGHSK 1213



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 35/105 (33%), Positives = 53/105 (50%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S T +L+ T +GH+ W+  +A +P    ++ S S D T+ +W L   E      Q+ L  
Sbjct: 989  STTGELQQTFKGHDLWIRAVAFSPDGKHLV-SGSDDNTIKLWDLATSEL-----QQSLED 1042

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            HS  +  V  S D     S S D T++LWD A G+  R  E H++
Sbjct: 1043 HSRSVHAVAFSPDDKQLASSSLDSTIKLWDSATGELQRTLEGHSQ 1087



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 33/103 (32%), Positives = 53/103 (51%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L  TL GH+G V  +A +P    ++ S S D T+ +W     ++  G   +   GH 
Sbjct: 781  TGELLQTLDGHSGTVESLAFSPD-GKLLASGSYDNTIDLW-----DSATGELLQTFEGHP 834

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            H I  V  + DG    S S D T+++WDLA G+  +  + H++
Sbjct: 835  HSIWSVAFAPDGKELASASDDSTIKIWDLATGELQQTLDSHSQ 877



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/95 (33%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL  H G V  +  +P    ++ S S D T+ +W     E       + L GHS  +  +
Sbjct: 745  TLENHLGPVESVVFSPDGKQLV-SGSYDDTVKIWDPATGEL-----LQTLDGHSGTVESL 798

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS+D T+ LWD A G+  + FE H
Sbjct: 799  AFSPDGKLLASGSYDNTIDLWDSATGELLQTFEGH 833



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 34/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L+ TL  H+  V  +A +P    ++ SSS D T+ VW     E      Q+ L G S
Sbjct: 865  TGELQQTLDSHSQSVRSVAFSPD-GKLLASSSLDSTIKVWNPATGEL-----QQSLEGRS 918

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             ++  V  S DG    SGS   T++LW+ A G+  +  E H++
Sbjct: 919  GWVKSVAFSPDGKKLASGSEKNTVKLWNPATGELLQTLEGHSQ 961



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/93 (32%), Positives = 48/93 (51%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L+ +L  H+  V  +A +P     + SSS D T+ +W     ++  G  Q+ L GHS
Sbjct: 1033 TSELQQSLEDHSRSVHAVAFSPD-DKQLASSSLDSTIKLW-----DSATGELQRTLEGHS 1086

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
              +  V  S DG    S S+D T++LW+   G+
Sbjct: 1087 QGVRSVTFSPDGKLLASNSYDGTIKLWNPLTGE 1119



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 29/102 (28%), Positives = 47/102 (46%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S T +L  TL GH+  +  +  +P    ++ S S D+T  +W     E       +   G
Sbjct: 1157 SATGELLQTLEGHSDRIQSVVFSPD-GKLLASGSYDQTAKLWDPATGEL-----LQIFEG 1210

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            HS ++  V  S DG    S S+ +T++LWD   G+  +   D
Sbjct: 1211 HSKWVESVAFSPDGKLLASSSYGETIKLWDPVTGELLQTLND 1252



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 20/62 (32%), Positives = 34/62 (54%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +L + E  +   Q+ L  H   +  VV S DG   +SGS+D T+++WD A G+  +  + 
Sbjct: 731 QLPKVEQTWSAEQQTLENHLGPVESVVFSPDGKQLVSGSYDDTVKIWDPATGELLQTLDG 790

Query: 350 HT 355
           H+
Sbjct: 791 HS 792



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 28/103 (27%), Positives = 44/103 (42%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L     GH+ WV  +A +P    ++ SSS  +T+ +W     E       + L    
Sbjct: 1201 TGELLQIFEGHSKWVESVAFSPD-GKLLASSSYGETIKLWDPVTGEL-----LQTLNDPD 1254

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                 V  S DGN   S     T ++WD A G+  +  + H+K
Sbjct: 1255 ESAGSVAFSPDGNRLASVDIFDT-KIWDPATGELLQALKGHSK 1296


>UniRef50_UPI00006D0027 Cluster: hypothetical protein
           TTHERM_00760520; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00760520 - Tetrahymena
           thermophila SB210
          Length = 480

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/102 (36%), Positives = 58/102 (56%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E+ +L   L+GH G V  +A + +   M  SSS D ++ +W L++    Y    + LYGH
Sbjct: 171 ESGQLERALKGHMGTVNSVAFDSQGKYMA-SSSTDLSIRIWDLSQ----YTCI-RTLYGH 224

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +SDV    +G++ +S S DKTL+LW++  G   R +E H
Sbjct: 225 EHNVSDVKFLPNGDFLISASRDKTLKLWEVVTGFCKRTYEGH 266



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   VTQ+A +P Y  ++ + S D ++ +W     +   G  ++ L GH   ++ V 
Sbjct: 137 MQGHRSQVTQVAFHPTY-SIVATCSEDGSIRLW-----DFESGQLERALKGHMGTVNSVA 190

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S G Y  S S D ++R+WDL+     R    H
Sbjct: 191 FDSQGKYMASSSTDLSIRIWDLSQYTCIRTLYGH 224



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 31/85 (36%), Positives = 44/85 (51%), Gaps = 2/85 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIAT--NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL+GH+ WV  +A   N +Y   + S S DK+L VW L +      I       H+HFIS
Sbjct: 400 TLKGHDNWVRSLAVHNNNRY---LYSCSDDKSLRVWDLEKMRQARKIHD----AHNHFIS 452

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL 316
            V  +       +GS D T+++WDL
Sbjct: 453 SVAFNPSYLILATGSVDTTVKIWDL 477



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/102 (27%), Positives = 52/102 (50%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S T   + +L  +N   T++  + K   +++S SRDK +I+W     +  +      L G
Sbjct: 352 SNTPSAKNSLTQNN---TKLQQSTKTIQILISGSRDKNIIIWNPQNAQQLF-----TLKG 403

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           H +++  + + ++  Y  S S DK+LR+WDL   +  R+  D
Sbjct: 404 HDNWVRSLAVHNNNRYLYSCSDDKSLRVWDLEKMRQARKIHD 445



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/98 (29%), Positives = 49/98 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V+ +   P   D ++S+SRDKTL +W++       G  ++   GH  ++  +
Sbjct: 220 TLYGHEHNVSDVKFLPN-GDFLISASRDKTLKLWEVVT-----GFCKRTYEGHEEWVKCL 273

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            +   G    SGS D+T+ +W+L A +  +    H  V
Sbjct: 274 RVHESGTQFASGSQDQTVMVWNLDANQPQQVLRGHEHV 311



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 22/64 (34%), Positives = 32/64 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH  WV  +  +        S S+D+T++VW L  D N    PQ+ L GH H +  V
Sbjct: 262 TYEGHEEWVKCLRVHES-GTQFASGSQDQTVMVWNL--DANQ---PQQVLRGHEHVVECV 315

Query: 248 VLSS 259
           V ++
Sbjct: 316 VYAN 319


>UniRef50_Q7NJ67 Cluster: WD-repeat protein; n=1; Gloeobacter
           violaceus|Rep: WD-repeat protein - Gloeobacter violaceus
          Length = 1197

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 32/96 (33%), Positives = 52/96 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+GW+  +  +P     + SSS+D  + +W         G P + + GH+ ++  +
Sbjct: 688 TLRGHSGWIHAVRFSPN-GQWLASSSQDGKIQLW-----HPESGEPLQAMQGHTGWVRSI 741

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + DG   +SGS D+TLRLWD+  G   +  + HT
Sbjct: 742 AFAPDGQTLISGSDDQTLRLWDVQRGLLLKCLQGHT 777



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 37/95 (38%), Positives = 52/95 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH GWV  IA  P    +I S S D+TL +W + R     G+  K L GH+ ++  V 
Sbjct: 731 MQGHTGWVRSIAFAPDGQTLI-SGSDDQTLRLWDVQR-----GLLLKCLQGHTGWVRSVD 784

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S+DG    SGS D+T+RLWD  +G   R    H+
Sbjct: 785 FSADGRTLASGSDDQTVRLWDADSGLCFRVMHGHS 819



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 35/96 (36%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH GWV  +A +P    ++ SSS D +L +W +   +   G+    L GH+ ++  V
Sbjct: 940  TLRGHTGWVNSLAFSPNGA-LLASSSVDHSLRIWNVETGQC-LGM----LQGHTSWVRSV 993

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                DG    S S DKT RLWD+  G+     + HT
Sbjct: 994  AFHPDGRVLASASQDKTARLWDIETGRCLWTLQGHT 1029



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 31/94 (32%), Positives = 54/94 (57%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH GWV  +  +      + S S D+T+ +W     + + G+  + ++GHS++IS VV
Sbjct: 773  LQGHTGWVRSVDFSAD-GRTLASGSDDQTVRLW-----DADSGLCFRVMHGHSNWISSVV 826

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    SGS D ++R+W++++G   R  + H
Sbjct: 827  FSPDGRLLTSGSVDHSVRIWEISSGHCLRVLQGH 860



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 32/102 (31%), Positives = 51/102 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET +  G L+GH  WV  +A +P    ++ S+S+DKT  +W +      +      L GH
Sbjct: 975  ETGQCLGMLQGHTSWVRSVAFHPD-GRVLASASQDKTARLWDIETGRCLW-----TLQGH 1028

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + ++  V    DG+   SGS D T++LWD+  G+       H
Sbjct: 1029 TSWVRSVAFHPDGHTLASGSDDGTVKLWDVQTGRLADSLSGH 1070



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 34/102 (33%), Positives = 48/102 (47%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET +   TL+GH  WV  +A +P     + S S D T+ +W +       G     L GH
Sbjct: 1017 ETGRCLWTLQGHTSWVRSVAFHPD-GHTLASGSDDGTVKLWDVQT-----GRLADSLSGH 1070

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +  VV ++DG    SG  DKT+RLWD  + + T     H
Sbjct: 1071 GSGVWSVVFAADGKRLASGGDDKTVRLWDTTSMQCTHVLNRH 1112



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 27/96 (28%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L+ H  WV  +A +P    ++ SS +D+T+ +W     + + G   K L GH+ +++ +
Sbjct: 898  SLQAHTSWVRTVAFSPD-GTLLASSGQDRTIKLW-----DPDSGRCLKTLRGHTGWVNSL 951

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S +G    S S D +LR+W++  G+     + HT
Sbjct: 952  AFSPNGALLASSSVDHSLRIWNVETGQCLGMLQGHT 987



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/94 (29%), Positives = 43/94 (45%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH  WV  IA +P    ++ S S D+T+ +W     +   G   K   GH  ++  V  
Sbjct: 606 RGHTSWVWSIAFSPD-GRVLASGSADRTVRLW-----DYRTGQCLKVFQGHEGWVRSVAF 659

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              G    SGS D  +RLW++ +G+       H+
Sbjct: 660 HPGGGILASGSEDAAVRLWEVDSGRCLLTLRGHS 693



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/95 (25%), Positives = 43/95 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   +  +A        + S S D ++ +W  +  +     P + L  H+ ++  V 
Sbjct: 857  LQGHGSGIWSVAFRGD-GKTLASGSIDHSVRLWDFSTRQ-----PMRSLQAHTSWVRTVA 910

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    S   D+T++LWD  +G+  +    HT
Sbjct: 911  FSPDGTLLASSGQDRTIKLWDPDSGRCLKTLRGHT 945



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 2/95 (2%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
            +T +L  +L GH    W    A + K    + S   DKT+ +W  T  +  + + +    
Sbjct: 1059 QTGRLADSLSGHGSGVWSVVFAADGK---RLASGGDDKTVRLWDTTSMQCTHVLNR---- 1111

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             H+  +  V + +D     S S D+T+ LWDL  G
Sbjct: 1112 -HASGVLCVAIEADSRILASSSADETITLWDLQGG 1145


>UniRef50_Q10ZJ8 Cluster: WD-40 repeat; n=2; Cyanobacteria|Rep:
           WD-40 repeat - Trichodesmium erythraeum (strain IMS101)
          Length = 728

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/104 (35%), Positives = 55/104 (52%), Gaps = 1/104 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYG 223
           ETL+    LRGH  WV+ +   P     ++S S DKT+ VW L TR E         L G
Sbjct: 555 ETLEEIFLLRGHTDWVSAVTVTPD-GKQVISGSFDKTIKVWSLATRKEI------ATLVG 607

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H+ ++  + ++ DG   +SGS+DKT+++W L  G+       HT
Sbjct: 608 HTGWVKALAVTPDGKRVISGSFDKTIKVWCLETGQELFSLSGHT 651



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL GH GWV  +A  P     ++S S DKT+ VW L   +  +      L GH+
Sbjct: 598 TRKEIATLVGHTGWVKALAVTPD-GKRVISGSFDKTIKVWCLETGQELFS-----LSGHT 651

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            +++ + ++ DG+  +S S D TL++WDL   +    F
Sbjct: 652 DWVNSIAVTPDGSLVISASDDNTLKVWDLETRQVIANF 689



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 33/104 (31%), Positives = 52/104 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K+  TLRGH GWV   A +      I+S S D T+ +W L   E  +      L GH
Sbjct: 266 ETQKVEMTLRGHQGWVN--AVSVLSDKEIISGSSDNTIKIWSLETGEELF-----TLKGH 318

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +  +  +    +    +SG+ D T+++W+L + K    F+ H+K
Sbjct: 319 TDGVRTITTLLE-RQIISGAADNTVKVWNLDSKKAVFTFKGHSK 361



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 32/96 (33%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+   N  +  +A  P     I   S D+TL VW L   E  +      L GH+ ++S V
Sbjct: 520 TIVSDNRCIFAVAVTPDGKQAIACLS-DQTLKVWNLETLEEIF-----LLRGHTDWVSAV 573

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++ DG   +SGS+DKT+++W LA  K       HT
Sbjct: 574 TVTPDGKQVISGSFDKTIKVWSLATRKEIATLVGHT 609



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 32/101 (31%), Positives = 46/101 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  T  GH+GWV  I        M++S S D TL VW         G     + GH+  
Sbjct: 146 RLLRTFTGHSGWVNAIVVTSG--GMVISGSSDNTLKVWN-----PETGKEISTITGHAAR 198

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           I  + L  D  + +SGS D T+++WDL   +       HT+
Sbjct: 199 IRAIALLDD-KWVISGSDDFTIKVWDLETTEELVTLTGHTR 238



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 29/97 (29%), Positives = 46/97 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  I T       I+S + D T+ VW L   +  +        GHS  I+ V
Sbjct: 314 TLKGHTDGVRTITT--LLERQIISGAADNTVKVWNLDSKKAVFTFK-----GHSKEINAV 366

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++ D    +S + D TL++W+L  G+     + HT+
Sbjct: 367 AVTPDNKRMISAASDNTLKVWNLETGEELFPLKGHTE 403



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 33/103 (32%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIAT-NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           ET K   T+ GH   +  IA  + K+   ++S S D T+ VW L   E         L G
Sbjct: 184 ETGKEISTITGHAARIRAIALLDDKW---VISGSDDFTIKVWDLETTEELV-----TLTG 235

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H+  +  V   SDG   +SGS D T+++W+L   K       H
Sbjct: 236 HTRAVRAVAALSDGR-VISGSSDNTIKVWNLETQKVEMTLRGH 277



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 26/95 (27%), Positives = 48/95 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   V  +A  P     ++S S D TL +W L  D +    P   + GH++ ++  +
Sbjct: 398 LKGHTESVYAVAVLPD--GRLISGSDDFTLKIWSL--DTSEEFCP---MVGHTNRVNAAI 450

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +    +S +WD T+++W+L   K+    + HT
Sbjct: 451 VLPE-QQVISAAWDHTIKVWNLNTTKSIYTLKGHT 484


>UniRef50_A7BVG4 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp.
           PS|Rep: WD-40 repeat protein - Beggiatoa sp. PS
          Length = 888

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 40/105 (38%), Positives = 53/105 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L GH GW+  +    K  +  LS+S DKTL +W      +  G       GH
Sbjct: 82  ETGQEINSLSGHTGWIMSVVALKK-DNTFLSASYDKTLKLWN-----SQTGQEIHTFEGH 135

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  I  V LS +G  ALSGS D TL LW L + +  R F+ HT V
Sbjct: 136 TRSIFSVALSPNGKTALSGSGDNTLILWGLNSKRKLRTFKGHTNV 180



 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 35/96 (36%), Positives = 50/96 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   +  +A +P      LS S D TLI+W L           +   GH++ I+ V
Sbjct: 131 TFEGHTRSIFSVALSPN-GKTALSGSGDNTLILWGLNSKRK-----LRTFKGHTNVITSV 184

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S +G  ALSGS+DKTL+LW++   +  + FE HT
Sbjct: 185 AFSPNGKMALSGSYDKTLKLWNIRNRQVMKTFEGHT 220



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 39/100 (39%), Positives = 51/100 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KLR T +GH   +T +A +P    M LS S DKTL +W +   +       K   GH+  
Sbjct: 170 KLR-TFKGHTNVITSVAFSPN-GKMALSGSYDKTLKLWNIRNRQ-----VMKTFEGHTDK 222

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           I  V  S DG   LSGS DKT++ W+L  G     F+ HT
Sbjct: 223 IWSVAFSPDGLTCLSGSEDKTIKRWNLKKGIEINEFQGHT 262



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 32/95 (33%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   +  +A +P      LS S DKT+  W L +     GI      GH+  +  V
Sbjct: 215 TFEGHTDKIWSVAFSPDGLTC-LSGSEDKTIKRWNLKK-----GIEINEFQGHTDKVWSV 268

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG   +SGS D T+RLW+    +  R F+ H
Sbjct: 269 AFSPDGKTIVSGSEDNTIRLWNSETEQEIRTFQGH 303



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P +   GH++++  V    DG   LSGS D TL+LWD+  G+       HT
Sbjct: 44  PIRTFQGHTYYVESVAFMPDGKTILSGSLDNTLKLWDIETGQEINSLSGHT 94



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 27/79 (34%), Positives = 40/79 (50%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +A +P     I+S S D T+ +W    ++       +   GH+  +  V  
Sbjct: 259 QGHTDKVWSVAFSPD-GKTIVSGSEDNTIRLWNSETEQEI-----RTFQGHNGPVRSVTF 312

Query: 254 SSDGNYALSGSWDKTLRLW 310
           S DG+Y LSGS D TL+LW
Sbjct: 313 SPDGHYILSGSTDNTLKLW 331


>UniRef50_UPI00006CB0EE Cluster: Vegetatible incompatibility protein
           HET-E-1, putative; n=1; Tetrahymena thermophila
           SB210|Rep: Vegetatible incompatibility protein HET-E-1,
           putative - Tetrahymena thermophila SB210
          Length = 638

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = +2

Query: 113 PKYPDM--ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           P++ D   ++S S DKT+ VWKL + +NN  +  + L GH  ++  +V+  D +  +SGS
Sbjct: 489 PEFADQRCLISGSSDKTIKVWKLNK-KNNQAVQVRNLVGHKDYVQTLVMLPDDSTLVSGS 547

Query: 287 WDKTLRLWDLAAGKTTRRFEDHT 355
            DK++ LW++  G+   + + HT
Sbjct: 548 LDKSIMLWNIHTGQNIAKLDGHT 570



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 34/121 (28%), Positives = 58/121 (47%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           ++K   K ++ +++R  L GH  +V  +   P     ++S S DK++++W +   +N   
Sbjct: 508 VWKLNKKNNQAVQVRN-LVGHKDYVQTLVMLPD-DSTLVSGSLDKSIMLWNIHTGQNI-- 563

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F 379
               +L GH+ FI+ + L S+    LS S D TL+ WD+         E H     N  F
Sbjct: 564 ---AKLDGHTSFITKLNLYSE-RVILSSSTDGTLKFWDVNIKSCVHTLEGHQGAVNN--F 617

Query: 380 C 382
           C
Sbjct: 618 C 618



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 37/124 (29%), Positives = 55/124 (44%), Gaps = 21/124 (16%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG--------- 199
           ET++    LRGH   V  + + P     ++S+S DK + +W  ++   N           
Sbjct: 351 ETMECLLCLRGHTQGVRDLISLPN--GFLVSASYDKLIKIWNTSQSLINMNQSISSPTNT 408

Query: 200 ---IPQ--------KRLYGH-SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
              I Q        K L GH S  IS + LS  G    SGS D T+++WDL +G+  +  
Sbjct: 409 PNVIQQDYSSQCLVKTLKGHLSGVISLLYLS--GQILASGSADYTIKIWDLQSGEALKTI 466

Query: 344 EDHT 355
             HT
Sbjct: 467 SGHT 470



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 20/79 (25%), Positives = 38/79 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   +  I T    P+ + +   D T+ +W L   E         L GH+  + D++  
Sbjct: 320 GHTRQINSICTYG--PNKVATGGEDNTIRLWNLETMECLLC-----LRGHTQGVRDLISL 372

Query: 257 SDGNYALSGSWDKTLRLWD 313
            +G + +S S+DK +++W+
Sbjct: 373 PNG-FLVSASYDKLIKIWN 390


>UniRef50_Q3MB33 Cluster: Peptidase C14, caspase catalytic subunit
            p20; n=2; Nostocaceae|Rep: Peptidase C14, caspase
            catalytic subunit p20 - Anabaena variabilis (strain ATCC
            29413 / PCC 7937)
          Length = 1557

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 36/88 (40%), Positives = 46/88 (52%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH  WV  +A +P     I+S S DKTL +W    D N   I Q    GH   +  V  
Sbjct: 1441 RGHEDWVRSVAFSPD-GGRIVSGSDDKTLRLW----DVNGQPIGQP-FRGHEDLVRSVAF 1494

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            S DG   +SGS+D+T+R+WD A G   R
Sbjct: 1495 SPDGERIVSGSYDETIRIWDAATGDCLR 1522



 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 37/96 (38%), Positives = 47/96 (48%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH G V  +A +P     I+S S D T+ +W    D N   I Q    GH + +  V  
Sbjct: 1315 RGHEGRVYSVAFSPD-GGRIVSGSNDNTIRLW----DVNGQPIGQP-FRGHENLVYSVAF 1368

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S DG   +SGSWD T+RLWD+      R F  H  V
Sbjct: 1369 SPDGGRIVSGSWDNTIRLWDVNGQPIGRPFRGHENV 1404



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 35/93 (37%), Positives = 46/93 (49%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH G V  +A +P     I+S S D T+ +W    D N   I Q    GH   +  V  
Sbjct: 1147 RGHEGGVNSVAFSPD-GGRIVSGSNDNTIRLW----DMNGQPIGQP-FRGHEDMVYSVAF 1200

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   +SGS+DKT+RLWD+      + F  H
Sbjct: 1201 SPDGGRIVSGSYDKTIRLWDMNGQPIGQPFRGH 1233



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 34/93 (36%), Positives = 46/93 (49%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH G V  +A +P     I+S S D T+ +W    D N   I Q    GH   ++ V  
Sbjct: 1063 RGHEGGVNSVAFSPD-GGRIVSGSNDNTIRLW----DVNGQPIGQP-FRGHEGGVNSVAF 1116

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   +SGS+D T+RLWD+      + F  H
Sbjct: 1117 SPDGGRIVSGSYDNTVRLWDVNGQPIGQPFRGH 1149



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/93 (35%), Positives = 45/93 (48%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH   V  +A +P     I+S S D T+ +W    D N   I +    GH + +  V  
Sbjct: 1357 RGHENLVYSVAFSPD-GGRIVSGSWDNTIRLW----DVNGQPIGRP-FRGHENVVYSVAF 1410

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   +SGSWD T+RLWD+      + F  H
Sbjct: 1411 SPDGGRIVSGSWDNTIRLWDVNGQSIGQPFRGH 1443



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 35/93 (37%), Positives = 45/93 (48%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH   V  +A +P     I+S S D T+ +W    D N   I Q    GH  ++  V  
Sbjct: 1399 RGHENVVYSVAFSPD-GGRIVSGSWDNTIRLW----DVNGQSIGQP-FRGHEDWVRSVAF 1452

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   +SGS DKTLRLWD+      + F  H
Sbjct: 1453 SPDGGRIVSGSDDKTLRLWDVNGQPIGQPFRGH 1485



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 45/93 (48%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH   V  +A +P     I+S S D T+ +W    + N   I Q    GH + ++ V  
Sbjct: 1231 RGHEDMVLSVAFSPD-GGRIVSGSYDNTVRLW----EANGQSIGQP-FRGHENLVNSVAF 1284

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   +SGS D T+RLWD+      + F  H
Sbjct: 1285 SPDGGRIVSGSNDNTIRLWDVNGQPIGQPFRGH 1317



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 33/94 (35%), Positives = 45/94 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +A +P     I+S S D T+ +W    D N   I Q    GH   ++ V 
Sbjct: 978  LQGHENGVKSVAFSPD-GGRIVSGSNDNTIRLW----DVNGQPIGQP-FRGHEGGVNSVA 1031

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG   +SGS D T+RLWD+      + F  H
Sbjct: 1032 FSPDGGRIVSGSNDNTIRLWDVNGQPIGQPFRGH 1065



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 28/89 (31%), Positives = 41/89 (46%)
 Frame = +2

Query: 86   GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
            G V  +A +P    +++  S+  T+ VW     E   G     L GH + +  V  S DG
Sbjct: 941  GVVYSVAFSPDGKKLVIGDSKG-TIQVW-----ETFSGRVLLFLQGHENGVKSVAFSPDG 994

Query: 266  NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +SGS D T+RLWD+      + F  H
Sbjct: 995  GRIVSGSNDNTIRLWDVNGQPIGQPFRGH 1023


>UniRef50_A3IX04 Cluster: WD-40 repeat protein; n=3;
           Chroococcales|Rep: WD-40 repeat protein - Cyanothece sp.
           CCY 0110
          Length = 930

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSS-RDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           K +  L GH  WVT ++ N     +  +S+  DKT+ +W + + +       ++L GH++
Sbjct: 541 KSQQVLEGHQDWVTALSFNQNADKLASASTINDKTIRIWSVAKQQQT-----QQLKGHTN 595

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            I  +    D  Y +S + D T+RLWD   GK  ++ + HT
Sbjct: 596 SIQAIAFCPDDRYLISAASDNTIRLWDRKTGKAIKQLQQHT 636



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/95 (33%), Positives = 53/95 (55%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   +  +A +P    ++ S   DKT+ +W++       G   ++L GH + + DVV
Sbjct: 765  LQGHLEDIEGVAFSPN-SQLVASCGNDKTIKIWEVVS-----GQQVQQLEGHKYSVEDVV 818

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG +  S S DKT+R+W + +GK   +F+ HT
Sbjct: 819  FSPDGQFIASVSRDKTVRVWHIISGKEVHKFQGHT 853



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/95 (33%), Positives = 51/95 (53%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +P     I S SRDKT+ VW +   +  +     +  GH++++  V 
Sbjct: 807  LEGHKYSVEDVVFSPD-GQFIASVSRDKTVRVWHIISGKEVH-----KFQGHTNYVYCVA 860

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG+Y +SG  DK + +WDL +G+ T+  + HT
Sbjct: 861  FSLDGHYLISGGKDKMIAIWDLISGELTQLMQGHT 895



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 31/94 (32%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ H  WV  +A +P     I     D T+ +W +             L GH   +S V 
Sbjct: 632 LQQHTNWVYSVACSPD-GRWIAIGYNDWTVRLWDIIEQRE-----VNCLEGHESSVSSVA 685

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              D  + +SGSWD TLR+WD+  GK  R  +DH
Sbjct: 686 FCPDNQHLISGSWDGTLRVWDIHTGKCKRILQDH 719



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 34/99 (34%), Positives = 52/99 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V+ +A  P    +I S S D TL VW +     + G  ++ L  H ++IS V 
Sbjct: 674 LEGHESSVSSVAFCPDNQHLI-SGSWDGTLRVWDI-----HTGKCKRILQDHQNWISSVA 727

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
           +S +G +  SG WDKT+ LW++A   T  +    T++ Q
Sbjct: 728 VSPNGQWVASGGWDKTVHLWEIAYSWTQFQATKPTRILQ 766



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI--PQKRLYG 223
            T K +  L+ H  W++ +A +P     + S   DKT+ +W++      +    P + L G
Sbjct: 709  TGKCKRILQDHQNWISSVAVSPN-GQWVASGGWDKTVHLWEIAYSWTQFQATKPTRILQG 767

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H   I  V  S +     S   DKT+++W++ +G+  ++ E H
Sbjct: 768  HLEDIEGVAFSPNSQLVASCGNDKTIKIWEVVSGQQVQQLEGH 810



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH+  +T +A N K   ++LS S D+TLI+W++      + + +    G    I+ V 
Sbjct: 420 LQGHSKKITGLAFN-KDGSLLLSGSLDETLIIWEIKTGTKRHELSEPM--GR---ITAVA 473

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S D  +  SGS    +R+W   +G+  R  E H
Sbjct: 474 FSEDNQFIASGSHTGIVRIWGAISGQEWRCLEGH 507



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   +  IA  P     ++S++ D T+ +W     +   G   K+L  H++++  V 
Sbjct: 590 LKGHTNSIQAIAFCPD-DRYLISAASDNTIRLW-----DRKTGKAIKQLQQHTNWVYSVA 643

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
            S DG +   G  D T+RLWD+   +     E H     +  FC
Sbjct: 644 CSPDGRWIAIGYNDWTVRLWDIIEQREVNCLEGHESSVSSVAFC 687



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW--DKTL 301
           ++ S  RDKT+ +W +T      G  Q+ L GH  +++ +  + + +   S S   DKT+
Sbjct: 522 VLASGGRDKTIHLWNVTS-----GKSQQVLEGHQDWVTALSFNQNADKLASASTINDKTI 576

Query: 302 RLWDLAAGKTTRRFEDHTKV*QNS*FC 382
           R+W +A  + T++ + HT   Q   FC
Sbjct: 577 RIWSVAKQQQTQQLKGHTNSIQAIAFC 603



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH   I  ++ SSD     SG  DKT+ LW++ +GK+ +  E H
Sbjct: 504 LEGHGTAIESLIFSSDSKVLASGGRDKTIHLWNVTSGKSQQVLEGH 549



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 22/81 (27%), Positives = 42/81 (51%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH  +V  +A +      ++S  +DK + +W L   E       + + GH++ I+ +  
Sbjct: 850  QGHTNYVYCVAFSLD-GHYLISGGKDKMIAIWDLISGELT-----QLMQGHTNDINSIAF 903

Query: 254  SSDGNYALSGSWDKTLRLWDL 316
            + DG++ +SG  D  +RLW L
Sbjct: 904  TGDGSFLVSGDNDGVVRLWKL 924



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 23/65 (35%), Positives = 38/65 (58%)
 Frame = +2

Query: 152 KTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           + + +W LT+     G   ++L GHS  I+ +  + DG+  LSGS D+TL +W++  G  
Sbjct: 404 QNIYLWDLTQ-----GKFLRQLQGHSKKITGLAFNKDGSLLLSGSLDETLIIWEIKTG-- 456

Query: 332 TRRFE 346
           T+R E
Sbjct: 457 TKRHE 461


>UniRef50_A6RKZ7 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 548

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 35/98 (35%), Positives = 49/98 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   VT +A +P     I+S S D T+ +W +T      G   + L GH+  ++ V
Sbjct: 421 TLEGHAHPVTSVAFSPD-SKQIVSGSLDNTIKLWDITT-----GAMLQTLEGHTDSVTSV 474

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S D    +SGSWD  +RLWD   G   +  E HT +
Sbjct: 475 AFSPDSKQIVSGSWDYKVRLWDTMTGAMLQTLEGHTNI 512



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   VT +A +P     I+S S D  + +W     +   G   + L GH++ +  V
Sbjct: 463 TLEGHTDSVTSVAFSPD-SKQIVSGSWDYKVRLW-----DTMTGAMLQTLEGHTNIVISV 516

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
             S DG   +SGS DKT+RLWD++
Sbjct: 517 AFSPDGKQVVSGSDDKTVRLWDIS 540



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%)
 Frame = +2

Query: 176 TRDENN--YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +RD  N   G     L GH+H ++ V  S D    +SGS D T++LWD+  G   +  E 
Sbjct: 407 SRDRVNASMGATLHTLEGHAHPVTSVAFSPDSKQIVSGSLDNTIKLWDITTGAMLQTLEG 466

Query: 350 HT 355
           HT
Sbjct: 467 HT 468


>UniRef50_UPI000023E54C Cluster: hypothetical protein FG08955.1; n=1;
            Gibberella zeae PH-1|Rep: hypothetical protein FG08955.1
            - Gibberella zeae PH-1
          Length = 1418

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 34/104 (32%), Positives = 53/104 (50%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L+GH+  V  +  +      + S S DKT+ +W     +   G  ++ L G
Sbjct: 1133 AETGECERELKGHSDMVNSVVFSHD-SKKVASGSWDKTIRIW-----DAETGECERELKG 1186

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS  ++ VV S D     SGSWDKT+R+W+   G+  R  E H+
Sbjct: 1187 HSDMVNSVVFSHDSKKVASGSWDKTIRIWNAETGECERVLEGHS 1230



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L+GH+  V  +         + S S DKT+ +W     +   G  ++ L G
Sbjct: 1091 AETGECERELKGHSDMVNSVVFLYD-SKKVASGSWDKTIRIW-----DAETGECERELKG 1144

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS  ++ VV S D     SGSWDKT+R+WD   G+  R  + H+
Sbjct: 1145 HSDMVNSVVFSHDSKKVASGSWDKTIRIWDAETGECERELKGHS 1188



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 32/95 (33%), Positives = 46/95 (48%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L GH+  V  +  +      + S S DKT+ +W     E      ++ L G
Sbjct: 1217 AETGECERVLEGHSDGVNSVVFSHD-SKKVASGSIDKTIRIWNAETGEC-----ERELKG 1270

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            HS  I  VV S D     SGSWDKT+R+W+   G+
Sbjct: 1271 HSDDIRSVVFSHDSKKVASGSWDKTIRIWNAETGE 1305



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/104 (30%), Positives = 51/104 (49%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L+GH+  V  +  +      + S S DKT+ +W     E      ++ L G
Sbjct: 1175 AETGECERELKGHSDMVNSVVFSHD-SKKVASGSWDKTIRIWNAETGEC-----ERVLEG 1228

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS  ++ VV S D     SGS DKT+R+W+   G+  R  + H+
Sbjct: 1229 HSDGVNSVVFSHDSKKVASGSIDKTIRIWNAETGECERELKGHS 1272



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/104 (29%), Positives = 50/104 (48%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L GH+  V  +  +      + S S D+T+ +W     E      ++ L G
Sbjct: 1007 AETGECERVLEGHSNSVNSVVFSHD-SKKVASGSIDQTIRIWNAETGEC-----ERELEG 1060

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS  ++ VV S D     SGS D+T+R+WD   G+  R  + H+
Sbjct: 1061 HSADVNSVVFSHDSKKVASGSIDETIRIWDAETGECERELKGHS 1104



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/104 (29%), Positives = 51/104 (49%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L GH+  V  +  +      + S S D+T+ +W     E      ++ L G
Sbjct: 965  AETGECERVLEGHSADVNSVVFSHD-SKKVASGSIDQTIRIWNAETGEC-----ERVLEG 1018

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS+ ++ VV S D     SGS D+T+R+W+   G+  R  E H+
Sbjct: 1019 HSNSVNSVVFSHDSKKVASGSIDQTIRIWNAETGECERELEGHS 1062



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131  ILSSSRDKTLIVW--KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
            I+  + +K +  W   L + E N+      L GHS  ++ VV   D     SGSWD T+R
Sbjct: 902  IMRRTFEKVIPKWICSLPKVEENWDACLLTLEGHSKRVNSVVFLHDSKKVASGSWDDTIR 961

Query: 305  LWDLAAGKTTRRFEDHT 355
            +W+   G+  R  E H+
Sbjct: 962  IWNAETGECERVLEGHS 978


>UniRef50_A5UYN9 Cluster: Protein kinase; n=1; Roseiflexus sp.
           RS-1|Rep: Protein kinase - Roseiflexus sp. RS-1
          Length = 1330

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 36/96 (37%), Positives = 54/96 (56%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH   +T ++ +P   + +LS S D TL +W         G  ++ L GH+  I+   
Sbjct: 579 IKGHAEKITCVSFSPD-GNFLLSGSEDNTLRLWDWL------GTCKRILKGHTGAITCAA 631

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S DG Y LSGS D T+RLWD+A G+  R F+ HT+
Sbjct: 632 FSQDGRYILSGSHDCTVRLWDVATGECLRVFKGHTE 667



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/75 (38%), Positives = 38/75 (50%)
 Frame = +2

Query: 92   VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
            +T +  +P     ILS S D T+ +W L      +        GH   +  V  S DG Y
Sbjct: 1182 ITSVVFHPN-GRFILSGSVDGTVRIWDLETSRCVHVFS-----GHRDIVQSVAFSQDGCY 1235

Query: 272  ALSGSWDKTLRLWDL 316
            A+SGSWDKT+RLW L
Sbjct: 1236 AVSGSWDKTVRLWVL 1250



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 34/98 (34%), Positives = 49/98 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GHN WV  +A +P     ILS+S DKT+ +W + R     GI    L      I+ V
Sbjct: 954  TLIGHNFWVWSVAASP-CGRYILSASFDKTMRLWDVKR-----GICLHTLNIPDKTINSV 1007

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
              S  G Y + G ++ T+++WD+   K  R F    +V
Sbjct: 1008 AFSPSGEYIVFGGYE-TMQMWDVRKWKCIRVFRYEKRV 1044



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/49 (46%), Positives = 29/49 (59%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + + GH+  I+ V  S DGN+ LSGS D TLRLWD   G   R  + HT
Sbjct: 577 RNIKGHAEKITCVSFSPDGNFLLSGSEDNTLRLWDW-LGTCKRILKGHT 624



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 29/97 (29%), Positives = 44/97 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH G +T  A +      ILS S D T+ +W +   E       +   GH+  ++ V 
Sbjct: 620 LKGHTGAITCAAFSQD-GRYILSGSHDCTVRLWDVATGEC-----LRVFKGHTEKVTSVA 673

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
                 Y  SGS D TL++WD+  G +    E   +V
Sbjct: 674 FDIGRQYIASGSTDHTLKIWDIHDGSSIHTIEHEGEV 710



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 7/94 (7%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR------DENNYGIPQKRLYGHSH 232
            L GH G +T +A  P     ILS S D T+ +W + +      DE +       L G   
Sbjct: 1080 LEGHEGAITSVAVRPD-GYYILSCSYDHTVRLWDVCKGVCVYVDETHMKSLPHPLGGEID 1138

Query: 233  F-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
              ++ V  S DG +A+S   D  +R+W++  GKT
Sbjct: 1139 VPVNSVSFSPDGKHAVSAGTDGMMRIWNIENGKT 1172



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 21/48 (43%), Positives = 26/48 (54%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            L GH   I+ V +  DG Y LS S+D T+RLWD+  G      E H K
Sbjct: 1080 LEGHEGAITSVAVRPDGYYILSCSYDHTVRLWDVCKGVCVYVDETHMK 1127



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S+  D  + +W +   EN   + Q R       I+ VV   +G + LSGS D T+R+WD
Sbjct: 1154 VSAGTDGMMRIWNI---ENGKTLSQLRC---KDSITSVVFHPNGRFILSGSVDGTVRIWD 1207

Query: 314  LAAGKTTRRFEDHTKV*QN 370
            L   +    F  H  + Q+
Sbjct: 1208 LETSRCVHVFSGHRDIVQS 1226



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSW-DKTLRLWDLAAGKTTRRFEDH 352
            R++ +   +  V  S DG Y +SG W D T+RLW++  G+     E H
Sbjct: 1036 RVFRYEKRVDAVAFSPDGRYVVSGGWDDATIRLWEVQTGRCVCILEGH 1083


>UniRef50_Q5AZ95 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 434

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 34/99 (34%), Positives = 54/99 (54%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ T+ GH+ WV  +A +P    ++ S S +KT+ +W    D    G+ +  L GHS+++
Sbjct: 147 LKHTIEGHSDWVLSVAFSPD-GQLLASGSAEKTIKLW----DSATCGL-KHTLGGHSNWV 200

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +V S DG    SGS D T++LWD  +G      E H+
Sbjct: 201 LPLVFSPDGRLLASGSNDATIKLWDPPSGSLKHTLEGHS 239



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 34/104 (32%), Positives = 51/104 (49%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S T  L+ TL GH+ WV  +  +P    ++ S S D T+ +W     +   G  +  L G
Sbjct: 184 SATCGLKHTLGGHSNWVLPLVFSPD-GRLLASGSNDATIKLW-----DPPSGSLKHTLEG 237

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS+ I  +  S +G    SGS D T++LWD A G      + H+
Sbjct: 238 HSNKIESLAFSPNGQLLASGSSDATIKLWDTATGSFRHTLKGHS 281



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 31/96 (32%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ W+  +  +P    ++ S S D T+ +W    D  + G+ Q  L GHS  +  V
Sbjct: 36  TLEGHSDWIETVTFSPD-GRLLASGSNDTTIKLW----DPASGGLKQT-LEGHSSSVQSV 89

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S +G    SGS D T++LW+ A+       E H+
Sbjct: 90  AFSPNGQLLASGSSDTTIKLWNSASDSLKHTMEGHS 125



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 31/89 (34%), Positives = 45/89 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH+  +  +A +P    ++ S S D T+ +W     +   G  +  L GHS  +
Sbjct: 231 LKHTLEGHSNKIESLAFSPN-GQLLASGSSDATIKLW-----DTATGSFRHTLKGHSDMV 284

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             VV S D     SGS D T++LWD A G
Sbjct: 285 LSVVFSPDSQLLESGSGDNTIKLWDPATG 313



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 24/57 (42%), Positives = 33/57 (57%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           E+N+G   + L GHS +I  V  S DG    SGS D T++LWD A+G   +  E H+
Sbjct: 27  EDNWGPELQTLEGHSDWIETVTFSPDGRLLASGSNDTTIKLWDPASGGLKQTLEGHS 83


>UniRef50_Q5AXM0 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 1878

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 34/98 (34%), Positives = 50/98 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GHN WV  +  +     ++ S+S D T+ +W     +   G  Q+ L GH+  +
Sbjct: 297 LQNTLEGHNEWVKSVVFSHD-SRLLASASDDGTVKIW-----DTATGTLQRMLKGHNDSV 350

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             VV S D     SGS D+T+R+W+   G     FEDH
Sbjct: 351 RSVVFSHDSRLIASGSNDRTVRIWETTTGLLRHTFEDH 388



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/102 (32%), Positives = 47/102 (46%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGH 226
           T  L+ TL GHN WV  +  +     +I S+S D T+ +W          +P Q  L  H
Sbjct: 462 TGSLQRTLEGHNDWVRSVVFSHD-SRLIASASDDMTVKIWDTAT------VPLQNNLESH 514

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +++  VV S D     S S D T+++WD A G      E H
Sbjct: 515 DNWVRSVVFSHDSRLLASASDDMTVKIWDTATGSLENTLEGH 556



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/104 (25%), Positives = 46/104 (44%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+ L+  L  H+ WV  +  +     ++ S+S D T+ +W     +   G  +  L GH 
Sbjct: 504 TVPLQNNLESHDNWVRSVVFSHD-SRLLASASDDMTVKIW-----DTATGSLENTLEGHD 557

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             ++ V  S D     S S D T+++W  A G     F+   +V
Sbjct: 558 DRVNSVSFSPDSRLLASASDDGTVKIWYAATGTVQHTFDGSGRV 601



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           G  Q  L GH   ++ V  S D     S S D+T+++W  A G   R  E H
Sbjct: 421 GSLQNVLEGHDDCVNSVSFSPDSRLLASASDDRTVKIWHAATGSLQRTLEGH 472



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 24/98 (24%), Positives = 40/98 (40%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+  L+GHN  V  +  +     +I S S D+T+ +W+ T      G+ +     H   +
Sbjct: 339 LQRMLKGHNDSVRSVVFSHD-SRLIASGSNDRTVRIWETTT-----GLLRHTFEDHEDSV 392

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  + D     S S    +++WD   G      E H
Sbjct: 393 MAVSFAHDSRRLASASDGGNVKIWDTRTGSLQNVLEGH 430



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GH   +  V  S D     S S D T+++WD A        E H +
Sbjct: 261 GHDRAVGSVSFSHDSRLLASASGDGTVKIWDTATSFLQNTLEGHNE 306


>UniRef50_UPI000038C710 Cluster: COG2319: FOG: WD40 repeat; n=1;
           Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40
           repeat - Nostoc punctiforme PCC 73102
          Length = 492

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 34/100 (34%), Positives = 53/100 (53%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL  TL GH+GWV  +A +P    ++ SSS D+T+ +W +     N G     L GH  +
Sbjct: 368 KLLQTLNGHSGWVMCVAISPD-GKILASSSYDQTIKLWNI-----NTGKVINTLAGHCSY 421

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +  S  G Y  SGS D +++LWD+  G+      +H+
Sbjct: 422 VCAIAFSPVGQYLASGSADHSVKLWDVNTGQELYTLNNHS 461



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 31/99 (31%), Positives = 51/99 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L   L+GH+G V  +A  PK   + +S   D T+ +W L  ++       + L GHS +
Sbjct: 326 QLLQVLKGHSGLVYSLAICPKQ-QIFVSGGADNTIKLWNLKSNKL-----LQTLNGHSGW 379

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V +S DG    S S+D+T++LW++  GK       H
Sbjct: 380 VMCVAISPDGKILASSSYDQTIKLWNINTGKVINTLAGH 418



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/103 (31%), Positives = 53/103 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T KL  TL  H  WV  +A +P    ++ S S D TL++W+++      G   K L  H
Sbjct: 239 DTGKLLHTLTSHTKWVRCLAFSPDSQTLV-SGSDDSTLMIWQVST-----GKLLKTLKVH 292

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  V++S DG   LSG  D T+++  +  G+  +  + H+
Sbjct: 293 STPVFSVIISPDGQTILSGGTDSTIKISHIEMGQLLQVLKGHS 335



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/87 (32%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K+  TL GH  +V  IA +P     + S S D ++ +W +   +  Y      L  HS
Sbjct: 408 TGKVINTLAGHCSYVCAIAFSP-VGQYLASGSADHSVKLWDVNTGQELY-----TLNNHS 461

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
            +++ V  S D     SGS D T++LW
Sbjct: 462 DWVNSVTFSPDSKTLASGSRDMTIKLW 488



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 26/92 (28%), Positives = 42/92 (45%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H  WV   A +P     + S S D T+ +W L     + G     L  H+ ++  +  S 
Sbjct: 208 HLNWVFTTAISPD-GKTLASGSSDNTIKIWHL-----DTGKLLHTLTSHTKWVRCLAFSP 261

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           D    +SGS D TL +W ++ GK  +  + H+
Sbjct: 262 DSQTLVSGSDDSTLMIWQVSTGKLLKTLKVHS 293



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H +++    +S DG    SGS D T+++W L  GK       HTK
Sbjct: 208 HLNWVFTTAISPDGKTLASGSSDNTIKIWHLDTGKLLHTLTSHTK 252



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 29/102 (28%), Positives = 47/102 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL  TL+ H+  V  +  +P     ILS   D T+   K++  E   G   + L GHS
Sbjct: 282 TGKLLKTLKVHSTPVFSVIISPD-GQTILSGGTDSTI---KISHIE--MGQLLQVLKGHS 335

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  + +       +SG  D T++LW+L + K  +    H+
Sbjct: 336 GLVYSLAICPKQQIFVSGGADNTIKLWNLKSNKLLQTLNGHS 377


>UniRef50_Q8Z019 Cluster: WD-40 repeat protein; n=4; cellular
            organisms|Rep: WD-40 repeat protein - Anabaena sp.
            (strain PCC 7120)
          Length = 1711

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 32/96 (33%), Positives = 55/96 (57%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GHN W+T ++ +P    ++ S S DKT+ +W +       G   K L GH+ +++D+
Sbjct: 1470 SLPGHNHWITSLSFSPN-KQILASGSADKTIKLWSVN------GRLLKTLLGHNGWVTDI 1522

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S+DG   +S S DKT+++W L  G+  R  + H+
Sbjct: 1523 KFSADGKNIVSASADKTIKIWSL-DGRLIRTLQGHS 1557



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 45/123 (36%), Positives = 61/123 (49%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG +   K     S   +L  TL GHNGWVT I  +    + I+S+S DKT+ +W L  
Sbjct: 1491 ASGSAD--KTIKLWSVNGRLLKTLLGHNGWVTDIKFSADGKN-IVSASADKTIKIWSLD- 1546

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
                 G   + L GHS  +  V LS DG    S S D+T++LW+L  G+       H+ V
Sbjct: 1547 -----GRLIRTLQGHSASVWSVNLSPDGQTLASTSQDETIKLWNL-NGELIYTLRGHSDV 1600

Query: 362  *QN 370
              N
Sbjct: 1601 VYN 1603



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 33/81 (40%), Positives = 46/81 (56%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GHN  V Q+  +P    +I ++S DKT+ +W  +RD N  G       GH+H ++ +
Sbjct: 1306 TLEGHNEAVWQVIFSPD-GRLIATASADKTITLW--SRDGNILGT----FAGHNHEVNSL 1358

Query: 248  VLSSDGNYALSGSWDKTLRLW 310
              S DGN   SGS D T+RLW
Sbjct: 1359 SFSPDGNILASGSDDNTVRLW 1379



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/99 (31%), Positives = 51/99 (51%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  TL+GH+  V  +  +P     + S+S+D+T+ +W L   E  Y      L GHS  
Sbjct: 1548 RLIRTLQGHSASVWSVNLSPD-GQTLASTSQDETIKLWNLN-GELIY-----TLRGHSDV 1600

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + ++  S DG    S S D T++LW++  G   + F+ H
Sbjct: 1601 VYNLSFSPDGKTIASASDDGTIKLWNVPNGTLLKTFQGH 1639



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 32/101 (31%), Positives = 49/101 (48%)
 Frame = +2

Query: 14   SSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
            +S  K  +  S    + GT  GHN  V  ++ +P   +++ S S D T+ +W + R    
Sbjct: 1329 ASADKTITLWSRDGNILGTFAGHNHEVNSLSFSPD-GNILASGSDDNTVRLWTVNRT--- 1384

Query: 194  YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              +P K  YGH   +S V  S+DG    S S D T++ W L
Sbjct: 1385 --LP-KTFYGHKGSVSYVRFSNDGKKITSLSTDSTMKTWSL 1422



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 28/77 (36%), Positives = 41/77 (53%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            HN WVT ++ +P   ++I S S D T+ +W+  RD    G     L GH+  ++ V  S 
Sbjct: 1105 HNAWVTSVSYSPD-GEVIASGSVDNTIHLWR--RD----GKLLTTLTGHNDGVNSVSFSP 1157

Query: 260  DGNYALSGSWDKTLRLW 310
            DG    S S D T++LW
Sbjct: 1158 DGEILASASADSTIKLW 1174



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 31/97 (31%), Positives = 48/97 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH+  V  ++ +P   ++I S S D T+ +W      +  G     L GHS  ++ +
Sbjct: 1183 TLKGHDQGVKSVSFSPN-GEIIASGSSDHTINLW------SRAGKLLLSLNGHSQGVNSI 1235

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              S +G+   S S D T+RLW L  G+       HTK
Sbjct: 1236 KFSPEGDTIASASDDGTIRLWSL-DGRPLITIPSHTK 1271



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 27/83 (32%), Positives = 40/83 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH+  V  ++ +P     I S+S D T+ +W +       G   K   GH   +  V
Sbjct: 1593 TLRGHSDVVYNLSFSPD-GKTIASASDDGTIKLWNVPN-----GTLLKTFQGHRGGVRSV 1646

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              S DG    SG  D T+++W+L
Sbjct: 1647 SFSPDGKILASGGHDTTVKVWNL 1669



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 33/103 (32%), Positives = 47/103 (45%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG S      +  S   KL  +L GH+  V  I  +P+  D I S+S D T+ +W L  
Sbjct: 1204 ASGSSD--HTINLWSRAGKLLLSLNGHSQGVNSIKFSPE-GDTIASASDDGTIRLWSLD- 1259

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
                 G P   +  H+  +  V  S DG   +S   D T++LW
Sbjct: 1260 -----GRPLITIPSHTKQVLAVTFSPDGQTIVSAGADNTVKLW 1297



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 28/87 (32%), Positives = 43/87 (49%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL      VT I+  P    + L+S  D T+ ++      N  G   + L GH+H+
Sbjct: 1425 KLLQTLSSPLPDVTSISFTPDNKIVALASP-DHTIHLY------NRQGGLLRSLPGHNHW 1477

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDL 316
            I+ +  S +     SGS DKT++LW +
Sbjct: 1478 ITSLSFSPNKQILASGSADKTIKLWSV 1504


>UniRef50_Q4C005 Cluster: G-protein beta WD-40 repeat; n=1;
           Crocosphaera watsonii WH 8501|Rep: G-protein beta WD-40
           repeat - Crocosphaera watsonii
          Length = 299

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 37/92 (40%), Positives = 51/92 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GHN  VT ++  P     + S+S DKTL +W L       G     L GH+ +++ V
Sbjct: 155 TFTGHNSSVTAVSVTPDGLKAV-SASDDKTLKLWDLAT-----GQELLTLTGHNDWVTAV 208

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            ++ DG  A+S S+DKTL+LWDLA GK    F
Sbjct: 209 SVTPDGLKAVSASYDKTLKLWDLATGKEIATF 240



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  ++ V ++ DG  A+S S DKTL+LWDLA G+       H
Sbjct: 158 GHNSSVTAVSVTPDGLKAVSASDDKTLKLWDLATGQELLTLTGH 201


>UniRef50_Q10V31 Cluster: WD-40 repeat; n=1; Trichodesmium
           erythraeum IMS101|Rep: WD-40 repeat - Trichodesmium
           erythraeum (strain IMS101)
          Length = 578

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 29/97 (29%), Positives = 54/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ-KRLYGHSHFISDVV 250
           + H   V  +A  P     ++S S DKT+ +WKL +++N   I   + L GH+  +  V 
Sbjct: 329 KAHPESVNSVAVTPD-EQFVISGSDDKTIKIWKLPKNKNINDISLVQTLTGHTDVVDGVA 387

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           ++ +     SGSWD T+++W+LA+G+  +    H+++
Sbjct: 388 IAPNSKIFASGSWDGTIKIWNLASGELLQTIAGHSEI 424



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/103 (31%), Positives = 49/103 (47%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P +K    + L  TL GH   V  +A  P    +  S S D T+ +W L   E       
Sbjct: 362 PKNKNINDISLVQTLTGHTDVVDGVAIAPN-SKIFASGSWDGTIKIWNLASGEL-----L 415

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           + + GHS  ++ + +S DG +  SGS D  ++LW+L  G+  R
Sbjct: 416 QTIAGHSEIVNGIAISPDGQFLASGSKDNQIKLWNLQTGQLVR 458



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 26/102 (25%), Positives = 52/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +L  T+  ++  +  +  +P    ++ SSS + T+ +W L   +  + + +     H
Sbjct: 452 QTGQLVRTINTNSVSILSVVFSPD-SQILASSSSNGTINIWNLQTGKLIHNLKE-----H 505

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +  +V++ DG   +SGSWDKT++ W+L+ GK       H
Sbjct: 506 LDGVWSIVITPDGKTLISGSWDKTIKFWELSTGKLKGSLRGH 547



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 30/88 (34%), Positives = 45/88 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T KL   L+ H   V  I   P    +I S S DKT+  W+L+      G  +  L GH
Sbjct: 494 QTGKLIHNLKEHLDGVWSIVITPDGKTLI-SGSWDKTIKFWELST-----GKLKGSLRGH 547

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +IS V +S +G   +SG WD+ + +W
Sbjct: 548 NSYISVVAISPNGQIIVSGGWDRKINIW 575


>UniRef50_A0YWB3 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Lyngbya sp. PCC 8106|Rep: Serine/Threonine
           protein kinase with WD40 repeats - Lyngbya sp. PCC 8106
          Length = 662

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 31/95 (32%), Positives = 51/95 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH+  +T +A  P     I+S S D T+ +W         G   + L GHS+ +S + 
Sbjct: 419 LKGHSNSITALAMTPD-GQQIISGSVDSTIKIWSAKT-----GQLLETLQGHSYSVSALA 472

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +S +  + +SGSWD T+++W LA G+  +    HT
Sbjct: 473 VSPNAQFIVSGSWDNTIKIWSLATGELQKTLTGHT 507



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L+ TL GH   V  I  +    ++I S S D ++ +W L   +  +     + Y   
Sbjct: 496 TGELQKTLTGHTNSVNAITVDTD-SELIYSGSVDNSINIWSLKTGKVEHTFEPFQTY--- 551

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                VV+SSD  + +SGSWD T+ +W L  G+  +    H
Sbjct: 552 ---KTVVISSDSRFVISGSWDNTIEIWSLKDGQLIQTLPGH 589



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  IA +P     I+S   D  + +W +       G   + L GHS+ I+ +
Sbjct: 376 TLTGHSDVVNVIAISPD-GQFIVSGGWDHKIKIWSVQS-----GQLIRNLKGHSNSITAL 429

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++ DG   +SGS D T+++W    G+     + H+
Sbjct: 430 AMTPDGQQIISGSVDSTIKIWSAKTGQLLETLQGHS 465



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S S D T+ +W L   +    +P     GH H + D+ +S D  +  SGS D+T+++W
Sbjct: 563 VISGSWDNTIEIWSLKDGQLIQTLP-----GHDHDLLDLAVSPDSKFIASGSSDQTIKIW 617

Query: 311 DLAAGKTTRRFEDH 352
            L  G   R    H
Sbjct: 618 SLETGYLLRTLTGH 631



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  +  +A +P     I S S D+T+ +W L   E  Y +  + L GH + ++ +
Sbjct: 585 TLPGHDHDLLDLAVSPD-SKFIASGSSDQTIKIWSL---ETGYLL--RTLTGHFNSVNTL 638

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             SSDG    SGS +  + +W
Sbjct: 639 TFSSDGLCLASGSNNGVIMVW 659


>UniRef50_A0YLR0 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC
            8106|Rep: WD-repeat protein - Lyngbya sp. PCC 8106
          Length = 1223

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 1/113 (0%)
 Frame = +2

Query: 2    ASGX-SSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT 178
            ASG   +  K ++   E LK   TL GH+ W+  +A +P     + S S D T+ VW + 
Sbjct: 1085 ASGSIDNTLKLWTVSGECLK---TLYGHSNWIFSVAFSPD-GKFLASGSHDHTIRVWDVE 1140

Query: 179  RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
              E  +      L GH+H +S V    +G + +SGS D+T+RLWD+  G+  +
Sbjct: 1141 TGECIH-----ILQGHTHLVSSVRFCHEGKFIISGSQDQTVRLWDVETGECVK 1188



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 32/86 (37%), Positives = 47/86 (54%)
 Frame = +2

Query: 125  DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
            ++I S S D TL +W ++      G   K LYGHS++I  V  S DG +  SGS D T+R
Sbjct: 1082 EIIASGSIDNTLKLWTVS------GECLKTLYGHSNWIFSVAFSPDGKFLASGSHDHTIR 1135

Query: 305  LWDLAAGKTTRRFEDHTKV*QNS*FC 382
            +WD+  G+     + HT +  +  FC
Sbjct: 1136 VWDVETGECIHILQGHTHLVSSVRFC 1161



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 31/94 (32%), Positives = 46/94 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  WV  +A +P   +++ S S D+T+ +W         G   + L GHS  +  + 
Sbjct: 981  LTGHTDWVRCLAFSPN-GEILASGSADQTIRLWN-----PQTGQCLQILSGHSDQVYSIA 1034

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG   +SGS DKT+R WD+  G   +    H
Sbjct: 1035 FSGDGRILISGSTDKTVRFWDVKTGNCLKVCHGH 1068



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/103 (32%), Positives = 47/103 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T KL    +GH  WV  +A +P   +M+ S   D+ + +W +       G   K   GH
Sbjct: 633 KTGKLVAICQGHPNWVRSVAFSPD-GEMLASGGADRLVKLWNVET-----GACIKTYSGH 686

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              +  V  SSDG    SGS D T++LWD   G+       HT
Sbjct: 687 EGEVFSVAFSSDGTKIASGSGDCTVKLWDTHTGQCLNTLSGHT 729



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ--KRLYGHSHFIS 241
            T+ GH G V  ++ +P   +++ S S D T+ VW    + +    P   K LYGH++ I 
Sbjct: 808  TISGHTGGVYSVSFSPT-ENLLASGSADYTVRVWDCENENHQDQSPYSIKTLYGHTNQIF 866

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V     G      S D+T++LWD+ + +  + +  HT
Sbjct: 867  CVSFCPQGETLACVSLDQTVKLWDVRSSQCLKTWSGHT 904



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 28/96 (29%), Positives = 45/96 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  WV  +A +P   D + S S+D+T+ +W +       G   K  + H  ++  V
Sbjct: 724 TLSGHTDWVRSVAFSPT-TDRVASGSQDQTMRIWDVKT-----GDCLKICHEHQGWVRSV 777

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + +G+   SGS D  + LW    G+  +    HT
Sbjct: 778 AFNGNGSLLASGSSDHNINLWKGDTGEYLKTISGHT 813



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 27/78 (34%), Positives = 37/78 (47%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H GWV  +A N     ++ S S D  + +WK   D   Y    K + GH+  +  V  S 
Sbjct: 770 HQGWVRSVAFNGN-GSLLASGSSDHNINLWK--GDTGEY---LKTISGHTGGVYSVSFSP 823

Query: 260 DGNYALSGSWDKTLRLWD 313
             N   SGS D T+R+WD
Sbjct: 824 TENLLASGSADYTVRVWD 841



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 28/95 (29%), Positives = 44/95 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH G V  +A +      I S S D T+ +W     + + G     L GH+ ++  V
Sbjct: 682 TYSGHEGEVFSVAFSSD-GTKIASGSGDCTVKLW-----DTHTGQCLNTLSGHTDWVRSV 735

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S   +   SGS D+T+R+WD+  G   +   +H
Sbjct: 736 AFSPTTDRVASGSQDQTMRIWDVKTGDCLKICHEH 770



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 26/96 (27%), Positives = 48/96 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   +  +  N +   ++ S S D+T+ +W ++      G   + L GH+ ++  +
Sbjct: 939  TLSGHEDQIFAVGFNCQ--GILASGSSDQTIRLWDVSE-----GRCFQILTGHTDWVRCL 991

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S +G    SGS D+T+RLW+   G+  +    H+
Sbjct: 992  AFSPNGEILASGSADQTIRLWNPQTGQCLQILSGHS 1027



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 28/95 (29%), Positives = 45/95 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+  V  IA +     +++S S DKT+  W +       G   K  +GH   +  V 
Sbjct: 1023 LSGHSDQVYSIAFSGD-GRILISGSTDKTVRFWDVKT-----GNCLKVCHGHCDRVFAVD 1076

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +S+     SGS D TL+LW + +G+  +    H+
Sbjct: 1077 FNSNAEIIASGSIDNTLKLWTV-SGECLKTLYGHS 1110



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 27/95 (28%), Positives = 44/95 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   +  ++  P+  + +   S D+T+ +W +   +       K   GH+ +   V
Sbjct: 857  TLYGHTNQIFCVSFCPQ-GETLACVSLDQTVKLWDVRSSQC-----LKTWSGHTDWALPV 910

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                D N A SGS DKT+RLW++  G   +    H
Sbjct: 911  ACYGD-NIA-SGSNDKTIRLWNIYTGDCVKTLSGH 943


>UniRef50_A0DA29 Cluster: Chromosome undetermined scaffold_42, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_42, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2077

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+G +  +  +P    +  S S DK++ +W +       G  ++   GH ++I  + 
Sbjct: 1417 LEGHSGCIQSVKFSPDGATLA-SGSEDKSIRIWDI-----RLGQVKQIFEGHQNWIRSIC 1470

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DGN   SGS DK++R+WDL +G+  +R E H
Sbjct: 1471 FSPDGNILASGSQDKSIRIWDLRSGQERKRLEGH 1504



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 49/94 (52%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +P   + + S S DK + +W L       G+ +K+L GHS  I  V 
Sbjct: 1375 LDGHKLGVYSVCFSPD-GNTLASGSGDKVIRLWSLKT-----GLEKKKLEGHSGCIQSVK 1428

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    SGS DK++R+WD+  G+  + FE H
Sbjct: 1429 FSPDGATLASGSEDKSIRIWDIRLGQVKQIFEGH 1462



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/95 (31%), Positives = 50/95 (52%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +++    GH  W+  I  +P   +++ S S+DK++ +W L       G  +KRL GH  +
Sbjct: 1454 QVKQIFEGHQNWIRSICFSPD-GNILASGSQDKSIRIWDLRS-----GQERKRLEGHRSW 1507

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
            IS V  S DG    SG  D+ + LWD+ + K  ++
Sbjct: 1508 ISTVCFSPDGTTLASGGGDQLICLWDVRSDKNNQK 1542



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 35/103 (33%), Positives = 51/103 (49%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET + R  L GHN +V  +  +P    +  S S D +L +W +       G+ + +L GH
Sbjct: 1325 ETGQQRFLLEGHNDFVQSLCFSPDGATLA-SGSYDCSLRLWDVKS-----GLEKLKLDGH 1378

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               +  V  S DGN   SGS DK +RLW L  G   ++ E H+
Sbjct: 1379 KLGVYSVCFSPDGNTLASGSGDKVIRLWSLKTGLEKKKLEGHS 1421



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/92 (30%), Positives = 48/92 (52%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH G V  I         + S+S DK++I+W +       G   K+L GH+  +S + ++
Sbjct: 1251 GHKGSVYSICFTSD-GKFLASASEDKSIILWDV-----KLGQDMKKLKGHTEKVSTLCIA 1304

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             D +   SGS+D+++RLW++  G+     E H
Sbjct: 1305 PDDSILASGSFDRSIRLWNIETGQQRFLLEGH 1336



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 27/95 (28%), Positives = 47/95 (49%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +G   WV  +  +P    ++ S + D ++ +W     +   G  +  L GH  ++  +  
Sbjct: 1544 QGKINWVFSVCFSPD-GTILASGNGDNSIRLW-----DAKSGQEKNNLEGHRSWVYSICF 1597

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S DG    SGS DK++RLWD+ +G+     E HT+
Sbjct: 1598 SPDGTLLASGSDDKSIRLWDVESGQQKNLLELHTQ 1632



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 31/96 (32%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-HSHFI 238
            +  L GH  WV  I  +P    ++ S S DK++ +W +   +      QK L   H+  I
Sbjct: 1582 KNNLEGHRSWVYSICFSPD-GTLLASGSDDKSIRLWDVESGQ------QKNLLELHTQEI 1634

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
              +  S DGN   SG  DK++ LWDL   K   + E
Sbjct: 1635 YSICFSPDGNTLASGGEDKSILLWDLKLWKQKIKLE 1670



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 32/96 (33%), Positives = 53/96 (55%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GHN  V+QI  +P   ++++SSS DK++ +W +++ ++      K+L   +  IS   
Sbjct: 1792 LEGHNDSVSQINFSPD-SNLLVSSSYDKSIRLWDVSQKQD------KKLQLRA--IS-AC 1841

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            LS DG    +G  DK +RLWDL +G    +   H +
Sbjct: 1842 LSPDGTTLATGCLDKLIRLWDLKSGDQKMKLIGHNQ 1877



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/97 (28%), Positives = 54/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSS-RDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            L G NG V  +  +P    +IL+S   D ++++W +     + G  + +L GH+  +  V
Sbjct: 1669 LEGINGSVLSVCFSPD--GLILASGCGDNSILLWDM-----DSGQQKLKLEGHNERVYSV 1721

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              SS G+   S S D+++RLW +A+G+  ++ E +++
Sbjct: 1722 CFSSFGDILASSSHDQSIRLWRVASGEEIKKIEGNSR 1758



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = +2

Query: 149  DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            DK + +W L       G  + +L GH+  +  V  S DG    SGS+D ++ LWD  +G 
Sbjct: 1855 DKLIRLWDLKS-----GDQKMKLIGHNQRVESVTFSPDGAILASGSFDASIYLWDTKSGN 1909

Query: 329  TTRRFEDHTK 358
               R   H+K
Sbjct: 1910 LKIRINGHSK 1919



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 27/85 (31%), Positives = 42/85 (49%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GHN  V  +  +P    ++ S S D ++ +W     +   G  + R+ GHS  +  + 
Sbjct: 1872 LIGHNQRVESVTFSPDGA-ILASGSFDASIYLW-----DTKSGNLKIRINGHSKSVLSLQ 1925

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAG 325
             S  G    SGS D +LRLWD+ +G
Sbjct: 1926 FSPKGTILASGSLDGSLRLWDVNSG 1950



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 27/91 (29%), Positives = 48/91 (52%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S  LK+R  + GH+  V  +  +PK   ++ S S D +L +W +     N G  + +L G
Sbjct: 1907 SGNLKIR--INGHSKSVLSLQFSPK-GTILASGSLDGSLRLWDV-----NSGSEKLKLRG 1958

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             ++ +  +  SSDG     G+ DK++ +WD+
Sbjct: 1959 LTNQVQILCFSSDGTVVAQGALDKSINMWDI 1989



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 15/49 (30%), Positives = 29/49 (59%)
 Frame = +2

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++ GH   +  +  +SDG +  S S DK++ LWD+  G+  ++ + HT+
Sbjct: 1248 KIIGHKGSVYSICFTSDGKFLASASEDKSIILWDVKLGQDMKKLKGHTE 1296



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GHN  V  +  +  + D++ SSS D+++ +W++   E       K++ G+S     V 
Sbjct: 1711 LEGHNERVYSVCFS-SFGDILASSSHDQSIRLWRVASGEEI-----KKIEGNSR---SVC 1761

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG      SW  ++ +WDL
Sbjct: 1762 FSPDGTLLAFASWSYSISIWDL 1783



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 25/104 (24%), Positives = 47/104 (45%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            E+ + +  L  H   +  I  +P   + + S   DK++++W L   +        +L G 
Sbjct: 1619 ESGQQKNLLELHTQEIYSICFSPD-GNTLASGGEDKSILLWDLKLWKQKI-----KLEGI 1672

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +  +  V  S DG    SG  D ++ LWD+ +G+   + E H +
Sbjct: 1673 NGSVLSVCFSPDGLILASGCGDNSILLWDMDSGQQKLKLEGHNE 1716


>UniRef50_A6S2U0 Cluster: Putative uncharacterized protein; n=1;
            Botryotinia fuckeliana B05.10|Rep: Putative
            uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1065

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 35/103 (33%), Positives = 55/103 (53%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S T  L+ TL GHNG V  +A +     ++ S+S D+T+ +W     ++  G  Q+ L G
Sbjct: 891  SATGTLQQTLEGHNGEVNSVAFSAD-SKLLASASDDRTIKIW-----DSATGTLQQTLEG 944

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            HS  ++ V  S+D     S S D+T+++WD A G   +  E H
Sbjct: 945  HSGGVNSVAFSADSKLLASASRDRTIKIWDAATGTLQQTLEGH 987



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/104 (33%), Positives = 54/104 (51%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S T  L  TL GH+ WV  IA +     ++ S SRD T+ +W     ++  G  Q+ L G
Sbjct: 849  SATDTLLQTLEGHSDWVRSIAFSTD-SKLLASWSRDHTIKIW-----DSATGTLQQTLEG 902

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H+  ++ V  S+D     S S D+T+++WD A G   +  E H+
Sbjct: 903  HNGEVNSVAFSADSKLLASASDDRTIKIWDSATGTLQQTLEGHS 946



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/96 (33%), Positives = 54/96 (56%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+G V  IA +     ++ S+SRD T+ +W     ++  G  Q+ L G+S +++ V
Sbjct: 689 TLEGHSGGVNSIAFSAD-SKLLASASRDHTIKIW-----DSATGTLQQTLEGNSDWVNAV 742

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S+D     S S D+T+++WD A G   +  E+H+
Sbjct: 743 AFSADSKLLASASRDRTIKIWDSATGTLQQTLEEHS 778



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 33/104 (31%), Positives = 53/104 (50%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S T  L+ TL  H+ WV  +A +     ++ S+SRD+T+ +W         G  Q+ L G
Sbjct: 765  SATGTLQQTLEEHSDWVNSVAFSAD-SKLLASASRDRTIKIWNAAT-----GTLQQTLEG 818

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS +++ V  S+D     S S D T+++WD A     +  E H+
Sbjct: 819  HSDWVNSVAFSADSKLLASASDDHTIKIWDSATDTLLQTLEGHS 862


>UniRef50_Q8YTC2 Cluster: Uncharacterized WD repeat-containing protein
            alr2800; n=1; Nostoc sp. PCC 7120|Rep: Uncharacterized WD
            repeat-containing protein alr2800 - Anabaena sp. (strain
            PCC 7120)
          Length = 1258

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 32/87 (36%), Positives = 48/87 (55%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  IA +P    ++ S+S D+T+ +W +     N G       GH+H +S V
Sbjct: 1141 TLTGHTNWVFDIAFSPD-GKILASASHDQTVRIWDV-----NTGKCHHICIGHTHLVSSV 1194

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              S DG    SGS D+T+R+W++  G+
Sbjct: 1195 AFSPDGEVVASGSQDQTVRIWNVKTGE 1221



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 34/96 (35%), Positives = 53/96 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P   + + S+S DKT+ +W + +D    G   + L GH+ ++  V
Sbjct: 721 TLTGHEHEVFSVAFHPD-GETLASASGDKTIKLWDI-QD----GTCLQTLTGHTDWVRCV 774

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DGN   S + D T++LWD++ GK  R  + HT
Sbjct: 775 AFSPDGNTLASSAADHTIKLWDVSQGKCLRTLKSHT 810



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/100 (33%), Positives = 49/100 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL    RGH+ WV  +  +P   +++ S   D+ + +W + RD    G+  K L GH H 
Sbjct: 675 KLLLICRGHSNWVRFVVFSPD-GEILASCGADENVKLWSV-RD----GVCIKTLTGHEHE 728

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  V    DG    S S DKT++LWD+  G   +    HT
Sbjct: 729 VFSVAFHPDGETLASASGDKTIKLWDIQDGTCLQTLTGHT 768



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 29/96 (30%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  +A +P   + + SS+ D T+ +W +++     G   + L  H+ ++  V
Sbjct: 763  TLTGHTDWVRCVAFSPD-GNTLASSAADHTIKLWDVSQ-----GKCLRTLKSHTGWVRSV 816

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S+DG    SGS D+T+++W+   G+  + +  HT
Sbjct: 817  AFSADGQTLASGSGDRTIKIWNYHTGECLKTYIGHT 852



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/97 (32%), Positives = 50/97 (51%)
 Frame = +2

Query: 65   GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            G LRGH+  V     +P   ++I + S D+T+ +W   +     G   K L GH++++ D
Sbjct: 1098 GILRGHSNRVYSAIFSPN-GEIIATCSTDQTVKIWDWQQ-----GKCLKTLTGHTNWVFD 1151

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  S DG    S S D+T+R+WD+  GK       HT
Sbjct: 1152 IAFSPDGKILASASHDQTVRIWDVNTGKCHHICIGHT 1188



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 28/96 (29%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+ H GWV  +A +      + S S D+T+ +W       + G   K   GH++ +  +
Sbjct: 805  TLKSHTGWVRSVAFSAD-GQTLASGSGDRTIKIWNY-----HTGECLKTYIGHTNSVYSI 858

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S D    +SGS D+T++LWD       +    HT
Sbjct: 859  AYSPDSKILVSGSGDRTIKLWDCQTHICIKTLHGHT 894



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 31/96 (32%), Positives = 43/96 (44%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     +   S D+++ +W         G   K  YG++ +   V
Sbjct: 889  TLHGHTNEVCSVAFSPD-GQTLACVSLDQSVRLWNCRT-----GQCLKAWYGNTDWALPV 942

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S D     SGS DKT++LWD   GK     E HT
Sbjct: 943  AFSPDRQILASGSNDKTVKLWDWQTGKYISSLEGHT 978



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 27/93 (29%), Positives = 45/93 (48%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            G+  W   +A +P    ++ S S DKT+ +W     +   G     L GH+ FI  +  S
Sbjct: 934  GNTDWALPVAFSPDR-QILASGSNDKTVKLW-----DWQTGKYISSLEGHTDFIYGIAFS 987

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             D     S S D ++RLW+++ G+  +   +HT
Sbjct: 988  PDSQTLASASTDSSVRLWNISTGQCFQILLEHT 1020



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 28/96 (29%), Positives = 47/96 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   V  IA +P    +++S S D+T+ +W          I  K L+GH++ +  V
Sbjct: 847  TYIGHTNSVYSIAYSPD-SKILVSGSGDRTIKLWDCQTH-----ICIKTLHGHTNEVCSV 900

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG      S D+++RLW+   G+  + +  +T
Sbjct: 901  AFSPDGQTLACVSLDQSVRLWNCRTGQCLKAWYGNT 936



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 27/92 (29%), Positives = 42/92 (45%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H  WV  +  +P+   +I + S D T+ +W ++      G   K L  HS  I  +  S 
Sbjct: 1019 HTDWVYAVVFHPQ-GKIIATGSADCTVKLWNIST-----GQCLKTLSEHSDKILGMAWSP 1072

Query: 260  DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    S S D+++RLWD   G+       H+
Sbjct: 1073 DGQLLASASADQSVRLWDCCTGRCVGILRGHS 1104


>UniRef50_P61964 Cluster: WD repeat-containing protein 5; n=34;
           Bilateria|Rep: WD repeat-containing protein 5 - Homo
           sapiens (Human)
          Length = 334

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 39/117 (33%), Positives = 62/117 (52%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  ++  KP + +     L+ TL GH   V+ +  +P   + + SSS DK + +W     
Sbjct: 20  SSSATQSKP-TPVKPNYALKFTLAGHTKAVSSVKFSPN-GEWLASSSADKLIKIWGAYD- 76

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G  +K + GH   ISDV  SSD N  +S S DKTL++WD+++GK  +  + H+
Sbjct: 77  ----GKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS 129



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/100 (29%), Positives = 55/100 (55%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +    ++++S+S DKTL +W ++      G   K L GHS++
Sbjct: 78  KFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSS-----GKCLKTLKGHSNY 131

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 132 VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHS 171



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L   
Sbjct: 159 KTGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDD 212

Query: 227 SHF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 213 DNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 255


>UniRef50_Q4P9P9 Cluster: Nuclear distribution protein PAC1; n=4;
           Dikarya|Rep: Nuclear distribution protein PAC1 -
           Ustilago maydis (Smut fungus)
          Length = 453

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 33/98 (33%), Positives = 55/98 (56%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+  V+ +   P   D I+S+SRDKT+ +W+ +      G   K L GH+ ++   
Sbjct: 202 TLQGHDHSVSSVRFLPG-DDYIVSASRDKTIKIWEFST-----GFCTKTLQGHAEWVRSA 255

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + S D  + +S S D+T R+WD+++G+T      H  V
Sbjct: 256 IPSDDAKWLVSCSTDQTARVWDVSSGETKVELRGHEHV 293



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/104 (31%), Positives = 51/104 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  +  + K  + +LS S D ++ VW    D  N     K L GH
Sbjct: 152 ETGDFERTLKGHTKAVQDVDFDSK-GNYVLSCSSDLSIKVWDANNDYKNI----KTLQGH 206

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            H +S V      +Y +S S DKT+++W+ + G  T+  + H +
Sbjct: 207 DHSVSSVRFLPGDDYIVSASRDKTIKIWEFSTGFCTKTLQGHAE 250



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 29/74 (39%), Positives = 43/74 (58%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + SRDKT+ +W     ++  G   K L GH +++  +  S +G   LS S DKT+RLW
Sbjct: 331 VATGSRDKTIRIW-----DSISGQCLKTLTGHDNWVRGLAFSPNGKSLLSVSDDKTMRLW 385

Query: 311 DLAAGKTTRRFEDH 352
           DL +G+ TR  E H
Sbjct: 386 DLQSGRCTRTIEAH 399



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +A +P     +LS S DKT+ +W L       G   + +  H HF + +
Sbjct: 353 TLTGHDNWVRGLAFSPN-GKSLLSVSDDKTMRLWDL-----QSGRCTRTIEAHQHFATGI 406



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +2

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           D   S  G +  +GS DKT+R+WD  +G+  +    H
Sbjct: 321 DASASMAGQFVATGSRDKTIRIWDSISGQCLKTLTGH 357


>UniRef50_P49695 Cluster: Probable serine/threonine-protein kinase
           pkwA; n=2; Streptosporangineae|Rep: Probable
           serine/threonine-protein kinase pkwA - Thermomonospora
           curvata
          Length = 742

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 33/96 (34%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  WV  +A +P    ++ S S D T+ +W +   E      +    GH+H++ D+
Sbjct: 496 TLEGHTDWVRAVAFSPDGA-LLASGSDDATVRLWDVAAAEE-----RAVFEGHTHYVLDI 549

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG+   SGS D T RLW++A G      + HT
Sbjct: 550 AFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHT 585



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 34/89 (38%), Positives = 45/89 (50%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R    GH  +V  IA +P    M+ S SRD T  +W +       G     L GH+ ++ 
Sbjct: 536 RAVFEGHTHYVLDIAFSPD-GSMVASGSRDGTARLWNVAT-----GTEHAVLKGHTDYVY 589

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            V  S DG+   SGS D T+RLWD+A GK
Sbjct: 590 AVAFSPDGSMVASGSRDGTIRLWDVATGK 618



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/84 (29%), Positives = 40/84 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH  WV  +A +P    ++ S S D+T+ +W +   E +       L GH+  +  V
Sbjct: 663 TFEGHTDWVRAVAFSPDGA-LLASGSDDRTIRLWDVAAQEEH-----TTLEGHTEPVHSV 716

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
               +G    S S D T+R+W +A
Sbjct: 717 AFHPEGTTLASASEDGTIRIWPIA 740



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 33/103 (32%), Positives = 50/103 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K R  L+     V  +A +P    M++  S D T+ +W +   E  +        GH+
Sbjct: 616 TGKERDVLQAPAENVVSLAFSPD-GSMLVHGS-DSTVHLWDVASGEALHTFE-----GHT 668

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++  V  S DG    SGS D+T+RLWD+AA +     E HT+
Sbjct: 669 DWVRAVAFSPDGALLASGSDDRTIRLWDVAAQEEHTTLEGHTE 711



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V  S  G+    GS DK + +WD+A+G      E HT
Sbjct: 465 VAFSPGGSLLAGGSGDKLIHVWDVASGDELHTLEGHT 501


>UniRef50_Q1D4W8 Cluster: WD domain, G-beta repeat protein; n=1;
            Myxococcus xanthus DK 1622|Rep: WD domain, G-beta repeat
            protein - Myxococcus xanthus (strain DK 1622)
          Length = 1399

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 38/102 (37%), Positives = 53/102 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T K    L GH+GWV   A        ++S+S D+TL VW L       G    RL GH
Sbjct: 855  KTKKELARLEGHDGWVRGCAVTAN--GRLVSASSDRTLRVWNLEA-----GKELMRLEGH 907

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  ++D  +++ G   +S S D+TLR+WDL  GK   R E H
Sbjct: 908  AGPVNDCAVTARGQ-VVSASSDRTLRVWDLETGKELMRLEGH 948



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 36/95 (37%), Positives = 49/95 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+G V      P     ++S+S DKTL VW+L       G    R+ GH  ++   
Sbjct: 534 TLKGHDGPVNGCTVTPS--GWVVSASDDKTLRVWELET-----GKELARMEGHEGWVRSC 586

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  DG   +S S DKTLR+W+L  GK   R E H
Sbjct: 587 AVIPDGR-VVSASDDKTLRVWELETGKELARMEGH 620



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 38/102 (37%), Positives = 51/102 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET K    L GH+G V   A   +    ++S+S D+TL VW L       G    RL GH
Sbjct: 937  ETGKELMRLEGHDGPVWDCAVTAR--GQVVSASSDRTLRVWDLET-----GKELVRLEGH 989

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +   V+++DG   +S S DKTLR+W+   GK   R E H
Sbjct: 990  DGPVLGCVMTADGRL-VSASSDKTLRIWEPTTGKELARLEGH 1030



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 35/102 (34%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    + GH G V   A        ++S+S D TL VW+L       G    R+ GH
Sbjct: 691 ETGKELARMEGHEGPVNGCAVT--VDGRVVSASSDGTLRVWELET-----GKELARMEGH 743

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++   +++DG + LS S DKTLR+W+L  G+   + E H
Sbjct: 744 EEPVNGCAVAADG-WVLSASNDKTLRVWELDTGREVAQLEGH 784



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 35/94 (37%), Positives = 47/94 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH G V   A   +    ++S+S D+TL VW L       G    RL GH   + D  
Sbjct: 904  LEGHAGPVNDCAVTAR--GQVVSASSDRTLRVWDLET-----GKELMRLEGHDGPVWDCA 956

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +++ G   +S S D+TLR+WDL  GK   R E H
Sbjct: 957  VTARGQ-VVSASSDRTLRVWDLETGKELVRLEGH 989



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 35/102 (34%), Positives = 50/102 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    + GH G V   +  P     ++S+S D+ L VW+L       GI   +L GH
Sbjct: 609 ETGKELARMEGHKGPVWGCSVTPD--GRLVSASFDEMLRVWELKT-----GIKLAQLVGH 661

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++   ++ DG   +S S D TLR+W+L  GK   R E H
Sbjct: 662 KGAVNGCAVTVDGR-VVSASSDGTLRVWELETGKELARMEGH 702



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 35/102 (34%), Positives = 51/102 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET K    + GH   V   A        +LS+S DKTL VW+L     + G    +L GH
Sbjct: 732  ETGKELARMEGHEEPVNGCAVAAD--GWVLSASNDKTLRVWEL-----DTGREVAQLEGH 784

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +    ++ DG + +S S DKTLR+W+L   + + R +DH
Sbjct: 785  EGPVKSCAVTEDG-WVVSASDDKTLRVWELETARQSARRQDH 825



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 33/93 (35%), Positives = 47/93 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    + GH GWV   A  P     ++S+S DKTL VW+L       G    R+ GH
Sbjct: 568 ETGKELARMEGHEGWVRSCAVIP--DGRVVSASDDKTLRVWEL-----ETGKELARMEGH 620

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
              +    ++ DG   +S S+D+ LR+W+L  G
Sbjct: 621 KGPVWGCSVTPDGR-LVSASFDEMLRVWELKTG 652



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET K    L GH+G V            ++S+S DKTL +W+ T      G    RL GH
Sbjct: 978  ETGKELVRLEGHDGPVLGCVMTAD--GRLVSASSDKTLRIWEPTT-----GKELARLEGH 1030

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
               + D  +++DG   +S S DKTL +WD+A+G+    F
Sbjct: 1031 RGPVWDCAMTADG-MVISASDDKTLGVWDIASGQRIHTF 1068



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/94 (34%), Positives = 43/94 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH G V   A        ++S+S DKTL VW+L     +      R   H   +    
Sbjct: 781  LEGHEGPVKSCAVTED--GWVVSASDDKTLRVWELETARQS-----ARRQDHKGPVWGCT 833

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +SDG   +S S DKTL++W+L   K   R E H
Sbjct: 834  ATSDGRL-VSASSDKTLKVWELKTKKELARLEGH 866



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + L GH   ++   ++  G + +S S DKTLR+W+L  GK   R E H
Sbjct: 533 RTLKGHDGPVNGCTVTPSG-WVVSASDDKTLRVWELETGKELARMEGH 579


>UniRef50_Q11AA2 Cluster: Serine/threonine protein kinase with WD40
           repeats; n=2; Oscillatoriales|Rep: Serine/threonine
           protein kinase with WD40 repeats - Trichodesmium
           erythraeum (strain IMS101)
          Length = 692

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 37/103 (35%), Positives = 53/103 (51%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L+ TL GH   V  +A +P   + I S S+DKT+ +W +     N G+    LYGH 
Sbjct: 473 TRRLKNTLSGHLQDVLSVAISPD-GNTIASVSKDKTIKLWDI-----NSGLLLYTLYGHL 526

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  V  SSDG    SGS D T++LW+   G+     + H K
Sbjct: 527 DVVQSVAFSSDGKTLASGSNDGTVKLWNWRDGRLLSTLKGHRK 569



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 37/103 (35%), Positives = 52/103 (50%), Gaps = 1/103 (0%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFIS 241
           G L GH+G +  +A +P    ++ S+S D TL +W L TR   N       L GH   + 
Sbjct: 436 GQLSGHDGPIWSVAISPDGRTLV-SASGDSTLKIWNLYTRRLKN------TLSGHLQDVL 488

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QN 370
            V +S DGN   S S DKT++LWD+ +G        H  V Q+
Sbjct: 489 SVAISPDGNTIASVSKDKTIKLWDINSGLLLYTLYGHLDVVQS 531



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI--PQKRLYGHS 229
           +L  TL+GH   V  +A +P     + S S DKT+ +W++  +     I   Q+ L GHS
Sbjct: 559 RLLSTLKGHRKPVWSVAISPD-GKTLASGSWDKTIKLWEINNNSFQRVIRRSQRTLIGHS 617

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  +  S DG    SG +D T++LW +  G      + H+
Sbjct: 618 EKVQSLQFSPDGETLASGDFDGTIKLWQIKTGGLMGTLKGHS 659



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/83 (36%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +      + S S D T+ +W   RD    G     L GH   +  V
Sbjct: 521 TLYGHLDVVQSVAFSSD-GKTLASGSNDGTVKLWNW-RD----GRLLSTLKGHRKPVWSV 574

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
            +S DG    SGSWDKT++LW++
Sbjct: 575 AISPDGKTLASGSWDKTIKLWEI 597



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT 178
           L GTL+GH+ WV  +  +P+   +I S S D T+ VW+ +
Sbjct: 651 LMGTLKGHSAWV-NLTFDPRGKTLI-SGSFDDTIKVWRFS 688


>UniRef50_A0YXI8 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. PCC
           8106|Rep: WD-40 repeat protein - Lyngbya sp. PCC 8106
          Length = 304

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 35/103 (33%), Positives = 57/103 (55%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L+GTL GH G V   + +P+  D++ S   D ++ +WKL ++E   GI    L GH
Sbjct: 130 ETGQLKGTLTGHAGSVKTFSISPR-GDILASDGADNSIRLWKL-QNEELIGI----LEGH 183

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +  + +S DG   +SG  D+T+R+W +   K  R    H+
Sbjct: 184 TGGVLTLTVSPDGETLVSGGKDETIRIWQIRTQKLLRTLSGHS 226



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/90 (31%), Positives = 43/90 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P    +++S+S D  + VW     E         L GH   + +V
Sbjct: 5   TLSGHADGVKSVAVSPD-GKILISASEDGKIKVWNFKTGECLL-----TLGGHPFGVKNV 58

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            +S DG +  +G  D T+++W L  GK  R
Sbjct: 59  AVSPDGEFFATGGGDGTIKIWSLKNGKLLR 88



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 36/89 (40%), Positives = 47/89 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL  TL GH+  V  +  +P     IL+S    +LI  KL RD N  G     L GHS
Sbjct: 215 TQKLLRTLSGHSYAVNSVKISPN--GHILASGGYDSLI--KL-RDLNT-GDLLNLLSGHS 268

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             ++ V  S D    +SGS DKT++LW+L
Sbjct: 269 GAVNTVTFSPDAKILVSGSEDKTIKLWNL 297


>UniRef50_Q54N36 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 399

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/102 (33%), Positives = 56/102 (54%), Gaps = 1/102 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNP-KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           L   L  HN  VT +ATN  +Y   ++S S+D T+ VW +  D+       + L GHS  
Sbjct: 7   LNDCLFEHNYEVTSLATNGIRY---LISGSKDCTVKVWIVESDKPT--TLYRTLIGHSSI 61

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           I DV ++ D  Y +SGSWD  + +WD+ +G+  +  +  +++
Sbjct: 62  IQDVAITQDEKYVISGSWDGNVCIWDIESGQCIKTIKHQSQI 103


>UniRef50_Q0C7G0 Cluster: Putative uncharacterized protein; n=1;
            Aspergillus terreus NIH2624|Rep: Putative uncharacterized
            protein - Aspergillus terreus (strain NIH 2624)
          Length = 1251

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 38/103 (36%), Positives = 50/103 (48%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T  LR +L GH+ WV  IA +     ++ S S+D T+ +W         G P     GHS
Sbjct: 753  TGSLRQSLSGHSDWVRAIAFSSS-GRLLASGSQDSTVKLWDAVT-----GAPLNDFCGHS 806

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              I  V  S  G+  +SGS D TLRLWD+  G   R    HT+
Sbjct: 807  GPICSVDFSPSGDLVVSGSVDCTLRLWDVTTGSLKRTLNGHTQ 849



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 35/98 (35%), Positives = 53/98 (54%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T  L+ TL GH   V  +A +P   ++++S S+DKT+ +W  T      G  ++ L GHS
Sbjct: 837  TGSLKRTLNGHTQPVQAVAFSPN-GEVLVSGSQDKTIKLWATTP-----GSLEQTLEGHS 890

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             ++  +  SS G    SGS D T+R+WD  AG   + F
Sbjct: 891  DWVRAIAFSSCGRLIASGSHDGTVRVWDAGAGAVKQAF 928



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/93 (32%), Positives = 49/93 (52%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH+G +  +  +P   D+++S S D TL +W +T      G  ++ L GH+  +  V  S
Sbjct: 804  GHSGPICSVDFSPS-GDLVVSGSVDCTLRLWDVTT-----GSLKRTLNGHTQPVQAVAFS 857

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +G   +SGS DKT++LW    G   +  E H+
Sbjct: 858  PNGEVLVSGSQDKTIKLWATTPGSLEQTLEGHS 890



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 4/102 (3%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI----PQKRLYGH 226
            LR TL GH   V  +A +P    ++ S S D T  +W ++ +     +    P + + GH
Sbjct: 976  LRTTLAGHIFSVGALAFSPD-SQLLASGSFDSTAKLWDISTEALQSSLIEETPPEVIDGH 1034

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  +  V  S D     SGS DKT++LWD+  G      E H
Sbjct: 1035 SGTVGIVAFSFDKKILASGSIDKTVKLWDVITGSLLYTLEGH 1076



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 31/103 (30%), Positives = 43/103 (41%), Gaps = 5/103 (4%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK-----LTRDENNYGIPQKRLYG 223
            L  TL GH+ WV  IA +     +I S S D T+ VW      + +     G  +  + G
Sbjct: 882  LEQTLEGHSDWVRAIAFS-SCGRLIASGSHDGTVRVWDAGAGAVKQAFTVQGHLRNTVVG 940

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H   +  V  S DG     G+ D T+ LWD+  G        H
Sbjct: 941  HQASVGAVAFSPDGRLLACGTHDSTISLWDITTGALRTTLAGH 983



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 26/87 (29%), Positives = 42/87 (48%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            LR T+ GH   V  +A +P    ++   + D T+ +W +T      G  +  L GH   +
Sbjct: 934  LRNTVVGHQASVGAVAFSPD-GRLLACGTHDSTISLWDITT-----GALRTTLAGHIFSV 987

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLA 319
              +  S D     SGS+D T +LWD++
Sbjct: 988  GALAFSPDSQLLASGSFDSTAKLWDIS 1014



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 31/94 (32%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            GH+G V  +A +  +   IL+S S DKT+ +W +      Y      L GH   I  V  
Sbjct: 1033 GHSGTVGIVAFS--FDKKILASGSIDKTVKLWDVITGSLLY-----TLEGHLDLIWAVEF 1085

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG    SGS D  ++LWD   G      + H+
Sbjct: 1086 SPDGRLLASGSNDGAIKLWDTYNGALQHTLDGHS 1119



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 19/70 (27%), Positives = 32/70 (45%)
 Frame = +2

Query: 146 RDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           R+   ++ +L + EN +G   + L GH+  I  V  S       + S DKT++ WD   G
Sbjct: 695 REPPSLIRRLPKVENLWGTELQTLEGHTGPIGAVAFSPIDQVLATCSHDKTIKFWDTTTG 754

Query: 326 KTTRRFEDHT 355
              +    H+
Sbjct: 755 SLRQSLSGHS 764



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 28/86 (32%), Positives = 39/86 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   +  +  +P    ++ S S D  + +W    D  N G  Q  L GHS  I  V
Sbjct: 1072 TLEGHLDLIWAVEFSPD-GRLLASGSNDGAIKLW----DTYN-GALQHTLDGHSGAIRAV 1125

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAG 325
              S       SGS D T+++W+ A G
Sbjct: 1126 AFSPGCQLLASGSTDNTVKVWNSADG 1151


>UniRef50_UPI000045C045 Cluster: COG2319: FOG: WD40 repeat; n=1;
           Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40
           repeat - Nostoc punctiforme PCC 73102
          Length = 641

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 33/92 (35%), Positives = 49/92 (53%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K+   L GH+  V  +A +P    ++ ++S DKT+ +W+    +         L GHS
Sbjct: 327 TKKVLANLSGHSQAVKSVAFSPD-GQILATASDDKTIKLWQFDTLKEIC-----TLLGHS 380

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H +  V  S DG    SGSWDKT++LWD+  G
Sbjct: 381 HAVKSVAFSPDGQILASGSWDKTIKLWDVNTG 412



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/90 (33%), Positives = 46/90 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +TLK   TL GH+  V  +A +P    ++ S S DKT+ +W +     N G     + GH
Sbjct: 368 DTLKEICTLLGHSHAVKSVAFSPD-GQILASGSWDKTIKLWDV-----NTGTEICTITGH 421

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              ++ V  S  G    S S+D+T+RLW +
Sbjct: 422 QLQVNSVAFSPQGQLLASASYDRTIRLWQI 451



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 31/98 (31%), Positives = 47/98 (47%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL GH   V  +A +P    M+ + S D T+ +W++     N G     L GHS  +
Sbjct: 514 LLSTLSGHAWAVLTVAFSPD-GKMLATGSDDNTIKLWEV-----NTGQLICTLVGHSWSV 567

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  ++DG   LS S DKT++LW ++  +       H
Sbjct: 568 VAVAFTADGETLLSASCDKTVKLWRVSTAEEIVTLSGH 605



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 27/83 (32%), Positives = 42/83 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A      + +LS+S DKT+ +W+++  E         L GH   +S V
Sbjct: 559 TLVGHSWSVVAVAFTAD-GETLLSASCDKTVKLWRVSTAEEIV-----TLSGHVDSVSAV 612

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
            +S       S S D+T++LW L
Sbjct: 613 AVSKVTQLIASASRDRTIKLWQL 635



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 3/51 (5%)
 Frame = +2

Query: 215 LYGHSHFISDV---VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           L GHS  +S V    +S D +   SGS DK ++LWDL   K       H++
Sbjct: 289 LTGHSGTLSSVNALAISPDSHTLASGSDDKNIKLWDLNTKKVLANLSGHSQ 339



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           TL GH   V+ +A + K   +I S+SRD+T+ +W+L   +N+
Sbjct: 601 TLSGHVDSVSAVAVS-KVTQLIASASRDRTIKLWQLVEQDNS 641


>UniRef50_Q7ND80 Cluster: WD-repeat protein; n=5; Cyanobacteria|Rep:
            WD-repeat protein - Gloeobacter violaceus
          Length = 1188

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/87 (36%), Positives = 50/87 (57%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GHN WV  +A +P     + S S D+T+ +W+++      G   + L GHS ++  V
Sbjct: 942  TLSGHNNWVRSVAFSPD-GRTLASGSHDQTVKLWEVSS-----GQCLRTLTGHSSWVWSV 995

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              S DG    SGS+D+T+R+W+ A G+
Sbjct: 996  AFSPDGRTVASGSFDQTVRVWNAATGE 1022



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/95 (33%), Positives = 49/95 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+G+ GW+  +A  P     + S S D+T+ +W +       G   + L GH  ++  V
Sbjct: 858  TLQGNAGWIWSVAFAPD-GQTLASGSLDRTVRIWDVPS-----GRCVRTLTGHGSWVWSV 911

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS+D+T++LWD A G+  R    H
Sbjct: 912  AFSPDGRTLASGSFDQTIKLWDAATGQCLRTLSGH 946



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = +2

Query: 65   GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            GTL GH   V  +A +P    ++ S S D+TL +W++T      G     L GH+  I  
Sbjct: 731  GTLTGHTDQVLSVAFSPD-GGVLASGSHDQTLKLWEVTT-----GTCLTTLTGHTGRIRA 784

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  S DG +  S S D T++LWD A G+  R F  H+
Sbjct: 785  ISFSPDGEWLASSSLDCTVKLWDAATGECLRTFTGHS 821



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 31/96 (32%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  +A +P     + S S D+T+ +W         G   + L GH++++  V
Sbjct: 900  TLTGHGSWVWSVAFSPD-GRTLASGSFDQTIKLWDAAT-----GQCLRTLSGHNNWVRSV 953

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS D+T++LW++++G+  R    H+
Sbjct: 954  AFSPDGRTLASGSHDQTVKLWEVSSGQCLRTLTGHS 989



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + RGH  W++ +A +P    ++ S S D+T+ +W     +   G   + L GH  ++  V
Sbjct: 605 SFRGHTDWISALAFSPD-GSVLASGSEDQTIKLW-----DTATGQCLRTLTGHGGWVYSV 658

Query: 248 VLSSDGNYALSGS-WDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    S S  ++T+RLWD A G+ TR F+  T
Sbjct: 659 AFSPDGTLIASSSPSNETVRLWDAAGGQCTRTFKSRT 695



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 32/87 (36%), Positives = 45/87 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P     ++SSS D+T+ +W     E       + L GH+  +  V
Sbjct: 1068 TLTGHTSQVWSVAFSPD-SRTVVSSSHDQTVRLWDAATGEC-----LRTLTGHTSQVWSV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              S DG   +SGS D+T+RLWD   GK
Sbjct: 1122 AFSPDGRTVISGSQDETIRLWDSHTGK 1148



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/95 (30%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH+G V  ++  P     + S S D+T+ +W         G   + L G++ +I  V
Sbjct: 816  TFTGHSGQVWSVSFAPD-GQTLASGSLDQTVRIWDAAT-----GQCLRTLQGNAGWIWSV 869

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + DG    SGS D+T+R+WD+ +G+  R    H
Sbjct: 870  AFAPDGQTLASGSLDRTVRIWDVPSGRCVRTLTGH 904



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/89 (31%), Positives = 46/89 (51%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G +  +A +PK  +++        + +W++ RD    G  Q    GH+ +IS +  S DG
Sbjct: 569 GGILFVAYSPK-GELLAIGDDSGEVRLWRV-RD----GQQQLSFRGHTDWISALAFSPDG 622

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +   SGS D+T++LWD A G+  R    H
Sbjct: 623 SVLASGSEDQTIKLWDTATGQCLRTLTGH 651



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 31/96 (32%), Positives = 42/96 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV  +A +P     + S S D+T+ VW     E  +      L   S  +  V
Sbjct: 984  TLTGHSSWVWSVAFSPD-GRTVASGSFDQTVRVWNAATGECLH-----TLKVDSSQVWSV 1037

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG     GS +  + LWD A G+  R    HT
Sbjct: 1038 AFSPDGRILAGGSGNYAVWLWDTATGECLRTLTGHT 1073



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 27/96 (28%), Positives = 44/96 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH GWV  +A +P    +  SS  ++T+ +W         G   +     +  +  V
Sbjct: 647 TLTGHGGWVYSVAFSPDGTLIASSSPSNETVRLWDAAG-----GQCTRTFKSRTGRMWSV 701

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG+   + S D+T++LWD+  G+       HT
Sbjct: 702 AFSPDGHTLAAASLDRTVKLWDVRTGERLGTLTGHT 737



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +2

Query: 209  KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + L GH+  +  V  S D    +S S D+T+RLWD A G+  R    HT
Sbjct: 1067 RTLTGHTSQVWSVAFSPDSRTVVSSSHDQTVRLWDAATGECLRTLTGHT 1115


>UniRef50_Q6C0A7 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 367

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 30/97 (30%), Positives = 54/97 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH   +  I+ +P    M+ ++S D+T+ +W   R  +     Q+ L GH+H+++ V
Sbjct: 71  TLRGHRAGINDISWSPD-SKMLATASDDRTIRIWSTHRPSS-----QRILVGHTHYVTCV 124

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  GN  +SGS D+ +R+WD+  G+       H++
Sbjct: 125 KFNYKGNLVVSGSADENVRVWDVLQGRCIMTLAAHSQ 161



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 30/86 (34%), Positives = 45/86 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  +VT +  N K  ++++S S D+ + VW + +     G     L  HS  IS V 
Sbjct: 114 LVGHTHYVTCVKFNYK-GNLVVSGSADENVRVWDVLQ-----GRCIMTLAAHSQPISAVD 167

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            S +G   +SGS D  +R+WD A G+
Sbjct: 168 FSCEGTMIVSGSHDGLIRMWDTATGQ 193


>UniRef50_Q2GT52 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 1011

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 34/96 (35%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ WV  +A +P     + S S D T+ +W         G  Q+ L GHS  +  V
Sbjct: 550 TLKGHSNWVFAVAFSPD-GRTVASGSGDSTIRLWDAAT-----GAHQQTLKGHSGAVYAV 603

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    +GS D T+RLWD A G   +  + H+
Sbjct: 604 AFSPDGRTVATGSGDSTIRLWDAATGAHQQTLKGHS 639



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/96 (34%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V+ +A +P     + + S D T+ +W         G  Q+ L GHS+++  V
Sbjct: 508 TLEGHSSGVSAVAFSPD-GRTVATGSDDDTIRLWDAAT-----GAHQQTLKGHSNWVFAV 561

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS D T+RLWD A G   +  + H+
Sbjct: 562 AFSPDGRTVASGSGDSTIRLWDAATGAHQQTLKGHS 597



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 33/96 (34%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+G V  +A +P     + + S D T+ +W         G  Q+ L GHS  +  V
Sbjct: 592 TLKGHSGAVYAVAFSPD-GRTVATGSGDSTIRLWDAAT-----GAHQQTLKGHSGAVYAV 645

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    +GS+D T+RLWD A G   +  + H+
Sbjct: 646 AFSPDGRTVATGSYDDTIRLWDAATGAHQQTLKGHS 681



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 34/96 (35%), Positives = 47/96 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +P     + S S D+T+ +W         G  Q+ L GHS  +  V
Sbjct: 424 TLEGHSSSVRAVAFSPD-GRTVASGSADETIRLWDAAT-----GAHQQTLKGHSSAVYAV 477

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    +GS D T+RLWD A G   +  E H+
Sbjct: 478 AFSPDGRTVATGSDDSTIRLWDAATGAHQQTLEGHS 513



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/96 (34%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+  V  +A +P     + + S D T+ +W         G  Q+ L GHS  +S V
Sbjct: 466 TLKGHSSAVYAVAFSPD-GRTVATGSDDSTIRLWDAAT-----GAHQQTLEGHSSGVSAV 519

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    +GS D T+RLWD A G   +  + H+
Sbjct: 520 AFSPDGRTVATGSDDDTIRLWDAATGAHQQTLKGHS 555



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = +2

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +G  Q+ L GHS  +  V  S DG    SGS D+T+RLWD A G   +  + H+
Sbjct: 418 WGAHQQTLEGHSSSVRAVAFSPDGRTVASGSADETIRLWDAATGAHQQTLKGHS 471


>UniRef50_A0H1H8 Cluster: WD-40 repeat; n=2; Chloroflexus|Rep: WD-40
           repeat - Chloroflexus aggregans DSM 9485
          Length = 1004

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ETL L+ +L GH G V+ +  +P    +   +  D  + VW +       G    +L G
Sbjct: 438 AETLALQQSLNGHTGDVSALVFSPDGTILASGAQDDPVVRVWNVRN-----GREVLQLQG 492

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H  +I  +  S DG    SGS D+T+R+WD+A G+T      HT
Sbjct: 493 HEDWIRSLAFSPDGRLLASGSADRTIRIWDVARGETLVVLRGHT 536



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 31/91 (34%), Positives = 48/91 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH  W+  +A +P    ++ S S D+T+ +W + R E         L GH+  + +V 
Sbjct: 490 LQGHEDWIRSLAFSPD-GRLLASGSADRTIRIWDVARGETLVV-----LRGHTDLLGNVA 543

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    S S D T+RLWD+A+G+    F
Sbjct: 544 FSPDGRRLASASRDGTVRLWDVASGQQIDTF 574



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 3/104 (2%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVT--QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +ET  ++  LRGH+GWV    +A +P    ++ S+S D ++ +W         G+ +  L
Sbjct: 616 AETGNVQRELRGHDGWVVIRGVAYSPD-GRLLASASLDGSVRLWNPVN-----GVERDVL 669

Query: 218 YGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLAAGKTTRRFE 346
                 +  +  S DG+  LS S     L +WD+A+ +  + F+
Sbjct: 670 RQRGLRLLGLSWSPDGSRILSSSDMGGNLAIWDVASAQIVQSFQ 713


>UniRef50_A0DB07 Cluster: Chromosome undetermined scaffold_436,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_436,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 790

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/103 (30%), Positives = 54/103 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K +  L GH   VT ++ +P    ++ S S D ++ +W +  ++        +LYGH
Sbjct: 207 KTEKQKAQLDGHKSQVTSVSFSPD-GTLLASGSYDYSIRIWDVQTEQQKV-----QLYGH 260

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + ++  V  S DG    SGS D T+RLWD+  G+   + + H+
Sbjct: 261 TGYVQTVCFSPDGKTLASGSCDTTIRLWDVKQGQQKGKLDGHS 303



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 29/103 (28%), Positives = 52/103 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +  L GH   V  +  +P    ++   S D ++ +W +       G+ + +LYGH
Sbjct: 448 KTGQQKAKLYGHKSCVQSVCFSPD-GTILAFGSYDNSIRLWNVKT-----GLYKAKLYGH 501

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  ++ V  S DG    SGS DK++RLWD+   +   + + H+
Sbjct: 502 SSCVNSVYFSPDGTTIASGSDDKSVRLWDIKTLQQKAKLDGHS 544



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 28/100 (28%), Positives = 51/100 (51%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           +  L GH+  V  +  +P     I S S DK++ +W +   +      + +L GHS+ + 
Sbjct: 495 KAKLYGHSSCVNSVYFSPD-GTTIASGSDDKSVRLWDIKTLQQ-----KAKLDGHSYSVK 548

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            V +S +G    SGS D ++RLWD+  G+   + + H+ +
Sbjct: 549 SVCISPNGTTLASGSGDNSIRLWDVKTGQQKGKLDGHSSI 588



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +LYGH++ +  +  S DG    +GS DK++RLWD+  GK+  +   HT
Sbjct: 371 KLYGHTYSVMSICFSLDGTTLATGSVDKSIRLWDVKTGKSQAKLVGHT 418



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/103 (28%), Positives = 51/103 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +TL+ +  L GH+  V  +  +P     + S S D ++ +W +       G  + +L GH
Sbjct: 532 KTLQQKAKLDGHSYSVKSVCISPN-GTTLASGSGDNSIRLWDVKT-----GQQKGKLDGH 585

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  ++ V  S DG    SGS DK++ LWD+   +   + + H+
Sbjct: 586 SSIVTSVCFSPDGITLASGSADKSINLWDVQTEQQKVKLDGHS 628



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/90 (30%), Positives = 48/90 (53%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +G L GH+  VT +  +P     + S S DK++ +W +  ++        +L GH
Sbjct: 574 KTGQQKGKLDGHSSIVTSVCFSPD-GITLASGSADKSINLWDVQTEQQKV-----KLDGH 627

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+ +  V +S +G    S S D ++RLWD+
Sbjct: 628 SNSVKSVCISPNGTTLASVSHDNSIRLWDI 657



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           + + S DK++ +W + TR +      + +L GHS+ I+ V  S DG    SGS D ++RL
Sbjct: 150 LATGSEDKSISLWDVKTRQQ------KAKLGGHSNRITSVCFSPDGTTLASGSSDNSIRL 203

Query: 308 WDLAAGKTTRRFEDH 352
           WD+   K   + + H
Sbjct: 204 WDVKTEKQKAQLDGH 218



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 29/102 (28%), Positives = 47/102 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +L+  L GH   V  I  +      + + S DK++ +W +       G  Q +L GH
Sbjct: 364 KTSQLKIKLYGHTYSVMSICFSLD-GTTLATGSVDKSIRLWDVKT-----GKSQAKLVGH 417

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +  V  S +G    SGS D T+ LWD+  G+   +   H
Sbjct: 418 TSTVYSVYFSPNGTSLASGSQDYTICLWDVKTGQQKAKLYGH 459



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 21/88 (23%), Positives = 39/88 (44%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           V  I  +PK   + L S  D+ + +W L       G    ++  +   ++ V+ S D   
Sbjct: 95  VKSINFSPKTKGVTLVSCSDQIVHIWNLIT-----GKQISKIIVNFQVVNTVIFSPDDTT 149

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +GS DK++ LWD+   +   +   H+
Sbjct: 150 LATGSEDKSISLWDVKTRQQKAKLGGHS 177


>UniRef50_A0CVT5 Cluster: Chromosome undetermined scaffold_299, whole
            genome shotgun sequence; n=12; Paramecium
            tetraurelia|Rep: Chromosome undetermined scaffold_299,
            whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1708

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 34/103 (33%), Positives = 53/103 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T+K   +L GH+ +V  +  +P    +  S S D ++ +W +       GI + RL GH
Sbjct: 1033 KTVKQNKSLNGHDNYVLSVCFSPDGTSLA-SGSADSSICLWDVKT-----GIQKARLVGH 1086

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S ++  V  S DG    SGS DK++ LWD+ A K   +   HT
Sbjct: 1087 SEWVQAVCFSPDGTILASGSDDKSICLWDIQALKQKGQLHGHT 1129



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/103 (29%), Positives = 54/103 (52%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            + LK +G L GH   V+ +  +P     + S S+D ++ +W     +  YG    +L GH
Sbjct: 1117 QALKQKGQLHGHTSSVSSVCFSP-VGYTLASGSQDNSICLWDFNTKQQ-YG----KLEGH 1170

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +++I  ++ S DG+   S  +DK++RLWD+       + E H+
Sbjct: 1171 TNYIQSIMFSPDGDTLASCGFDKSIRLWDVKTRYQKAKLEGHS 1213



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  ++  +  +P   + I S SRD ++ +W         G  Q +L GHS++I  + 
Sbjct: 1499 LIGHTNYIQSLCFSPD-GNRIASGSRDNSINLW-----HGKTGQLQAKLIGHSNWIYSIC 1552

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG+   SGS+D ++ LWD+   +   + E H
Sbjct: 1553 FSLDGSQLASGSYDNSIHLWDVRNRQLKVKLEGH 1586



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 26/97 (26%), Positives = 48/97 (49%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L GH+GW+  ++ +P    ++ S S D+++ +W +   +      + +L GH+  + 
Sbjct: 1206 KAKLEGHSGWIYTLSFSPD-GTILASGSDDRSICLWDVQAKQQ-----KAKLDGHTSTVY 1259

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  S+DG    SGS D  +R WD+  G    +   H
Sbjct: 1260 SVCFSTDGATLASGSADNYIRFWDIKTGLEKAKLVGH 1296



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 30/97 (30%), Positives = 50/97 (51%)
 Frame = +2

Query: 65   GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            G L GH  ++  I  +P   D + S   DK++ +W +   +  Y   + +L GHS +I  
Sbjct: 1165 GKLEGHTNYIQSIMFSPD-GDTLASCGFDKSIRLWDV---KTRY--QKAKLEGHSGWIYT 1218

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  S DG    SGS D+++ LWD+ A +   + + HT
Sbjct: 1219 LSFSPDGTILASGSDDRSICLWDVQAKQQKAKLDGHT 1255



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 1/104 (0%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK-RLYGHSHFI 238
            +  L GH+ WV  +  +P    ++ S S DK++ +W +        + QK +L+GH+  +
Sbjct: 1080 KARLVGHSEWVQAVCFSPD-GTILASGSDDKSICLWDIQ------ALKQKGQLHGHTSSV 1132

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QN 370
            S V  S  G    SGS D ++ LWD    +   + E HT   Q+
Sbjct: 1133 SSVCFSPVGYTLASGSQDNSICLWDFNTKQQYGKLEGHTNYIQS 1176



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L+GH   V  +  +P   D + S S D  + +W +   + N     K L GH +++ 
Sbjct: 997  KAKLQGHAATVYSLCFSPD--DTLASGSGDSYICLWDVKTVKQN-----KSLNGHDNYVL 1049

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             V  S DG    SGS D ++ LWD+  G    R   H++
Sbjct: 1050 SVCFSPDGTSLASGSADSSICLWDVKTGIQKARLVGHSE 1088



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 31/105 (29%), Positives = 49/105 (46%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +G L GH G V  I  +      + S S D ++ +W +       G  + +L GH
Sbjct: 786  KTGQQKGKLDGHTGTVHSICFSLD-GFTLGSGSADTSIRLWDIKT-----GQQKAKLDGH 839

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            +  +  V  S DGN   SGS D ++R WD+  G+   +   H  V
Sbjct: 840  TSIVYSVCFSPDGNILASGSDDNSIRAWDVNTGQQKAKLNGHRAV 884



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/94 (26%), Positives = 47/94 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L  HN +V  +  +P    ++ S S D+++ +W +   +      + +L GH+  +  V 
Sbjct: 916  LGSHNNYVLSLCFSPD-GTILASGSDDRSICLWDVQTKQQ-----KAKLDGHTSTVYSVC 969

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S+DG    SGS D ++ LWD+  G+   + + H
Sbjct: 970  FSTDGATLASGSADNSILLWDIKTGQEKAKLQGH 1003



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T +L+  L GH+ W+  I  +      + S S D ++ +W    D  N  +  K L GH
Sbjct: 1533 KTGQLQAKLIGHSNWIYSICFSLD-GSQLASGSYDNSIHLW----DVRNRQLKVK-LEGH 1586

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            ++  S +  SSD     SGS D ++R+W+L  G+
Sbjct: 1587 NNCCSSLCFSSDSTTLASGSVDNSIRVWNLKTGE 1620



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 25/85 (29%), Positives = 39/85 (45%)
 Frame = +2

Query: 98   QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
            Q+  +P    M+ S S D ++ +W +       GI   +L GHS  +  +  S D     
Sbjct: 1344 QVTISPNQA-MLASGSYDNSISLWDVKT-----GIQNAKLVGHSQQVQSLCFSPDSTLLA 1397

Query: 278  SGSWDKTLRLWDLAAGKTTRRFEDH 352
            SGS DK + LWD+   +   +F  H
Sbjct: 1398 SGSDDKQIFLWDVQIRQQKAKFYGH 1422



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/94 (27%), Positives = 43/94 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+  V  +  +P    ++ S S DK + +W +   +      + + YGH   +  V 
Sbjct: 1377 LVGHSQQVQSLCFSPD-STLLASGSDDKQIFLWDVQIRQQ-----KAKFYGHVSTVYSVC 1430

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG+  LSGS D +  LWD+   +     + H
Sbjct: 1431 FSPDGSTLLSGSKDYSFYLWDVKTSQQRATLDCH 1464



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 18/72 (25%), Positives = 37/72 (51%)
 Frame = +2

Query: 140  SSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
            S+ D  + +W +  ++ N      +L  H++++  +  S DG    SGS D+++ LWD+ 
Sbjct: 896  SNEDNFIRLWDIKAEQEN-----AQLGSHNNYVLSLCFSPDGTILASGSDDRSICLWDVQ 950

Query: 320  AGKTTRRFEDHT 355
              +   + + HT
Sbjct: 951  TKQQKAKLDGHT 962



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = +2

Query: 149  DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            D ++++W + +          +L GH+++I  +  S DGN   SGS D ++ LW    G+
Sbjct: 1482 DGSILLWNVIQSRQT-----AKLIGHTNYIQSLCFSPDGNRIASGSRDNSINLWHGKTGQ 1536

Query: 329  TTRRFEDHT 355
               +   H+
Sbjct: 1537 LQAKLIGHS 1545



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLT 178
            ASG +  +  F  +   L+ +  L GH   +  ++ +P    MIL+S S D T+ +W + 
Sbjct: 1271 ASGSADNYIRFWDIKTGLE-KAKLVGHANTLYSVSFSPDA--MILASGSADNTIRLWNVQ 1327

Query: 179  RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +     +  +R   H      V +S +     SGS+D ++ LWD+  G    +   H++
Sbjct: 1328 SEYEKQNLDARRERCHQ-----VTISPNQAMLASGSYDNSISLWDVKTGIQNAKLVGHSQ 1382



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++ GH   +  V  S DG+   SGS D ++RLW++  G+   + + HT
Sbjct: 751 KIDGHDDKVLSVYFSPDGSTLGSGSADHSIRLWNVKTGQQKGKLDGHT 798



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 23/85 (27%), Positives = 38/85 (44%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L GH   V  +  +     +  S S D  +  W +       G+ + +L GH++ + 
Sbjct: 1248 KAKLDGHTSTVYSVCFSTDGATLA-SGSADNYIRFWDIKT-----GLEKAKLVGHANTLY 1301

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDL 316
             V  S D     SGS D T+RLW++
Sbjct: 1302 SVSFSPDAMILASGSADNTIRLWNV 1326


>UniRef50_UPI000038C5C2 Cluster: COG2319: FOG: WD40 repeat; n=1;
           Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40
           repeat - Nostoc punctiforme PCC 73102
          Length = 581

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 39/102 (38%), Positives = 48/102 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   TLRGH   V  +A  P     + S S D TL +W L       G     L GH
Sbjct: 370 ETGKAISTLRGHTDSVNAVAIIPDRQTAV-SGSADTTLKLWDLQT-----GNVISTLSGH 423

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++ V ++ DG  A+SGS D TL+LWDL  GK       H
Sbjct: 424 KDSVTAVAITPDGKKAVSGSADTTLKLWDLQTGKAISTLSGH 465



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 36/105 (34%), Positives = 50/105 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL GH   VT +A  P     + S S D TL +W L  ++         L GH
Sbjct: 454 QTGKAISTLSGHKDSVTAVAITPDGKKAV-SGSADTTLKLWDLQTEK-----AISTLSGH 507

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
              ++ V ++ DG  A+S S D TL+LWDL  GK    F   + +
Sbjct: 508 KDSVTAVAITPDGQKAVSSSTDTTLKLWDLETGKVISTFTGESSI 552



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 37/103 (35%), Positives = 46/103 (44%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   TLRGH G V  +A  P   D   + S    L +W L       G     L GH
Sbjct: 288 ETRRETFTLRGHRGLVNAVAITP---DGKKAVSVSNNLKLWNLKT-----GWQISTLTGH 339

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              I+ V ++ DG  A+S S D  L+LWDL  GK       HT
Sbjct: 340 KDSINAVAITPDGQKAVSASSDTNLKLWDLETGKAISTLRGHT 382



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + L GH   ++ V ++SDG  A+S S D TL++WDL  GK T     H
Sbjct: 160 RTLTGHKASVNVVAITSDGQTAVSTSDDNTLKVWDLQTGKETFTLSGH 207



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 31/90 (34%), Positives = 43/90 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL GH   V  +A  P    +I  S+  K   +W L       G     L GH
Sbjct: 196 QTGKETFTLSGHQASVNAVAITPDGQTIISVSNNLK---LWSLKT-----GKEISTLTGH 247

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++ I+ V ++ DG  A+S S D TL+LW L
Sbjct: 248 NNSINSVAITPDGQTAVSASSDNTLKLWTL 277


>UniRef50_Q1J328 Cluster: WD-40 repeat precursor; n=1; Deinococcus
           geothermalis DSM 11300|Rep: WD-40 repeat precursor -
           Deinococcus geothermalis (strain DSM 11300)
          Length = 335

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 32/102 (31%), Positives = 54/102 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L G+LRGH   VT +A +P    ++ S+SRD+T  +W +        +P + L GH+
Sbjct: 167 TGRLLGSLRGHTDVVTGVAFSPD-GRLLASASRDQTARLWDVATR-----LPTRTLTGHT 220

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +S +  S DG    + SWD ++++W +  G+       HT
Sbjct: 221 DVVSALAFSPDGTLLATVSWDASVKVWTVPEGRLLHTLRGHT 262



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 30/96 (31%), Positives = 46/96 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V+ +A +P    ++ + S D ++ VW +       G     L GH+  +  V
Sbjct: 215 TLTGHTDVVSALAFSPD-GTLLATVSWDASVKVWTVPE-----GRLLHTLRGHTAPVETV 268

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SG  D+ +RLW++A G+  R    HT
Sbjct: 269 AFSPDGRTLASGGQDREVRLWEMATGRLARTLSGHT 304



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 34/108 (31%), Positives = 47/108 (43%), Gaps = 4/108 (3%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG-- 223
           T +LR TL     +VT +A +P    +   S  +    V         + +P  RL G  
Sbjct: 117 TGQLRRTLELGTYYVTAVAFSPDGTRLATGSGDNSA--VSSSANSVKLWDVPTGRLLGSL 174

Query: 224 --HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             H+  ++ V  S DG    S S D+T RLWD+A    TR    HT V
Sbjct: 175 RGHTDVVTGVAFSPDGRLLASASRDQTARLWDVATRLPTRTLTGHTDV 222



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TLRGH   V  +A +P     + S  +D+ + +W++       G   + L GH+  
Sbjct: 253 RLLHTLRGHTAPVETVAFSPD-GRTLASGGQDREVRLWEMAT-----GRLARTLSGHTDT 306

Query: 236 ISDVVLSSDGNY-ALSGSWDKTLRLW 310
           ++ +  S +G + A SGS D+++RLW
Sbjct: 307 VNSLAFSPNGQWLASSGSRDRSVRLW 332


>UniRef50_A7BZD6 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Beggiatoa sp. PS|Rep: Serine/Threonine
           protein kinase with WD40 repeats - Beggiatoa sp. PS
          Length = 363

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 4/98 (4%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN----NYGIPQKRLYG 223
           KL  TLRGH  WV  +A +P    ++ S S D T+ +W +   +       G  QK   G
Sbjct: 74  KLLYTLRGHRDWVNSVAVSPD-EHILASGSEDNTIKLWDINTGKILRTFKKGWWQK---G 129

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           H   +  V+ S DG++ +SGS D T++ W+L  GK  R
Sbjct: 130 HEGPVRTVIFSPDGHFFVSGSDDNTIKFWELKTGKVRR 167



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/94 (34%), Positives = 45/94 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL+ H   VT +A +P     + S S D T+ +W L+      G  +  L GH
Sbjct: 239 DTAKEIETLKKHGNAVTTLAFSPD-GSTLASGSEDDTIKLWDLST-----GKQRCTLVGH 292

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            H +  VV   DG    S S D T++ WD+  GK
Sbjct: 293 EHSVFSVVFHPDGQTLTSASGDDTIKHWDIETGK 326



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 3/71 (4%)
 Frame = +2

Query: 143 SRDKTLIVWKLTRDENNYGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +R ++ +  K    +    +P+K LY   GH  +++ V +S D +   SGS D T++LWD
Sbjct: 52  NRSESHLSLKADERKTAQSLPKKLLYTLRGHRDWVNSVAVSPDEHILASGSEDNTIKLWD 111

Query: 314 LAAGKTTRRFE 346
           +  GK  R F+
Sbjct: 112 INTGKILRTFK 122



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 28/87 (32%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K R TL GH   V  +  +P     + S+S D T+  W +   +  Y      LYGH 
Sbjct: 282 TGKQRCTLVGHEHSVFSVVFHPD-GQTLTSASGDDTIKHWDIETGKEIY-----TLYGHD 335

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             ++ +  S +G   +S S DKT++LW
Sbjct: 336 CTVNSIAFSPNGRTLVSASNDKTIKLW 362



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 23/102 (22%), Positives = 45/102 (44%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K+R  L G+  WV  +A +P   D  + +S  +T+ +W++   +  + +  K     
Sbjct: 161 KTGKVRRILVGNGLWVRALAFSP---DGRILASESETIKLWEVNTGKTLFTLNGK----- 212

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               + +  S DG    SG  +  + LW++   K     + H
Sbjct: 213 ----NTIAFSPDGRILASGGANNAITLWEVDTAKEIETLKKH 250


>UniRef50_A7BLC5 Cluster: WD-40 repeat protein; n=2; Bacteria|Rep:
           WD-40 repeat protein - Beggiatoa sp. SS
          Length = 175

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 34/101 (33%), Positives = 51/101 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL  TL GH   V  +A +P     + S S D ++ VW + R +  + + Q     H+
Sbjct: 52  TGKLLQTLTGHQKDVLSVAFSPD-GKTLASGSADTSIKVWDIERGKTQHTLKQ-----HN 105

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++  V+ S DG Y  S S+D T+R WD  AGK  +    H
Sbjct: 106 NWVLSVIFSPDGRYITSSSYDHTIRFWDREAGKMLQTLTGH 146



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 30/99 (30%), Positives = 48/99 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH   +  ++ +P     + S S D T+ +W++     N G   + L GH   
Sbjct: 12  KIVHTLTGHQNIINSVSFSPD-GTRLASGSADNTIKLWEV-----NTGKLLQTLTGHQKD 65

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V  S DG    SGS D ++++WD+  GKT    + H
Sbjct: 66  VLSVAFSPDGKTLASGSADTSIKVWDIERGKTQHTLKQH 104



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 28/85 (32%), Positives = 42/85 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K + TL+ HN WV  +  +P     I SSS D T+  W     +   G   + L GH + 
Sbjct: 96  KTQHTLKQHNNWVLSVIFSPD-GRYITSSSYDHTIRFW-----DREAGKMLQTLTGHENH 149

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLW 310
           ++ +  S DG    SGS D T+++W
Sbjct: 150 VNSIAFSPDGRLLASGSRDLTIKIW 174



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           L GH + I+ V  S DG    SGS D T++LW++  GK  +    H K
Sbjct: 17  LTGHQNIINSVSFSPDGTRLASGSADNTIKLWEVNTGKLLQTLTGHQK 64


>UniRef50_A0YPZ3 Cluster: WD-40 repeat protein; n=2; Lyngbya sp. PCC
           8106|Rep: WD-40 repeat protein - Lyngbya sp. PCC 8106
          Length = 1218

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 37/95 (38%), Positives = 50/95 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  +A +P   +MI S+S D T+ +WK        GI  K L GH   ++ V
Sbjct: 598 TLQGHEDSVIGVAFSPN-GEMIASASFDNTVKLWKPE------GILVKTLEGHEDGVNGV 650

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    SGSWDKT++LW L  G   +  + H
Sbjct: 651 AFSRDGEMIASGSWDKTVKLWKL-DGTLVKTLQGH 684



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 35/95 (36%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P   DMI S+S D T+ +WKL       G   K L GH   +  V
Sbjct: 802  TLSGHEYSVFGVAFSPN-GDMIASASGDNTVKLWKLD------GTLVKTLQGHEDGVFGV 854

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S +G+   S S D T++LW L  G      E H
Sbjct: 855  AFSPNGDMIASASDDNTVKLWKL-DGTEVATLEGH 888



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +A +P   DMI ++S D T+ +W+        G   K L GH + +  V
Sbjct: 761  TLQGHENLVYGVAFSPN-GDMIATASADNTVKLWEPD------GTLVKTLSGHEYSVFGV 813

Query: 248  VLSSDGNYALSGSWDKTLRLWDL--AAGKTTRRFED 349
              S +G+   S S D T++LW L     KT +  ED
Sbjct: 814  AFSPNGDMIASASGDNTVKLWKLDGTLVKTLQGHED 849



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/81 (37%), Positives = 41/81 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  +A +P   DMI S+S D T+ +WK        G   K L GH + +  V
Sbjct: 884  TLEGHENTVIGVAFSPN-GDMIASASEDNTVKLWKPD------GTLVKTLEGHENGVYAV 936

Query: 248  VLSSDGNYALSGSWDKTLRLW 310
              S +G+   S S D T++LW
Sbjct: 937  AFSPNGDMIASASDDNTVKLW 957



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 29/82 (35%), Positives = 43/82 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A + +  DMI S+S DKT+ +WK        G   K L GH + +  V
Sbjct: 720 TLSGHENEVRGVAFS-RDGDMIASASLDKTVKLWKPD------GTLVKTLQGHENLVYGV 772

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
             S +G+   + S D T++LW+
Sbjct: 773 AFSPNGDMIATASADNTVKLWE 794



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 30/81 (37%), Positives = 43/81 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH G V  +A +PK  DMI ++    T+ +W+        G   K L GH + +  V
Sbjct: 680 TLQGHGGSVFDVAFSPK-GDMIATAGH-MTVKLWEPD------GTLVKTLSGHENEVRGV 731

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             S DG+   S S DKT++LW
Sbjct: 732 AFSRDGDMIASASLDKTVKLW 752



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 30/97 (30%), Positives = 44/97 (45%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           + ++ GH   V  +A +P   DMI S S D T+ +WK        G   + L GH   + 
Sbjct: 555 QNSINGHESGVIAVAFSPN-GDMIASGSADNTVKLWKPD------GTLVQTLQGHEDSVI 607

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            V  S +G    S S+D T++LW    G   +  E H
Sbjct: 608 GVAFSPNGEMIASASFDNTVKLWK-PEGILVKTLEGH 643


>UniRef50_A0DL78 Cluster: Chromosome undetermined scaffold_55, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_55, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2519

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMIL-SSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +T K  G L+GH+ +VT +  +P    M+L S S+DK +  W +T  + +Y +      G
Sbjct: 2137 KTFKQIGYLQGHSHFVTSLVFSPD--GMVLYSGSQDKMIRQWNVTATKQDYVLD-----G 2189

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            H +++S +  S DG    SGS D +++LW++  G    R E HT++
Sbjct: 2190 HLNYVSSLSFSPDGEMLASGSRDCSVQLWNVQEGTLICRLEGHTEM 2235



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 53   LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHS 229
            L+   TL GH   V  ++   +   ++ S S D+++ +W + T  +  Y      L GHS
Sbjct: 2097 LRQLSTLEGHGSNVNSLSFT-RNGQILASGSDDQSVRLWDVKTFKQIGY------LQGHS 2149

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            HF++ +V S DG    SGS DK +R W++ A K     + H
Sbjct: 2150 HFVTSLVFSPDGMVLYSGSQDKMIRQWNVTATKQDYVLDGH 2190



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/96 (28%), Positives = 45/96 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  ++ +     ++ S S DKT+ +W +       G     L GH   ++ V+
Sbjct: 1936 LEGHTDMVRYVSISNDN-QILASGSNDKTIRLWSIKT-----GKQMDVLEGHDESVTCVI 1989

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S D N  +SG  D T+R+W++ + +     E H K
Sbjct: 1990 FSQDSNILVSGGNDNTVRIWNIKSKQILAVLEGHQK 2025



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH  +V  IA       +I S   D  +I+W     +       + L GH+  +  V +
Sbjct: 1895 QGHKDYVKSIAITSDGSTLI-SGGEDNIIILWNAKTCQQI-----QILEGHTDMVRYVSI 1948

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D     SGS DKT+RLW +  GK     E H
Sbjct: 1949 SNDNQILASGSNDKTIRLWSIKTGKQMDVLEGH 1981



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 25/81 (30%), Positives = 42/81 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  +V+ ++ +P   +M+ S SRD ++ +W +       G    RL GH+  +  V+
Sbjct: 2187 LDGHLNYVSSLSFSPD-GEMLASGSRDCSVQLWNVQE-----GTLICRLEGHTEMVWCVL 2240

Query: 251  LSSDGNYALSGSWDKTLRLWD 313
             S       SG  D+T+R+WD
Sbjct: 2241 FSPTKMILASGGDDRTIRIWD 2261



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 25/94 (26%), Positives = 46/94 (48%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET +    ++ H G V  +       D+++S S D T+  + L +++    +    + GH
Sbjct: 2348 ETKQKEHQIKIHRGSVNSLKL---VEDILISGSSDHTIKTYNL-KEQREISV----ISGH 2399

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
             + IS + +S D    +SGS D ++ +WDL   K
Sbjct: 2400 QNTISSLAVSPDCKMLISGSDDLSIGIWDLTTQK 2433



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GH  ++  + ++SDG+  +SG  D  + LW+    +  +  E HT
Sbjct: 1896 GHKDYVKSIAITSDGSTLISGGEDNIIILWNAKTCQQIQILEGHT 1940



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 23/105 (21%), Positives = 49/105 (46%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T K    L GH+  VT +  +    ++++S   D T+ +W + + +    +    L GH
Sbjct: 1970 KTGKQMDVLEGHDESVTCVIFSQD-SNILVSGGNDNTVRIWNI-KSKQILAV----LEGH 2023

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I+ ++L  +    +S   DK + +WD+A        ++ ++V
Sbjct: 2024 QKAITSLLLYENSQKLISSGQDKKIIMWDVAKRSQCEVLQNESEV 2068



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +2

Query: 125  DMILSSS-RDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            + +LSS  +D  +++W +             L GH   ++ +  + +G    SGS D+++
Sbjct: 2077 EQLLSSGYKDGRIVMWDIKELRQ-----LSTLEGHGSNVNSLSFTRNGQILASGSDDQSV 2131

Query: 302  RLWDLAAGKTTRRFEDHT 355
            RLWD+   K     + H+
Sbjct: 2132 RLWDVKTFKQIGYLQGHS 2149


>UniRef50_Q8YSC0 Cluster: All3169 protein; n=2; Nostocaceae|Rep:
           All3169 protein - Anabaena sp. (strain PCC 7120)
          Length = 559

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/101 (31%), Positives = 53/101 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL     GH+  VT ++ +P+  +++ ++S DKT+ +W L      +      L GH+
Sbjct: 300 TQKLLACFSGHSQAVTSVSFSPQ-GEILATASDDKTIKLWHLPTSSEVF-----TLNGHT 353

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + +  V  S +G    SGSWDK ++LWD+  GK     + H
Sbjct: 354 NPVKSVSFSPNGQILASGSWDKQVKLWDVTTGKEIYALKAH 394



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/95 (29%), Positives = 54/95 (56%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ H   V+ +A +P+  +++ S+S D+T+ +W++T++   Y +  K L GH+  +  + 
Sbjct: 391 LKAHQLQVSAVAFSPQ-GEILASASFDRTIRLWQITQNHPRYTLI-KTLSGHTRAVLAIA 448

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG    +GS D T++LWD+  G+       H+
Sbjct: 449 FSPDGKILATGSDDNTIKLWDINTGQLIATLLGHS 483



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 28/84 (33%), Positives = 43/84 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA +P    ++ + S D T+ +W +     N G     L GHS  +  V
Sbjct: 436 TLSGHTRAVLAIAFSPD-GKILATGSDDNTIKLWDI-----NTGQLIATLLGHSWSVVAV 489

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
             ++D    +S SWDKT++LW ++
Sbjct: 490 TFTADNKTLISASWDKTIKLWKVS 513



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 27/89 (30%), Positives = 41/89 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  TL GH+ W     T       ++S+S DKT+ +WK++  E         L  H 
Sbjct: 472 TGQLIATLLGHS-WSVVAVTFTADNKTLISASWDKTIKLWKVSTTEEIV-----TLASHL 525

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             +  V ++       S S DKT++LW L
Sbjct: 526 DSVCAVAVNPVTQVIASSSRDKTIKLWQL 554



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN 190
           TL  H   V  +A NP    +I SSSRDKT+ +W+L   +N
Sbjct: 520 TLASHLDSVCAVAVNP-VTQVIASSSRDKTIKLWQLVIQQN 559



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 25/96 (26%), Positives = 40/96 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL G++     +A +P   + + S   DK + +W+L   +           GHS  ++ V
Sbjct: 266 TLTGYS--TNSLAISPD-GNKLASGGDDKIIRLWELNTQKL-----LACFSGHSQAVTSV 317

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S  G    + S DKT++LW L           HT
Sbjct: 318 SFSPQGEILATASDDKTIKLWHLPTSSEVFTLNGHT 353



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +2

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + + +S DGN   SG  DK +RLW+L   K    F  H++
Sbjct: 273 NSLAISPDGNKLASGGDDKIIRLWELNTQKLLACFSGHSQ 312


>UniRef50_Q5EUI2 Cluster: WD-repeat protein; n=1; Gemmata sp.
           Wa1-1|Rep: WD-repeat protein - Gemmata sp. Wa1-1
          Length = 293

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 33/98 (33%), Positives = 49/98 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L+  L GH  WV  +   P     + +   D T+ VW L       G    +L GH+
Sbjct: 130 TGRLQKVLEGHTSWVGSVVLTPDSTQAVTAGG-DNTIRVWDLQS-----GKEVAQLKGHA 183

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             I  + L++DG   +SG+ DKT R WDL +GK  +R+
Sbjct: 184 VAIRGLALTADGKTLISGASDKTCRAWDLKSGKEVKRY 221



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH G    IA  P    ++ S S D ++ +W  T      G  QK L GH+ ++  V
Sbjct: 94  TFAGHTGATAAIAVTPNGKTLV-SVSNDNSVRLWDATT-----GRLQKVLEGHTSWVGSV 147

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           VL+ D   A++   D T+R+WDL +GK   + + H
Sbjct: 148 VLTPDSTQAVTAGGDNTIRVWDLQSGKEVAQLKGH 182



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GH+   + + ++ +G   +S S D ++RLWD   G+  +  E HT
Sbjct: 97  GHTGATAAIAVTPNGKTLVSVSNDNSVRLWDATTGRLQKVLEGHT 141


>UniRef50_Q10YD2 Cluster: Serine/threonine protein kinase with WD40
           repeats; n=4; Cyanobacteria|Rep: Serine/threonine
           protein kinase with WD40 repeats - Trichodesmium
           erythraeum (strain IMS101)
          Length = 664

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/87 (36%), Positives = 47/87 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P    ++ S SRDKT+ +W +T+ +  +      L GH + +S V
Sbjct: 373 TLTGHFDSVNSVAFSPDN-QILASGSRDKTIEIWDMTKGKRWF-----TLTGHGNSVSSV 426

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
             S D     SGS DKT+ +WD+  GK
Sbjct: 427 AFSPDNQMLASGSRDKTIEIWDMKKGK 453



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 29/96 (30%), Positives = 46/96 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +A +P    M+ S  RD+ + +W L +    +      L GH   +  V
Sbjct: 457 TLLGHSDWVDTVAFSPDN-QMLASGGRDRAIEIWNLQKARRWF-----TLAGHQDRVYTV 510

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + DG    SG  D+T+++WDL   K     + H+
Sbjct: 511 AFNKDGGILASGGRDQTIKIWDLQKAKELFSIQGHS 546



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 31/97 (31%), Positives = 47/97 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A N K   ++ S  RD+T+ +W L + +  + I      GHS ++  +
Sbjct: 499 TLAGHQDRVYTVAFN-KDGGILASGGRDQTIKIWDLQKAKELFSIQ-----GHSDWVRSL 552

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    SGS D T++LW +  G+       H K
Sbjct: 553 SFSPDGGVLGSGSRDGTVKLWQVYGGELISTPIQHLK 589



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           L GHS  +  VV S DG    SGS DKT+++W +
Sbjct: 630 LNGHSSDVFSVVFSQDGRSLASGSNDKTIKIWQV 663


>UniRef50_A1BER4 Cluster: WD-40 repeat protein; n=1; Chlorobium
            phaeobacteroides DSM 266|Rep: WD-40 repeat protein -
            Chlorobium phaeobacteroides (strain DSM 266)
          Length = 1868

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 36/96 (37%), Positives = 46/96 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ W+   A +      ILS S DKTL +W     +   G     L GHS  +   
Sbjct: 1355 TLTGHSDWIRTCALSHDNK-YILSGSSDKTLKLW-----DAESGSCISTLTGHSGAVVSC 1408

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS+D TL+LWD  +G        H+
Sbjct: 1409 ALSHDNKYILSGSYDNTLKLWDAESGSCISTLTGHS 1444



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 36/96 (37%), Positives = 46/96 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ W+   A +      ILS S DKTL +W     +   G     L GHS  +   
Sbjct: 1481 TLTGHSDWIRTCALSHDNK-YILSGSSDKTLKLW-----DAESGSCISTLTGHSGAVVSC 1534

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS+D TL+LWD  +G        H+
Sbjct: 1535 ALSHDNKYILSGSYDNTLKLWDAESGSCISTLTGHS 1570



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 39/96 (40%), Positives = 47/96 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V   A +      ILS S DKTL +W     +   G     L GHS +I   
Sbjct: 1313 TLTGHSGAVFSCALSHDNK-YILSGSSDKTLKLW-----DAESGSCISTLTGHSDWIRTC 1366

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS DKTL+LWD  +G        H+
Sbjct: 1367 ALSHDNKYILSGSSDKTLKLWDAESGSCISTLTGHS 1402



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 38/96 (39%), Positives = 46/96 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V   A +      ILS S D TL +W     +   G     L GHS +I   
Sbjct: 1439 TLTGHSGAVVSCALSHDNK-YILSGSDDNTLKLW-----DAESGSCISTLTGHSDWIRTC 1492

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS DKTL+LWD  +G        H+
Sbjct: 1493 ALSHDNKYILSGSSDKTLKLWDAESGSCISTLTGHS 1528



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 36/86 (41%), Positives = 44/86 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V   A +      ILS S DKTL +W     +   G     L GHS  +   
Sbjct: 1733 TLTGHSGAVFSCALSHDNK-YILSGSSDKTLKLW-----DAESGSCISTLTGHSGAVFSC 1786

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAG 325
             LS D  Y LSGS+D TL+LWD  +G
Sbjct: 1787 ALSHDNKYILSGSYDNTLKLWDAESG 1812



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V   A +      ILS S D TL +W     +   G     L GHS  +   
Sbjct: 1523 TLTGHSGAVVSCALSHDNK-YILSGSYDNTLKLW-----DAESGSCISTLTGHSGAVVSC 1576

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS+D TL+LWD  +G        H+
Sbjct: 1577 ALSHDNKYILSGSYDNTLKLWDAESGSCISTLTGHS 1612



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V   A +      ILS S D TL +W     +   G     L GHS  +   
Sbjct: 1565 TLTGHSGAVVSCALSHDNK-YILSGSYDNTLKLW-----DAESGSCISTLTGHSGAVVSC 1618

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS+D TL+LWD  +G        H+
Sbjct: 1619 ALSHDNKYILSGSYDNTLKLWDAESGSCISTLTGHS 1654



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 37/96 (38%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+G V   A +      ILS S D TL +W     +   G     L GHS +I   
Sbjct: 1607 TLTGHSGAVVSCALSHDNK-YILSGSYDNTLKLW-----DAESGSCISTLTGHSDWIRTC 1660

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS D TL+LWD  +G        H+
Sbjct: 1661 ALSHDNKYILSGSDDNTLKLWDAESGSCISTLTGHS 1696



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 36/93 (38%), Positives = 44/93 (47%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH+G V   A +      ILS S D TL +W     +   G     L GHS +I    LS
Sbjct: 1232 GHSGAVFSCALSHDNK-YILSGSDDNTLKLW-----DAESGSCISTLTGHSDWIRTCALS 1285

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             D  Y LSGS DKTL+LWD  +G        H+
Sbjct: 1286 HDNKYILSGSSDKTLKLWDAESGSCISTLTGHS 1318



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  +   A +      ILS S D TL +W     +   G     L GHS  +   
Sbjct: 1691 TLTGHSDLIRTCALSHDNK-YILSGSSDNTLKLW-----DAESGSCISTLTGHSGAVFSC 1744

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             LS D  Y LSGS DKTL+LWD  +G        H+
Sbjct: 1745 ALSHDNKYILSGSSDKTLKLWDAESGSCISTLTGHS 1780


>UniRef50_Q550I6 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 730

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/107 (29%), Positives = 57/107 (53%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  +  GH G ++++  NP + ++I+S S+D T+  W +       G+  K L  H 
Sbjct: 548 TGQLVKSFSGHTGSISKVIFNP-HGNLIISGSKDSTIKFWDIVS-----GVCIKTLSSHL 601

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QN 370
             ++ +  +S G+Y LS S D + RLWD+   +  +RF+ H    +N
Sbjct: 602 GEVTSIATNSSGSYLLSASKDNSNRLWDIRNARPIKRFKGHQNTSKN 648



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S S D T+ +W         G     L G++  I D+  SS+GN   S + D  +++W
Sbjct: 390 LASGSSDNTIKLWN-----TETGTCINTLTGNTSRIWDLSSSSNGNLLASSAGDGIIKIW 444

Query: 311 DLAAGKTT 334
           D++  K++
Sbjct: 445 DVSQNKSS 452


>UniRef50_A0CRE9 Cluster: Chromosome undetermined scaffold_25, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_25,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1192

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 39/105 (37%), Positives = 54/105 (51%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           + +  L+L   L GH+  V   + NPK  + ILSSS DK + VWK   D   Y + Q   
Sbjct: 180 EQASELELVQILEGHSQGVNWCSFNPK-DNTILSSSDDKKIKVWKYF-DTRGYEVDQ--Y 235

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            GH++ +S  +    G Y +S S DKTLRLWD+        F +H
Sbjct: 236 CGHTNNVSCAMFHPFGEYFISNSEDKTLRLWDMKKKVEVDCFTNH 280



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 2/93 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--RLY 220
           +T K +  LRGH  +V  +  +P+ P   +S S D+T  +W       NY   Q    + 
Sbjct: 81  KTKKCQFVLRGHLDFVRCVNFHPELP-WCVSGSDDQTSRIW-------NYQSRQMIATVT 132

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           GHSH++         ++ ++ S D+T+RLW +A
Sbjct: 133 GHSHYVMHCEFHPSKDFMITCSLDQTIRLWSIA 165


>UniRef50_O43017 Cluster: Set1 complex component swd3; n=1;
           Schizosaccharomyces pombe|Rep: Set1 complex component
           swd3 - Schizosaccharomyces pombe (Fission yeast)
          Length = 380

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 2/105 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T +L  TL GH   ++Q+  AT  KY   + S+S DKT+ +W     E    +  + L G
Sbjct: 85  TFRLECTLFGHYRGISQVKWATGSKY---LASASDDKTIRIWDF---EKRCSV--RCLKG 136

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++++S +  +  G   +SGSWD+T+R+W+L  G   R    H++
Sbjct: 137 HTNYVSSIDFNPLGTLLVSGSWDETVRIWNLQDGTCLRMLPAHSE 181



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 29/86 (33%), Positives = 48/86 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH  +V+ I  NP    +++S S D+T+ +W L +D    G   + L  HS  I  V 
Sbjct: 134 LKGHTNYVSSIDFNP-LGTLLVSGSWDETVRIWNL-QD----GTCLRMLPAHSEPIISVS 187

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           +S+DG    + S+D   R+WD+ +G+
Sbjct: 188 ISADGTLCATASYDGMARIWDVLSGQ 213


>UniRef50_A4S646 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 495

 Score = 57.6 bits (133), Expect(2) = 3e-08
 Identities = 31/83 (37%), Positives = 45/83 (54%)
 Frame = +2

Query: 104 ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSG 283
           AT  K P+ ++S S D T+ +W+ +  +     P +RL GH   I+ V+ S DG Y  S 
Sbjct: 346 ATGGK-PERLVSGSDDYTMFMWEPSTTKT----PLQRLTGHQQLINHVLFSPDGRYFASA 400

Query: 284 SWDKTLRLWDLAAGKTTRRFEDH 352
           S+DK ++LWD   GK    F  H
Sbjct: 401 SFDKGVKLWDGLTGKFITSFRGH 423



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 30/87 (34%), Positives = 43/87 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   + RGH G V Q+A +     +++S+S+D T+ VW     +    +P     GH+
Sbjct: 413 TGKFITSFRGHVGAVYQLAWSAD-SRLLMSASKDSTMKVWDARLKKLKEDLP-----GHA 466

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S  G  A SG  DK LRLW
Sbjct: 467 DEVYAVDWSPMGTKAASGGKDKMLRLW 493



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S S D T+ +W L         P+  L GH++++  +  S+D  Y  SG  D  +RLW
Sbjct: 145 LASGSGDSTIRMWNLDSQA-----PKHTLKGHTNWVLCIAWSADNVYLASGGMDSAVRLW 199

Query: 311 DLAAGK 328
           D   G+
Sbjct: 200 DPITGE 205



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GH+  +  V  SSDG +  SGS D T+R+W+L +       + HT
Sbjct: 128 GHAEAVLSVAFSSDGKHLASGSGDSTIRMWNLDSQAPKHTLKGHT 172



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL-SGSWDKT 298
           +I ++SRD T+ VW     + N G   ++L GH H+++ + LS++  YAL +G +D T
Sbjct: 275 LIYTASRDTTIYVW-----DANDGKVVRQLKGHGHWVNSLALSTE--YALRTGPYDHT 325



 Score = 22.6 bits (46), Expect(2) = 3e-08
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKY 121
           L+GH  WV  +A + +Y
Sbjct: 299 LKGHGHWVNSLALSTEY 315


>UniRef50_Q47A03 Cluster: WD-40 repeat; n=1; Dechloromonas aromatica
            RCB|Rep: WD-40 repeat - Dechloromonas aromatica (strain
            RCB)
          Length = 1211

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDV 247
            L GH   V  +A + +   +I+S+S D +L +W     + N G P  K L GH+H+++ V
Sbjct: 1049 LVGHLKAVNSVAFS-RDGRLIVSASDDMSLRLW-----DANSGAPIGKPLTGHTHYVNSV 1102

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAG 325
              S DG Y +SGS D+TLRLWD+  G
Sbjct: 1103 AFSPDGRYVVSGSKDQTLRLWDVRTG 1128



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 31/86 (36%), Positives = 46/86 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH+  V  +A +P     I+S   DKTL +W ++  + +  +    L GH+  +  V 
Sbjct: 705 LKGHSQRVCAVAFSPD-GQHIVSGGDDKTLRLWNVSSGQPSGEV----LKGHTEAVYSVA 759

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            S +G   +SGS D TLRLWD   GK
Sbjct: 760 YSPNGLRIVSGSSDATLRLWDARTGK 785



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 33/88 (37%), Positives = 48/88 (54%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+ H   +  +A +P     I+S S D T+ +W+ T  +   G     L GH+  I+ V+
Sbjct: 791  LKRHRKAILGVAFSPD-GRYIVSGSGDYTVRLWE-TETQKPAG---DSLRGHTDEITGVL 845

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTT 334
             S DG   +SGS+DKTLRLW +AA   T
Sbjct: 846  FSRDGERVVSGSYDKTLRLWTVAADDPT 873



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 30/80 (37%), Positives = 40/80 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  +V  +A +P     ++S S+D+TL +W + R     G P   L GHS  I  V 
Sbjct: 1092 LTGHTHYVNSVAFSPD-GRYVVSGSKDQTLRLWDV-RTGTPVGAP---LEGHSDVIFGVT 1146

Query: 251  LSSDGNYALSGSWDKTLRLW 310
             S DG    S S D +LR W
Sbjct: 1147 FSPDGRQVASVSGDSSLRRW 1166



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 37/109 (33%), Positives = 46/109 (42%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG S +       +    L   L+GH G V  +A +P    ++ S S D TL  W    
Sbjct: 940  ASGSSDMSVRLWDAATGALLVPPLQGHLGTVYGVAFSPDGARLV-SGSADGTLRQWNAGS 998

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
                 G P     G    +S V  S DG   +S S D  LRLWD A GK
Sbjct: 999  GAP-IGSPMS---GEGGSVSSVAFSRDGRRIVSASEDGKLRLWDTATGK 1043



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           I++ SR+ +L +W+        G P  K L GHS +++ V  S DG   +S S D TLRL
Sbjct: 596 IVTGSRNGSLQLWEAAS-----GAPIGKPLIGHSSYVNSVAFSPDGKAIVSASRDHTLRL 650

Query: 308 WDLAAG 325
           W+   G
Sbjct: 651 WEAGTG 656



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 2/105 (1%)
 Frame = +2

Query: 44   SETLKLRG-TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
            +ET K  G +LRGH   +T +  + +  + ++S S DKTL +W +  D+    +    L 
Sbjct: 824  TETQKPAGDSLRGHTDEITGVLFS-RDGERVVSGSYDKTLRLWTVAADDPTSVV----LN 878

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT-RRFEDH 352
            G    +  V  S DG   +    D+ + + DL  GKTT + F  H
Sbjct: 879  GSDKALKSVAFSPDGTRLVWAGEDQDVHVLDLTTGKTTGKPFSGH 923



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           V  +A +P     I++   D  L +W     +   G P K   GHS  +  V  S DG +
Sbjct: 669 VCSVAFSP-LGQRIVAGGLDGNLRLWDAATGQM-LGEPLK---GHSQRVCAVAFSPDGQH 723

Query: 272 ALSGSWDKTLRLWDLAAGKTTRR-FEDHTK 358
            +SG  DKTLRLW++++G+ +    + HT+
Sbjct: 724 IVSGGDDKTLRLWNVSSGQPSGEVLKGHTE 753



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 29/85 (34%), Positives = 42/85 (49%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            + G  G V+ +A + +    I+S+S D  L +W  T      G P   L GH   ++ V 
Sbjct: 1006 MSGEGGSVSSVAFS-RDGRRIVSASEDGKLRLWD-TATGKPIGKP---LVGHLKAVNSVA 1060

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAG 325
             S DG   +S S D +LRLWD  +G
Sbjct: 1061 FSRDGRLIVSASDDMSLRLWDANSG 1085



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +2

Query: 209  KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            K   GH   +  V +S D     SGS D ++RLWD A G
Sbjct: 918  KPFSGHREAVYSVAVSPDSKRIASGSSDMSVRLWDAATG 956


>UniRef50_A7BQY9 Cluster: WD-40 repeat protein; n=3; Beggiatoa sp.
            PS|Rep: WD-40 repeat protein - Beggiatoa sp. PS
          Length = 1207

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 35/103 (33%), Positives = 55/103 (53%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T K+  TL+ H   V ++A +      + +SS+D T+ +W +     N G  ++ L GH
Sbjct: 772  KTGKVLHTLKAHTDHVQKVAFSHDN-QWLATSSKDATIRLWNV-----NSGKTERVLRGH 825

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               I D+     G   +S S D+TLRLWD+ +G T R F+ HT
Sbjct: 826  KQIIFDIRFIDHGQTLVSASDDRTLRLWDIQSGVTKRVFQGHT 868



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/75 (34%), Positives = 36/75 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S+  D  + +W L  D+     PQ+   GH   IS +  SSDG    S S+D T RLW
Sbjct: 715 LASAGTDNKITLWNLETDQ-----PQQIFSGHKDQISGLAFSSDGELLASASYDGTARLW 769

Query: 311 DLAAGKTTRRFEDHT 355
            +  GK     + HT
Sbjct: 770 QVKTGKVLHTLKAHT 784



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 27/105 (25%), Positives = 50/105 (47%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET + +    GH   ++ +A +    +++ S+S D T  +W++       G     L  H
Sbjct: 730  ETDQPQQIFSGHKDQISGLAFSSD-GELLASASYDGTARLWQVKT-----GKVLHTLKAH 783

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            +  +  V  S D  +  + S D T+RLW++ +GKT R    H ++
Sbjct: 784  TDHVQKVAFSHDNQWLATSSKDATIRLWNVNSGKTERVLRGHKQI 828



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 19/40 (47%), Positives = 21/40 (52%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            Q R  GH   I  V+ S DG    + S D TLRLWDL  G
Sbjct: 1111 QYRFEGHESTIYRVIFSPDGQQIATASADATLRLWDLYNG 1150


>UniRef50_A3FPQ2 Cluster: Pleiotropic regulator 1; n=2;
           Cryptosporidium|Rep: Pleiotropic regulator 1 -
           Cryptosporidium parvum Iowa II
          Length = 427

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 34/106 (32%), Positives = 50/106 (47%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K +   KL   + GH GWV  IA +P   +  +S S DK +  W +     N GI +  L
Sbjct: 116 KWAPRFKLNKVISGHKGWVRSIAVDPSN-NFFVSGSSDKLIKFWDI-----NSGILKLTL 169

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GH   +  V+ S    +  S S DKT++ WDL   +  R +  H+
Sbjct: 170 IGHIAAVRKVLFSERHPFLFSCSEDKTMKCWDLEQNRIVRNYARHS 215



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 48/93 (51%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  +  +  +P+  D++ + SRD ++++W +   E+ +         H   IS +++ S
Sbjct: 214 HSSGIYCLDIHPRL-DIVATGSRDGSVVLWDIRTRESIH-----LFKNHKAAISSILMQS 267

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                +SGS+D+T+R WD+ AGK       H K
Sbjct: 268 IEPQLISGSYDRTIRTWDIVAGKARDILTRHIK 300


>UniRef50_A0DXJ0 Cluster: Chromosome undetermined scaffold_69, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_69, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1165

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 34/102 (33%), Positives = 52/102 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T +L+  L+GHN  V  +  +      + S S DKT+ +W +       G  Q +L GH
Sbjct: 1039 KTEQLKANLQGHNDAVRSVCFSAD-GTKLASGSDDKTICLWDIKT-----GQQQVKLEGH 1092

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +  V  S+DG    SGS DK++RLWD+  G+   + E H
Sbjct: 1093 CSTVYSVCFSADGTKLASGSDDKSIRLWDVKTGQQQAKLEGH 1134



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/101 (28%), Positives = 56/101 (55%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T + +  L GH+G V  ++ +     ++ SSS D ++ +W +   +  +     +L GH+
Sbjct: 715 TKQQKNELEGHDGTVYCVSFSID-GTLLASSSADNSIRLWDVKTGQQKF-----KLDGHT 768

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + +  V  S +G+   SGSWD+++RLWD+ +G+   + E H
Sbjct: 769 NQVQSVSFSPNGSMLASGSWDQSIRLWDVESGEQKLQLEGH 809



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/92 (27%), Positives = 48/92 (52%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   +  +  +P   +++ S S D ++ +W +   + ++     +L GH++++  V  S
Sbjct: 334 GHREQIRSVCFSPN-GELLASGSYDHSISIWNVKEGKQDF-----QLNGHTNYVLSVCFS 387

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           SDG    SGS D ++RLWD+   K  ++   H
Sbjct: 388 SDGKILASGSADNSIRLWDIQKRKQKQKLNGH 419



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDV 247
           L GH  WV  +  +P    ++ S S DK + +W + T+ + N       L GH   +  V
Sbjct: 680 LEGHTNWVQSVNFSPN-GFLLASGSLDKDIRLWDVRTKQQKN------ELEGHDGTVYCV 732

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    S S D ++RLWD+  G+   + + HT
Sbjct: 733 SFSIDGTLLASSSADNSIRLWDVKTGQQKFKLDGHT 768



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           L+   T+ G   W  +I     +   +I S S D ++I+W +       G   ++L GH+
Sbjct: 630 LRQLNTVMGCQNWTIKIKIRRSHSLGLITSGSADNSIILWDV-----KIGQQIQKLEGHT 684

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++  V  S +G    SGS DK +RLWD+   +     E H
Sbjct: 685 NWVQSVNFSPNGFLLASGSLDKDIRLWDVRTKQQKNELEGH 725



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 33/107 (30%), Positives = 50/107 (46%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            R  L GH   V  +  +P   + + S S DK++ +W +       G  +  L GH+  I 
Sbjct: 887  RFKLVGHRKEVISVCFSPN-GNTLASGSNDKSICLWDVKT-----GKQKAVLNGHTSNIQ 940

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
             V  S D N   SGS D ++RLW+   G+  ++   HT   Q+  FC
Sbjct: 941  SVCFSPDSNTLASGSNDFSVRLWNAKNGELIQQLNGHTSYVQSVSFC 987



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/95 (29%), Positives = 43/95 (45%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  ++ +P    M+ S S D+++ +W +   E        +L GH   I  V 
Sbjct: 764  LDGHTNQVQSVSFSPN-GSMLASGSWDQSIRLWDVESGEQKL-----QLEGHDGTIYSVS 817

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SG  D ++RLW +  GK   +   H+
Sbjct: 818  FSPDGTKLASGGSDISIRLWQINTGKQILKIRSHS 852



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 25/96 (26%), Positives = 47/96 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+G +  ++ +P     + S   D ++ +W++     N G    ++  HS+ ++ V 
Sbjct: 806  LEGHDGTIYSVSFSPD-GTKLASGGSDISIRLWQI-----NTGKQILKIRSHSNCVNSVC 859

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S+DG+   SGS D ++ LWD    +   +   H K
Sbjct: 860  FSTDGSMLASGSDDNSICLWDFNENQQRFKLVGHRK 895



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 26/89 (29%), Positives = 43/89 (48%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T K +  L GH   +  +  +P   + + S S D ++ +W     +N   I Q  L GH
Sbjct: 924  KTGKQKAVLNGHTSNIQSVCFSPD-SNTLASGSNDFSVRLWNA---KNGELIQQ--LNGH 977

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            + ++  V   S G    SGS D ++RLW+
Sbjct: 978  TSYVQSVSFCSCGTLLASGSRDHSIRLWN 1006



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++YGH   I  V  S +G    SGS+D ++ +W++  GK   +   HT
Sbjct: 331 KVYGHREQIRSVCFSPNGELLASGSYDHSISIWNVKEGKQDFQLNGHT 378


>UniRef50_A2QT36 Cluster: Function: seems to be a general
            transcription factor; n=1; Aspergillus niger|Rep:
            Function: seems to be a general transcription factor -
            Aspergillus niger
          Length = 1510

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 35/92 (38%), Positives = 48/92 (52%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T  L+ TL+GH   V  I+ +P     + S+S D+T+ VW L    +      + L GH 
Sbjct: 977  TSTLQQTLKGHTDSVISISISPD-GRRLASASMDRTVKVWDLMTSTH------QTLNGHE 1029

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             +I  V  S DG    SGS+DKT R+WDL  G
Sbjct: 1030 SYIYGVAFSPDGRLLASGSYDKTARIWDLTTG 1061



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 30/86 (34%), Positives = 47/86 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  ++  +A +P    ++ S S DKT  +W LT   +      + L GH  ++  V
Sbjct: 1024 TLNGHESYIYGVAFSPD-GRLLASGSYDKTARIWDLTTGTH------QTLMGHDDYVYSV 1076

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAG 325
              S+DG    SG+ DKT+++WD+A G
Sbjct: 1077 SFSADGRRLASGAKDKTVKIWDVATG 1102



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/89 (35%), Positives = 46/89 (51%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  TL+GH  ++  ++ +P    +  SSS D+T+ +W     +   G  Q  L GH   +
Sbjct: 1282 LHQTLKGHRHFIHWLSFSPDMRQLA-SSSADRTIKIW-----DTATGSLQHTLEGHEWGV 1335

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            +  V S DG    SG+ DKT RLWD A G
Sbjct: 1336 NIAVFSPDGRRLASGADDKTFRLWDPATG 1364



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            L GH HFI  +  S D     S S D+T+++WD A G      E H
Sbjct: 1286 LKGHRHFIHWLSFSPDMRQLASSSADRTIKIWDTATGSLQHTLEGH 1331



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +2

Query: 170  KLTRDENNYGIPQKRLYGHSHF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +L   E ++    + + GH    +  V  S DG +  SGS D+T+++WD       +  +
Sbjct: 926  RLPEVEESWSAELESIEGHKDIAVRAVAFSPDGRWLASGSQDRTVKIWDAVTSTLQQTLK 985

Query: 347  DHT 355
             HT
Sbjct: 986  GHT 988



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 25/86 (29%), Positives = 42/86 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ +V  ++ +      + S ++DKT+ +W +       G  Q  +    H I   
Sbjct: 1065 TLMGHDDYVYSVSFSAD-GRRLASGAKDKTVKIWDVAT-----GALQDTIQTDLH-IESA 1117

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAG 325
            VL  DG  A+    D+ +++WDLA G
Sbjct: 1118 VLLPDGRLAVG---DRLIKIWDLATG 1140



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 20/64 (31%), Positives = 35/64 (54%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            +L+ +    +IVW ++  +  + I +    GH + +  V +S DG    SGS D T+++W
Sbjct: 1164 LLACTSGSNIIVWNMST-QTLHQICE----GHRNQVWAVAISPDGRRLASGSQDATIKIW 1218

Query: 311  DLAA 322
            DL A
Sbjct: 1219 DLDA 1222


>UniRef50_A0YQM3 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC
           8106|Rep: WD-repeat protein - Lyngbya sp. PCC 8106
          Length = 463

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRG--TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           K  E L+L    TL GH+ WV  +A +P     + S+S D  + +W L   +  +     
Sbjct: 42  KTQEPLRLPASKTLLGHSTWVYALAISPNN-QYLASASYDGKIKIWNLETGQLLHS---- 96

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            L GH+  I  +V+S D    +SG WD  +RLW+L  G+  R  + H
Sbjct: 97  -LSGHTDAIETLVVSPDSKVLVSGGWDNRIRLWNLETGELIRTLKGH 142



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/97 (31%), Positives = 50/97 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H+  V  +A +P     + ++S DKT+ +W L    NN  + Q+ L GHS  +  +
Sbjct: 221 TITAHSQAVWSVALSPD-GQTLATASTDKTIKLWDL----NNLQL-QQTLKGHSRAVLSL 274

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S D     SG +DK +RLW+   G+   ++E H K
Sbjct: 275 AFSPDSQTLASGGYDKIIRLWNPKTGQQMSQWEGHKK 311



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 29/94 (30%), Positives = 48/94 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  +L GH   +  +  +P    +++S   D  + +W L   E       + L GH
Sbjct: 89  ETGQLLHSLSGHTDAIETLVVSPD-SKVLVSGGWDNRIRLWNLETGELI-----RTLKGH 142

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
              +  + +S DG +  SGS DKT++LW+L+ GK
Sbjct: 143 IEDVKTLAISYDGKWLASGSVDKTIKLWNLSTGK 176



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 27/92 (29%), Positives = 45/92 (48%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L+L+ TL+GH+  V  +A +P     + S   DK + +W         G    +  GH  
Sbjct: 258 LQLQQTLKGHSRAVLSLAFSPD-SQTLASGGYDKIIRLWN-----PKTGQQMSQWEGHKK 311

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            I  V  S D     SGS D+T++LW++++ +
Sbjct: 312 PIWSVAFSPDSQILASGSSDETVKLWEISSSE 343



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 28/104 (26%), Positives = 51/104 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  TL+GH   V  +A +      + S S DKT+ +W L+  + +  +        
Sbjct: 131 ETGELIRTLKGHIEDVKTLAISYD-GKWLASGSVDKTIKLWNLSTGKKHLTLKT------ 183

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S ++  +V +SD    +SGS + ++ +W L  GK  +    H++
Sbjct: 184 SDWVRSIVFNSDTQTLVSGSENGSVEIWSLTDGKRLQTITAHSQ 227



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 15/49 (30%), Positives = 26/49 (53%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           K L GHS ++  + +S +  Y  S S+D  +++W+L  G+       HT
Sbjct: 53  KTLLGHSTWVYALAISPNNQYLASASYDGKIKIWNLETGQLLHSLSGHT 101


>UniRef50_A7RUR9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 273

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 1/105 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE-NNYGIPQKRLYG 223
           E+  L  TL GH+G+   +  +P    ++ S+  D  +I+W ++       G     L G
Sbjct: 101 ESGNLLDTLTGHDGYPVCLDFSPDGM-LLASTGADSNVIIWDISTARCYMQGTIIALLGG 159

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           HS ++ DV  SSDG    SGS D+T+R+WD AA +  ++   H++
Sbjct: 160 HSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEKLKKARFHSE 204



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+T  L   L GH G VT +  +P    +I SSS DKT+ +W  + DE       + L G
Sbjct: 17  SKTGALLAQLDGHAGAVTCVRVSPD-GGVIASSSADKTIRLWNPS-DEF-----LRSLEG 69

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H   ++ +  S +G   +S + DK L++WD+ +G        H
Sbjct: 70  HEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGH 112



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 29/94 (30%), Positives = 40/94 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ WV  +A +     ++ S SRD+T+ VW     E       K+   HS     V 
Sbjct: 157 LGGHSDWVMDVAFSSDGA-LLTSGSRDRTVRVWDCAAAEK-----LKKARFHSERCWSVA 210

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG +  S S D  +RLW +         E H
Sbjct: 211 YSDDGMWLASASDDFKVRLWAVEGYAQVAAMEGH 244



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 26/74 (35%), Positives = 38/74 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I S S D T+ VW     ++  G    +L GH+  ++ V +S DG    S S DKT+RLW
Sbjct: 3   IFSGSEDCTIRVW-----DSKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLW 57

Query: 311 DLAAGKTTRRFEDH 352
           +  + +  R  E H
Sbjct: 58  N-PSDEFLRSLEGH 70


>UniRef50_A2R251 Cluster: Function: co-expression of het-e and het-c
           lead to cell death; n=1; Aspergillus niger|Rep:
           Function: co-expression of het-e and het-c lead to cell
           death - Aspergillus niger
          Length = 380

 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 33/99 (33%), Positives = 53/99 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH+  V  +A +     ++ S SRDKT+ +W         G  +  L G+S+++
Sbjct: 190 LKHTLEGHSNPVYSVAFSNNR-QLLASGSRDKTIKLWNTAT-----GALKHTLKGYSNWV 243

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V  S++G    SGS+DKT++LW+ A G      E H+
Sbjct: 244 YSVAFSNNGQLLASGSYDKTIKLWNAATGALKYTLEGHS 282



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/89 (34%), Positives = 47/89 (52%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL+G++ WV  +A +     ++ S S DKT+ +W        Y      L GHS+ +
Sbjct: 232 LKHTLKGYSNWVYSVAFSNN-GQLLASGSYDKTIKLWNAATGALKY-----TLEGHSNPV 285

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             V  S++     SGS DKT++LWD A G
Sbjct: 286 YSVAFSNNRQLLASGSHDKTIKLWDAATG 314



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P ++ S S DKT+ +W         G  +  L GHS  +  V   ++G    SGS +KT+
Sbjct: 84  PKLLASGSDDKTIKLWDAAT-----GTLKHILEGHSGLVYSVAFLNNGQLLASGSGNKTI 138

Query: 302 RLWDLAAGKTTRRFEDHT 355
           +LWD A G      E+H+
Sbjct: 139 KLWDAATGALKHTLENHS 156



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 29/99 (29%), Positives = 47/99 (47%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+  L GH+G V  +A       ++ S S +KT+ +W         G  +  L  HS+ +
Sbjct: 106 LKHILEGHSGLVYSVAFLNN-GQLLASGSGNKTIKLWDAAT-----GALKHTLENHSNPV 159

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V  S++G    S S +KT++LW+ A G      E H+
Sbjct: 160 YSVAFSNNGQLLASSSGNKTIKLWNAATGALKHTLEGHS 198



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 29/89 (32%), Positives = 46/89 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL  H+  V  +A +     ++ SSS +KT+ +W         G  +  L GHS+ +
Sbjct: 148 LKHTLENHSNPVYSVAFSNN-GQLLASSSGNKTIKLWNAAT-----GALKHTLEGHSNPV 201

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             V  S++     SGS DKT++LW+ A G
Sbjct: 202 YSVAFSNNRQLLASGSRDKTIKLWNTATG 230


>UniRef50_UPI000038C572 Cluster: COG2319: FOG: WD40 repeat; n=1;
           Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40
           repeat - Nostoc punctiforme PCC 73102
          Length = 1218

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 36/102 (35%), Positives = 51/102 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL     GH GWV  +A +P    ++ S S DKT+ +W +     N G   + L GH+
Sbjct: 631 TGKLVVNFAGHLGWVWSLAFSPD-GQLLASCSSDKTIRLWDV-----NTGKCLRTLSGHT 684

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             I  V  S+DG    SG  + T+RLW++  G   + F  HT
Sbjct: 685 SSIWSVAFSADGQMLASGGDEPTIRLWNVNTGDCHKIFSGHT 726



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 30/95 (31%), Positives = 51/95 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+G++  V  +A N      + S S D+T+ +W +     N G   K+  GHS +++ V
Sbjct: 888  TLKGYSNSVFSVAFNLD-GQTLASGSTDQTVRLWDV-----NTGTCLKKFAGHSGWVTSV 941

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                DG+   S S D+T+RLW ++ G+  +  +DH
Sbjct: 942  AFHPDGDLLASSSADRTIRLWSVSTGQCLQILKDH 976



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 31/95 (32%), Positives = 48/95 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+ H  WV  +A +P    ++ S S D+T+ +W ++      G     L GHS +I  V 
Sbjct: 973  LKDHVNWVQSVAFSPDR-QILASGSDDQTIRLWSVST-----GKCLNILQGHSSWIWCVT 1026

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S +G    S S D+T+RLW  + G+  +  E HT
Sbjct: 1027 FSPNGEIVASSSEDQTIRLWSRSTGECLQILEGHT 1061



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   +  +A N      I S S D+T+ +W +     N G   K L G+S+ +  V 
Sbjct: 847  LPGHTNSIFSVAFNVD-GRTIASGSTDQTVKLWDV-----NTGRCFKTLKGYSNSVFSVA 900

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + DG    SGS D+T+RLWD+  G   ++F  H+
Sbjct: 901  FNLDGQTLASGSTDQTVRLWDVNTGTCLKKFAGHS 935



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/102 (29%), Positives = 53/102 (51%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K    L+GH+ W+  +  +P   +++ SSS D+T+ +W  +  E       + L GH+
Sbjct: 1008 TGKCLNILQGHSSWIWCVTFSPN-GEIVASSSEDQTIRLWSRSTGEC-----LQILEGHT 1061

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              +  +  S DG   LS + D+T+RLW +  G+    F+ H+
Sbjct: 1062 SRVQAIAFSPDGQI-LSSAEDETVRLWSVDTGECLNIFQGHS 1102



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 31/85 (36%), Positives = 44/85 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  IA +P     ILSS+ D+T+ +W +   E    I Q    GHS+ +  V 
Sbjct: 1057 LEGHTSRVQAIAFSPD--GQILSSAEDETVRLWSVDTGEC-LNIFQ----GHSNSVWSVA 1109

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAG 325
             S +G+   S S D+T+R+WD   G
Sbjct: 1110 FSPEGDILASSSLDQTVRIWDRHTG 1134



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 33/102 (32%), Positives = 48/102 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL GH   +  +A +     M+ S   + T+ +W +     N G   K   GH+
Sbjct: 673 TGKCLRTLSGHTSSIWSVAFSAD-GQMLASGGDEPTIRLWNV-----NTGDCHKIFSGHT 726

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             I  +  SSDG    SGS D T+RLW + +G+  R  E H+
Sbjct: 727 DRILSLSFSSDGQTLASGSADFTIRLWKI-SGECDRILEGHS 767



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/75 (33%), Positives = 40/75 (53%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S S D T+ +WK++      G   + L GHS  I  +  S DG   +SGS D T+RLW
Sbjct: 741 LASGSADFTIRLWKIS------GECDRILEGHSDRIWSISFSPDGQTLVSGSADFTIRLW 794

Query: 311 DLAAGKTTRRFEDHT 355
           +++ G      ++H+
Sbjct: 795 EVSTGNCFNILQEHS 809



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 31/110 (28%), Positives = 53/110 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+  +  I+ +P    ++ S S D T+ +W+++   N + I Q+    HS  +  + 
Sbjct: 763  LEGHSDRIWSISFSPDGQTLV-SGSADFTIRLWEVSTG-NCFNILQE----HSDRVRSLA 816

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNAD 400
             S +    +S S DKT+R+W+ + G+       HT    NS F    N D
Sbjct: 817  FSPNAQMLVSASDDKTVRIWEASTGECLNILPGHT----NSIFSVAFNVD 862



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 3/88 (3%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH+  V  +A +P+  D++ SSS D+T+ +W     + + G+  K L    H +   + 
Sbjct: 1099 QGHSNSVWSVAFSPE-GDILASSSLDQTVRIW-----DRHTGVCLKVLPVLPHAMRSAIA 1152

Query: 254  --SSDGNYAL-SGSWDKTLRLWDLAAGK 328
               S  +YA+ SGS + T+++WD   G+
Sbjct: 1153 FGKSTEHYAIASGSQNGTIQIWDAQTGE 1180


>UniRef50_Q39WC4 Cluster: NACHT nucleoside triphosphatase; n=1;
            Geobacter metallireducens GS-15|Rep: NACHT nucleoside
            triphosphatase - Geobacter metallireducens (strain GS-15
            / ATCC 53774 / DSM 7210)
          Length = 1416

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 36/100 (36%), Positives = 45/100 (45%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +LR    GH+  V  +A  P     + S S D TL  W L       G      YGH+  
Sbjct: 998  ELRRAFEGHSRQVLAVAVTPDGRQFV-SGSEDCTLKRWDLAE-----GTELWTYYGHTDG 1051

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S V +S DG   +SGSWD TLR WDL   +       HT
Sbjct: 1052 VSSVTVSPDGREIVSGSWDFTLRRWDLEQPRAREVLRGHT 1091



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/96 (31%), Positives = 52/96 (54%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LRGH   V+ +A  P     + S S D  + +W     +   GI    ++GH++ I+ + 
Sbjct: 919  LRGHTLPVSSLAAAPD-GSWLASGSWDNVVRLWDPETGQER-GI----IWGHTYGINALA 972

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++ DG   LS S+D+T++ W+ A G+  R FE H++
Sbjct: 973  VTPDGQTLLSASFDRTIKAWNPANGELRRAFEGHSR 1008



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/71 (39%), Positives = 40/71 (56%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            +L++S D+TL +W LT  +  Y      L GH+  I  V ++ DG  A+S S D++L LW
Sbjct: 1315 VLTASSDRTLKLWHLTTGQVMY-----TLRGHNREIWSVSVTPDGRRAVSASDDRSLILW 1369

Query: 311  DLAAGKTTRRF 343
            DL A K    F
Sbjct: 1370 DLEALKPLATF 1380



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 27/94 (28%), Positives = 44/94 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   VT     P   +  +++S D+ + VW        +      L GH  ++ DV 
Sbjct: 1129 LTGHGATVTAAVFTPS-GNRFVTASWDRKIKVWGAATGAEIFS-----LTGHETWVRDVA 1182

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            ++ DG  A++ S D+T+R+WDL   +    F  H
Sbjct: 1183 ITPDGRRAVTASHDRTVRVWDLEERRELWVFRGH 1216



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 28/83 (33%), Positives = 39/83 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH  WV  +A  P     + ++S D+T+ VW L      +        GH   +  V
Sbjct: 1170 SLTGHETWVRDVAITPDGRRAV-TASHDRTVRVWDLEERRELWVFR-----GHDAEVWSV 1223

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
            V++ DG  A S   D TLR WDL
Sbjct: 1224 VVTPDGRRAFSAGQDATLREWDL 1246



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 28/95 (29%), Positives = 46/95 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   V+ +  +P   + I+S S D TL  W L +        ++ L GH+  +S  
Sbjct: 1044 TYYGHTDGVSSVTVSPDGRE-IVSGSWDFTLRRWDLEQPR-----AREVLRGHTFKVSAA 1097

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             ++ DG  A+S + D TL++W+LA    +     H
Sbjct: 1098 AITPDGATAVSAAQDTTLKVWNLAGATASPPLTGH 1132



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 209 KRLYG-HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +R+ G H+H +  V ++ DG  A+S + D TLR+WDLA+G      + H
Sbjct: 832 ERILGTHTHPVRGVAITPDGRRAISAADDATLRVWDLASGAELMVLKGH 880



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL VW L       G     L GH   +  V +  DG    SGS D T+RLWD
Sbjct: 855  ISAADDATLRVWDLAS-----GAELMVLKGHESEVLAVAVFPDGRRIASGSRDATVRLWD 909

Query: 314  LAAGKTTRRFEDHT 355
               G+       HT
Sbjct: 910  TETGECLLILRGHT 923



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +2

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            H   ++D V   DG   L+ S D+TL+LW L  G+       H +
Sbjct: 1299 HRDQVNDCVFLPDGLRVLTASSDRTLKLWHLTTGQVMYTLRGHNR 1343


>UniRef50_A7C0D3 Cluster: Beta transducin-like protein; n=1;
           Beggiatoa sp. PS|Rep: Beta transducin-like protein -
           Beggiatoa sp. PS
          Length = 627

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 34/87 (39%), Positives = 47/87 (54%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           GW   IA +P     +LS+S D TL +W  T + N  G     L GH  ++  VV S DG
Sbjct: 134 GWFYSIAFSPTQNQALLSTSSDNTLKLWD-TENGNETGT----LKGHQDWVYLVVFSPDG 188

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFE 346
           N ALS S D T+++WD+   +  + FE
Sbjct: 189 NKALSASEDGTMKVWDIENEEEAQSFE 215



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 28/97 (28%), Positives = 43/97 (44%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           GTL+GH  WV  +  +P   +  LS+S D T+ VW +  +E       + ++        
Sbjct: 170 GTLKGHQDWVYLVVFSPD-GNKALSASEDGTMKVWDIENEEEAQSFEVEHIWA------- 221

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG+  L+G  D T+  WD   G      + HT
Sbjct: 222 AAFSPDGSQILTGGDDGTITQWDATTGVELNTLQGHT 258



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/77 (32%), Positives = 38/77 (49%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           IL+   D T+  W  T      G+    L GH+  +  V  S+DG+ A+SG    T+ +W
Sbjct: 231 ILTGGDDGTITQWDATT-----GVELNTLQGHTSRVYAVAFSADGSQAVSGDGQGTINIW 285

Query: 311 DLAAGKTTRRFEDHTKV 361
           D+A GK    +E H  +
Sbjct: 286 DIAQGKAISTYEAHNDI 302



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 35/112 (31%), Positives = 53/112 (47%)
 Frame = +2

Query: 14  SSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           S LF   + +++ + L  T  GH   +  +A +    + ILS S D T+  W L   E  
Sbjct: 28  SGLFSMGNALAQEIIL--TFEGHTDSIESVAISND-GNTILSGSHDNTIKSWNLETGEEI 84

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
                +   G + F+  V  SSD N  LSGS D T++ W+  AG+    F+D
Sbjct: 85  -----QTFQGPTDFVMAVAFSSDDNTVLSGSADNTIKAWN-KAGQKLDSFQD 130



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GH+  I  V +S+DGN  LSGS D T++ W+L  G+  + F+  T
Sbjct: 47  GHTDSIESVAISNDGNTILSGSHDNTIKSWNLETGEEIQTFQGPT 91



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 1/89 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  +A +      + S     T+ +W + +     G        H+  +S V
Sbjct: 253 TLQGHTSRVYAVAFSADGSQAV-SGDGQGTINIWDIAQ-----GKAISTYEAHNDIVSSV 306

Query: 248 V-LSSDGNYALSGSWDKTLRLWDLAAGKT 331
             L++D N  LS S+D T++LWDL A  T
Sbjct: 307 TFLATDNNKVLSASYDNTIKLWDLTATPT 335


>UniRef50_A7BQ86 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp.
            PS|Rep: WD-40 repeat protein - Beggiatoa sp. PS
          Length = 1400

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 31/82 (37%), Positives = 44/82 (53%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+ WV  +A +P    +   SS D T+I+W +   +N    P   L  HSH++  V 
Sbjct: 955  LTGHSDWVNSVAFSPDGQTLASVSSWDGTVILWDVDI-QNQLSEP---LIDHSHWVGSVA 1010

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG    SG  D+T++LWDL
Sbjct: 1011 FSPDGQTLASGGLDETVKLWDL 1032



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 37/105 (35%), Positives = 52/105 (49%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG S        ++    L   L GH+  V  IA +P     + S+S+D T+ +W + +
Sbjct: 1190 ASGSSDRTVRLWDVTTRQPLGKPLTGHSDKVNSIAFSPD-GQTLASASKDGTVRLWNV-K 1247

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
                 G P   L GHS ++S V  S DG    SGS D T+RLWD+
Sbjct: 1248 TRTPLGGP---LIGHSSWVSSVAFSPDGKTLASGSRDHTIRLWDI 1289



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/82 (36%), Positives = 46/82 (56%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+G V+ +A +P    ++ S+S D T+ +W +       G   + L GHS +++ V 
Sbjct: 869  LTGHSGDVSSVAFSPD-GQILASASDDNTVRLWNVAT-RTPLG---ETLTGHSDWVNSVA 923

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG    SGS D T+RLWD+
Sbjct: 924  FSPDGQTLASGSLDGTVRLWDV 945



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/83 (37%), Positives = 46/83 (55%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+ +V+ +A +P    ++ S+S DKT+ +W +       G P   L GHS  +S V 
Sbjct: 826  LTGHSHYVSSVAFSPD-GQILASASLDKTVRLWDVDT-RTPLGEP---LTGHSGDVSSVA 880

Query: 251  LSSDGNYALSGSWDKTLRLWDLA 319
             S DG    S S D T+RLW++A
Sbjct: 881  FSPDGQILASASDDNTVRLWNVA 903



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 33/85 (38%), Positives = 45/85 (52%), Gaps = 2/85 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISD 244
            TL GH+ WV  +A +P     + S S D T+ +W + TR     G P   L GHS +++ 
Sbjct: 911  TLTGHSDWVNSVAFSPD-GQTLASGSLDGTVRLWDVGTRTPQ--GEP---LTGHSDWVNS 964

Query: 245  VVLSSDGNYALS-GSWDKTLRLWDL 316
            V  S DG    S  SWD T+ LWD+
Sbjct: 965  VAFSPDGQTLASVSSWDGTVILWDV 989



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/75 (38%), Positives = 39/75 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           V  IA +P    ++ S   D T+ +W +       G P   L GHSH++S V  S DG  
Sbjct: 790 VDSIAFSPD-GQILASGGMDNTVRLWDMDT-RTPLGEP---LTGHSHYVSSVAFSPDGQI 844

Query: 272 ALSGSWDKTLRLWDL 316
             S S DKT+RLWD+
Sbjct: 845 LASASLDKTVRLWDV 859



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQK-RLYGHSHFISD 244
           L GH  WV  +A +P    ++ S+S+D  + +W + TR      +     ++G   FI D
Sbjct: 733 LTGHFYWVNSVAFSPD-GQILASASQDGIVRLWNVDTRTPLGEPLTGHFDIFGGLPFIVD 791

Query: 245 -VVLSSDGNYALSGSWDKTLRLWDL 316
            +  S DG    SG  D T+RLWD+
Sbjct: 792 SIAFSPDGQILASGGMDNTVRLWDM 816



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            L GHSH +  V  S +G    SGS D+T+RLWD+
Sbjct: 1170 LTGHSHCVESVAFSPNGQILASGSSDRTVRLWDV 1203



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 26/86 (30%), Positives = 44/86 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+  L  H+  +T +A +P    + L+S +D T+ +W +       G P   L GH +++
Sbjct: 686 LKTILYRHSFGITSVAFSPDGQTLALAS-KDGTVRLWDVDT-RTPLGEP---LTGHFYWV 740

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           + V  S DG    S S D  +RLW++
Sbjct: 741 NSVAFSPDGQILASASQDGIVRLWNV 766


>UniRef50_A0YUK7 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC
           8106|Rep: WD-repeat protein - Lyngbya sp. PCC 8106
          Length = 897

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 32/94 (34%), Positives = 48/94 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  WV  ++ +P   +++ S S D+T+ +W +       G   K L GH   +  + 
Sbjct: 319 LPGHKAWVMAVSFSPD-SNILASGSNDQTVRLWDVKT-----GQCLKTLRGHKSRVQSLT 372

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG    SGS DKT+RLWD+  GK  +  + H
Sbjct: 373 FSQDGKMIASGSNDKTVRLWDVETGKCLQVLKGH 406



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/96 (32%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  WV   + + +   ++ + SRDKT+ +W +   E       + L GH H +  V
Sbjct: 654 TLWGHESWVHSASFSCQ--GLLATGSRDKTIKIWDIETGEC-----LQTLAGHLHRVKSV 706

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S  G    SGS D+TL++WD+  G   +   +HT
Sbjct: 707 AFSPCGQILASGSDDQTLKIWDIKQGICLQTLSEHT 742



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 30/102 (29%), Positives = 49/102 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   TL GH   V  +A +P    ++ S S D+TL +W + +     GI  + L  H
Sbjct: 688 ETGECLQTLAGHLHRVKSVAFSP-CGQILASGSDDQTLKIWDIKQ-----GICLQTLSEH 741

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + ++  V  S DG    S   D+T++LW++  G   +    H
Sbjct: 742 TDWVLGVAFSPDGKMLASAGGDRTVKLWEIQTGNCVQTLRGH 783



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/87 (33%), Positives = 44/87 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH   V  +  +      ++SSS D T+ VW LT  +  Y       +GHS  +  V
Sbjct: 779  TLRGHRQRVRSVGFSYD-GSKVVSSSDDHTVKVWNLTTGDCVY-----TCHGHSQTVWSV 832

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              S +G    SG  D+T++LW++  G+
Sbjct: 833  ACSPEGQIFASGGDDQTIKLWEMTTGE 859



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/97 (28%), Positives = 47/97 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL  H  WV  +A +P    M+ S+  D+T+ +W++       G   + L GH   +  V
Sbjct: 737  TLSEHTDWVLGVAFSPD-GKMLASAGGDRTVKLWEIQT-----GNCVQTLRGHRQRVRSV 790

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              S DG+  +S S D T+++W+L  G        H++
Sbjct: 791  GFSYDGSKVVSSSDDHTVKVWNLTTGDCVYTCHGHSQ 827



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 23/95 (24%), Positives = 45/95 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  ++ WV+ +  NP    +++S S D  + +W +     +    +K L GH++ +S  
Sbjct: 570 TLDAYSNWVSFVTFNPD-GKLLVSCSEDGLVRLWNI-----HTKTCEKTLTGHTNIVSSA 623

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                G    + S D T++LW++  G+  +    H
Sbjct: 624 AFHPQGKLLATASDDSTIKLWNVTTGECLKTLWGH 658



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 23/94 (24%), Positives = 48/94 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+    W++ IA +P+  +++ ++S   T+  W +       G   K L G+   +  V 
Sbjct: 445 LKTQVNWMSSIALHPE-GEILATASDGNTVKFWDVET-----GKCTKILAGYQERVWAVA 498

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG    +GS D+T+++W+ + G+  +  ++H
Sbjct: 499 FSPDGQKFATGSNDQTIKIWNFSTGECVKTLQEH 532



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 27/103 (26%), Positives = 48/103 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    L G+   V  +A +P       + S D+T+ +W  +  E       K L  H
Sbjct: 479 ETGKCTKILAGYQERVWAVAFSPD-GQKFATGSNDQTIKIWNFSTGEC-----VKTLQEH 532

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H +  V  S DG   +S S D++++ W +A+G+  +  + ++
Sbjct: 533 RHLVWWVGFSPDGQTLISVSQDQSVKFWQVASGQCLKTLDAYS 575



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 30/90 (33%), Positives = 41/90 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH   V Q  T  +   MI S S DKT+ +W +       G   + L GH   I  +
Sbjct: 360 TLRGHKSRV-QSLTFSQDGKMIASGSNDKTVRLWDVET-----GKCLQVLKGHYRRILAI 413

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V        +S   D+T+R W++  GK  R
Sbjct: 414 VFHLKYGLVISCGEDETVRFWNITTGKCVR 443



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 26/98 (26%), Positives = 47/98 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ H   V  +  +P    +I S S+D+++  W++       G   K L  +S+++S V
Sbjct: 528 TLQEHRHLVWWVGFSPDGQTLI-SVSQDQSVKFWQVAS-----GQCLKTLDAYSNWVSFV 581

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG   +S S D  +RLW++      +    HT +
Sbjct: 582 TFNPDGKLLVSCSEDGLVRLWNIHTKTCEKTLTGHTNI 619


>UniRef50_A0YUE4 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC
            8106|Rep: WD-repeat protein - Lyngbya sp. PCC 8106
          Length = 1224

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 32/94 (34%), Positives = 48/94 (51%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH+ WV  +  +P    M+ S S D T+ +W     + + G   K L+GHS  I  VV S
Sbjct: 937  GHSDWVWSVCFSPN-GRMLASGSYDSTVKLW-----DTDTGEALKTLHGHSDRIETVVFS 990

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             DG    S S D+T+R+WD+  G+       H++
Sbjct: 991  GDGKLLASASDDQTVRVWDVQTGECLHTLTGHSR 1024



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/95 (32%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  +  +  +     ++ S+S D+T+ VW +   E  +      L GHS ++  V
Sbjct: 976  TLHGHSDRIETVVFSGD-GKLLASASDDQTVRVWDVQTGECLH-----TLTGHSRWVGVV 1029

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    SGS D +L+LWD+  GK  +  E H
Sbjct: 1030 AFSPDGQILASGSHDHSLKLWDIQTGKCLQTLEGH 1064



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            TL+G    V  +A +    D IL++ S+++ + +W +   +       + L GH H +  
Sbjct: 850  TLKGFESQVCSVAFSQD--DQILATGSQEQMVQLWDIATGQR-----LRTLRGHKHQVWS 902

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             VLS DG    +GS D  +RLWD+ AG+  +RF  H+
Sbjct: 903  FVLSPDGKTLATGSDDHRVRLWDIHAGRCIKRFSGHS 939



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 30/87 (34%), Positives = 44/87 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+ WV  +A +P    ++ S S D +L +W +       G   + L GH   I  +
Sbjct: 1018 TLTGHSRWVGVVAFSPD-GQILASGSHDHSLKLWDIQT-----GKCLQTLEGHFQRIDLL 1071

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              S DG    SGS D T+++WD+  GK
Sbjct: 1072 AFSPDGQSLASGSHDCTVKVWDVCTGK 1098



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/96 (30%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH   V     +P     + + S D  + +W +     + G   KR  GHS ++  V
Sbjct: 892  TLRGHKHQVWSFVLSPD-GKTLATGSDDHRVRLWDI-----HAGRCIKRFSGHSDWVWSV 945

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S +G    SGS+D T++LWD   G+  +    H+
Sbjct: 946  CFSPNGRMLASGSYDSTVKLWDTDTGEALKTLHGHS 981



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +G    V  I  +P+  ++I S S D+T+ +WK++  E        R  GH   I  V  
Sbjct: 616 QGKTKGVKSIVFSPE-GNLIASGSDDQTVRIWKVSTGEC-----LDRWSGHQETIKCVNF 669

Query: 254 SSDGNYALSGSWDKTLRLWDLAAG 325
           SSDG    SGS D+T+R+WD+ +G
Sbjct: 670 SSDGQMLASGSDDRTVRVWDVNSG 693



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/72 (38%), Positives = 38/72 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           M+ S S D+T+ VW    D N+ G  Q  L GH   I  V+ S D +   S S D+T+RL
Sbjct: 675 MLASGSDDRTVRVW----DVNSGGCLQV-LTGHREGIRTVIFSPDNSIVASSSDDQTVRL 729

Query: 308 WDLAAGKTTRRF 343
           W +  G+  R F
Sbjct: 730 WSIQTGECLRTF 741



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 28/95 (29%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH   V  +A + +   ++ SSS D+T+ VW     +   G   K L G    +  V
Sbjct: 808  SLEGHLDSVWAVAFS-RDGQLLASSSDDQTVKVW-----QTKTGSCLKTLKGFESQVCSV 861

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S D     +GS ++ ++LWD+A G+  R    H
Sbjct: 862  AFSQDDQILATGSQEQMVQLWDIATGQRLRTLRGH 896



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           G +  +  +V S +GN   SGS D+T+R+W ++ G+   R+  H
Sbjct: 617 GKTKGVKSIVFSPEGNLIASGSDDQTVRIWKVSTGECLDRWSGH 660


>UniRef50_A0YT97 Cluster: WD-40 repeat protein; n=1; Lyngbya sp. PCC
           8106|Rep: WD-40 repeat protein - Lyngbya sp. PCC 8106
          Length = 743

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 34/96 (35%), Positives = 50/96 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  +V  +  +P    ++ S S DKT+ VW L       G     L GHS  +  V
Sbjct: 575 TLSGHRSFVRAVTISPDSSKLV-SGSWDKTVKVWDLAT-----GKELLTLNGHSSSVKAV 628

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +SS+G+  +S S DKT+++WDLA G+       H+
Sbjct: 629 AISSNGSKVVSASSDKTVKVWDLATGEELLTLNGHS 664



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 34/87 (39%), Positives = 48/87 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +      ++S+S DKT+ VW L   E         L GHS  +  V
Sbjct: 617 TLNGHSSSVKAVAISSN-GSKVVSASSDKTVKVWDLATGEELL-----TLNGHSSSVEAV 670

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
            +SSDG+  +S S DKT+++WDL  GK
Sbjct: 671 AISSDGSKVVSASSDKTVKVWDLNTGK 697



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP---KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           TL GH   V+ +A  P   K    I+S S DKT+ VW L       G     L GH + +
Sbjct: 145 TLVGHGNQVSAVAITPDESKNESKIVSGSWDKTIKVWDLAT-----GKILSTLSGHGNPV 199

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLA 319
           S V ++ DG+  +S SWD+T+++WD+A
Sbjct: 200 SAVAITPDGSKIVSSSWDQTVKIWDVA 226



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 28/75 (37%), Positives = 42/75 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++SSS D T+ VW L +     G     L GHS  ++ V ++ D +  +SGS DKT+++W
Sbjct: 253 VVSSSNDNTIQVWDLAK-----GKELLTLSGHSDSVNAVAITPDESKLVSGSSDKTIKVW 307

Query: 311 DLAAGKTTRRFEDHT 355
           DLA GK       H+
Sbjct: 308 DLATGKKLFTINGHS 322



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 4/58 (6%)
 Frame = +2

Query: 194 YGIPQKR----LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +P K+    L GH  F+  V +S D +  +SGSWDKT+++WDLA GK       H+
Sbjct: 565 FDLPSKKELFTLSGHRSFVRAVTISPDSSKLVSGSWDKTVKVWDLATGKELLTLNGHS 622



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/95 (30%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GHN +   I T       ++SSS D+T+ VW L   +  + +     +   +FI+ +
Sbjct: 359 TLLGHN-YPINIVTISSKGSKLVSSSLDQTIKVWDLNSGKELFTLAGDNSF---NFITAI 414

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S D +  +S SWD T+++WDL + K       H
Sbjct: 415 AISLDESKLVSSSWDHTVKVWDLTSEKQRLTIRGH 449



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 32/102 (31%), Positives = 50/102 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K+  TL GH   V+ +A  P     I+SSS D+T+ +W +      +      L  HS
Sbjct: 185 TGKILSTLSGHGNPVSAVAITPD-GSKIVSSSWDQTVKIWDVATATELF-----TLNVHS 238

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  + +S D +  +S S D T+++WDLA GK       H+
Sbjct: 239 SLLKALAISLDCSKVVSSSNDNTIQVWDLAKGKELLTLSGHS 280



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/87 (32%), Positives = 49/87 (56%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V  +  +P    ++ S S+D ++ +W L       G     L GH++ I+ V
Sbjct: 317 TINGHSDSVEAVVISPDGLKLV-SGSKDCSVKIWDLAT-----GTELFTLLGHNYPINIV 370

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
            +SS G+  +S S D+T+++WDL +GK
Sbjct: 371 TISSKGSKLVSSSLDQTIKVWDLNSGK 397



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 68  TLRGHNGW--VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL G N +  +T IA +     ++ SSS D T+ VW LT ++    I      GH   ++
Sbjct: 401 TLAGDNSFNFITAIAISLDESKLV-SSSWDHTVKVWDLTSEKQRLTIR-----GHKGCVN 454

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLA 319
            V +S D +  +S S+D T+++WDLA
Sbjct: 455 AVAISPDESKLVSCSYDMTIKIWDLA 480



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 29/102 (28%), Positives = 53/102 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K R T+RGH G V  +A +P     ++S S D T+ +W L      + + +     H   
Sbjct: 441 KQRLTIRGHKGCVNAVAISPD-ESKLVSCSYDMTIKIWDLAMRREVFTLDK----DHGTV 495

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +  +V+S DG+  +S + + T+++WDL + K    F +++ V
Sbjct: 496 VG-IVISQDGSKLVSSTMN-TVKVWDLDSKKELFNFIEYSYV 535



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 4/52 (7%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNY----ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + L GH + +S V ++ D +      +SGSWDKT+++WDLA GK       H
Sbjct: 144 RTLVGHGNQVSAVAITPDESKNESKIVSGSWDKTIKVWDLATGKILSTLSGH 195


>UniRef50_A0CQ08 Cluster: Chromosome undetermined scaffold_238,
           whole genome shotgun sequence; n=9; Eukaryota|Rep:
           Chromosome undetermined scaffold_238, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 1142

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 33/101 (32%), Positives = 53/101 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+ L+  L GH+G+V ++  +P     + S S  K++ +W +       G  + +  GHS
Sbjct: 537 TVSLKAKLDGHSGYVYEVCFSPD-GTKLASGSDAKSIHLWDV-----KTGQQKAKFEGHS 590

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             I  V  S DGN   SGS DK++ LWD+  G+   +F+ H
Sbjct: 591 GGILSVCFSPDGNTLASGSADKSIHLWDVKKGEQKAKFDGH 631



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 29/105 (27%), Positives = 55/105 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +    GH+G +  +  +P   + + S S DK++ +W + + E      + +  GH
Sbjct: 578 KTGQQKAKFEGHSGGILSVCFSPD-GNTLASGSADKSIHLWDVKKGEQ-----KAKFDGH 631

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            + ++ V  S DG    SGS DKT+RLWD+  G+   + + H+ +
Sbjct: 632 QYSVTSVRFSPDGTILASGSADKTIRLWDVKTGQQKTKLDGHSSL 676



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/93 (33%), Positives = 48/93 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +  +P    ++ S S DKT+ +W +       G  + +L GHS  +  V  S
Sbjct: 630 GHQYSVTSVRFSPD-GTILASGSADKTIRLWDVKT-----GQQKTKLDGHSSLVLLVCFS 683

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    SGS D ++RLWD+  G+   +F+ H+
Sbjct: 684 PDGTTLASGSDDNSIRLWDVKTGQQNAKFDGHS 716



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/95 (31%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +V  +  +P    ++ S S D ++ +W    D     +  K L GHS ++ +V 
Sbjct: 502 LNGHSSYVYTVCFSPD-GTILASGSYDNSIHLW----DVATVSLKAK-LDGHSGYVYEVC 555

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG    SGS  K++ LWD+  G+   +FE H+
Sbjct: 556 FSPDGTKLASGSDAKSIHLWDVKTGQQKAKFEGHS 590



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 31/92 (33%), Positives = 47/92 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G VT +  +      I+S+S D +L +W  T      G  + +  GHS  IS    S
Sbjct: 378 GHSGDVTSVNFSTD-GTTIVSASYDNSLRLWDATT-----GQQKAKFEGHSGGISSACFS 431

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG    SGS DK++RLW++  G+   + + H
Sbjct: 432 LDGTKLASGSADKSIRLWNVKTGQQQAKLDGH 463



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/103 (29%), Positives = 51/103 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +  L GH   V  +  +P     + S S DK++ +W +     N G  + +L GH
Sbjct: 452 KTGQQQAKLDGHLCDVRSVCFSPD-GTTLASGSDDKSIRLWSV-----NTGQQKTKLNGH 505

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S ++  V  S DG    SGS+D ++ LWD+A      + + H+
Sbjct: 506 SSYVYTVCFSPDGTILASGSYDNSIHLWDVATVSLKAKLDGHS 548



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 30/94 (31%), Positives = 45/94 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+  V  +  +P     + S S  K++ +W +       G  + +  GHS  I  V 
Sbjct: 754  LNGHSSQVLSVCFSPD-GTKLASGSDAKSIYLWDVKT-----GQQKAKFDGHSGGILSVC 807

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    SGS DK++RLWD+  G    +F+ H
Sbjct: 808  FSPDGTTLASGSADKSIRLWDVKTGYQKAKFDGH 841



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 28/93 (30%), Positives = 46/93 (49%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G +  +  +P    +  S S D+T+ +W     +   G    +L GHS  +  V  S
Sbjct: 714 GHSGRILSVCFSPDGATLA-SGSADETIRLW-----DAKTGQQLVKLNGHSSQVLSVCFS 767

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    SGS  K++ LWD+  G+   +F+ H+
Sbjct: 768 PDGTKLASGSDAKSIYLWDVKTGQQKAKFDGHS 800



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++ GHS  ++ V  S+DG   +S S+D +LRLWD   G+   +FE H+
Sbjct: 375 KIDGHSGDVTSVNFSTDGTTIVSASYDNSLRLWDATTGQQKAKFEGHS 422



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T+R    WV  I  +P   +++   S+D ++ +  +       G  + +L GH+  ++ V
Sbjct: 888  TIRFSPRWVCAICFSPD-GNILAFGSKDHSIRLLDVKT-----GYQKAKLDGHTQKVNSV 941

Query: 248  VLSSDGNYALSGSWDKTLRLW 310
              S DG    S S D T+RLW
Sbjct: 942  CFSPDGTTLASCSDDNTIRLW 962



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 6/100 (6%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL------TRDENNYGIPQKRLYGHSHFI 238
            GH   VT +  +      + S S DK + +W +      T+ ++++G     +     ++
Sbjct: 840  GHQYTVTSVRFS--LDGTLASCSYDKFISLWNVKIGQQKTKLDSHFG-QDNTIRFSPRWV 896

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              +  S DGN    GS D ++RL D+  G    + + HT+
Sbjct: 897  CAICFSPDGNILAFGSKDHSIRLLDVKTGYQKAKLDGHTQ 936


>UniRef50_Q4WH28 Cluster: Pfs, NACHT and WD domain protein; n=4;
            Pezizomycotina|Rep: Pfs, NACHT and WD domain protein -
            Aspergillus fumigatus (Sartorya fumigata)
          Length = 1454

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 33/96 (34%), Positives = 47/96 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  WV  +A +P     + S+S DKT+ +W         G  ++ L  H  ++  V 
Sbjct: 1106 LEGHQNWVRAVAFSPD-GQTVASASDDKTIRLWDAAS-----GAEKQVLKAHKKWVRAVA 1159

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    S S DKT+RLWD A+G   +  + H K
Sbjct: 1160 FSPDGQTVASASDDKTIRLWDAASGAEKQVLKGHEK 1195



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 32/96 (33%), Positives = 47/96 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV  +A +P     + S+S D T+ +W         G  ++ L GH   ++ V 
Sbjct: 938  LKGHENWVNAVAFSPD-GQTVASASNDMTIRLWDAAS-----GAEKQVLKGHEKSVNAVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    S S D T+RLWD A+G   +  + H K
Sbjct: 992  FSPDGQTVASASNDMTIRLWDAASGAEKQVLKGHEK 1027



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 31/94 (32%), Positives = 49/94 (52%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +A +P     + S+S DKT+ +W         G  ++ L GH +++S V 
Sbjct: 1232 LKGHENSVNAVAFSPD-GQTVASASDDKTIRLWDAAS-----GAEKQVLKGHENWVSAVA 1285

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S+D T++LWD A+G   +  + H
Sbjct: 1286 FSPDGQTVASASFDTTIQLWDAASGAEKQVLKGH 1319



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/94 (32%), Positives = 46/94 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+ H  WV  +A +P     + S+S DKT+ +W         G  ++ L GH   +  V 
Sbjct: 1148 LKAHKKWVRAVAFSPD-GQTVASASDDKTIRLWDAAS-----GAEKQVLKGHEKSVRAVA 1201

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S+D T+RLWD A+G   +  + H
Sbjct: 1202 FSPDGQTVASASFDTTIRLWDAASGAEKQVLKGH 1235



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 32/96 (33%), Positives = 48/96 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +P     + S+S DKT+ +W         G  ++ L GH ++++ V 
Sbjct: 896  LEGHENSVNAVAFSPD-GQTVASASDDKTIRLWDAAS-----GAEKQVLKGHENWVNAVA 949

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    S S D T+RLWD A+G   +  + H K
Sbjct: 950  FSPDGQTVASASNDMTIRLWDAASGAEKQVLKGHEK 985



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/94 (32%), Positives = 46/94 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +A +P     + S+S D T+ +W         G  ++ L GH   ++ V 
Sbjct: 980  LKGHEKSVNAVAFSPD-GQTVASASNDMTIRLWDAAS-----GAEKQVLKGHEKSVNAVA 1033

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S+D T+RLWD A+G   +  E H
Sbjct: 1034 FSPDGQTVASASFDTTIRLWDAASGAEKQVLEGH 1067



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/96 (33%), Positives = 47/96 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +P     + S+S D T+ +W         G  ++ L GH +++  V 
Sbjct: 1064 LEGHENCVRAVAFSPD-GQTVASASDDMTVWLWDAAS-----GAEKQVLEGHQNWVRAVA 1117

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    S S DKT+RLWD A+G   +  + H K
Sbjct: 1118 FSPDGQTVASASDDKTIRLWDAASGAEKQVLKAHKK 1153



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/94 (32%), Positives = 47/94 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +A +P     + S+S D T+ +W         G  ++ L GH + ++ V 
Sbjct: 1190 LKGHEKSVRAVAFSPD-GQTVASASFDTTIRLWDAAS-----GAEKQVLKGHENSVNAVA 1243

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S DKT+RLWD A+G   +  + H
Sbjct: 1244 FSPDGQTVASASDDKTIRLWDAASGAEKQVLKGH 1277



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 30/94 (31%), Positives = 44/94 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +A +P     + S+S D T+ +W         G  ++ L GH + +  V 
Sbjct: 1022 LKGHEKSVNAVAFSPD-GQTVASASFDTTIRLWDAAS-----GAEKQVLEGHENCVRAVA 1075

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S D T+ LWD A+G   +  E H
Sbjct: 1076 FSPDGQTVASASDDMTVWLWDAASGAEKQVLEGH 1109



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV+ +A +P     + S+S D T+ +W         G  ++ L GH + ++ V 
Sbjct: 1274 LKGHENWVSAVAFSPD-GQTVASASFDTTIQLWDAAS-----GAEKQVLKGHENSVNAVA 1327

Query: 251  LSSDGNYALSG------SWDKTLRLWDLAAG 325
             S DG    S       S D T+RLWD A+G
Sbjct: 1328 FSPDGQTVASASNDTTISNDTTIRLWDAASG 1358


>UniRef50_A6RMS9 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 750

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 39/97 (40%), Positives = 54/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR TL GH G +T IA +P     I S S D+T+ +W    D  N G  +K L GH+  I
Sbjct: 545 LRKTLIGHTGEITAIAFSPD-DKQIASGSNDRTIKLW----DSIN-GNLRKTLIGHTGEI 598

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLA-AGKTTRRFE 346
           + +  S D     SGS D+T++LWD+A   K +R F+
Sbjct: 599 TAIAFSPDDKQIASGSNDRTIKLWDIAEVLKVSRIFD 635



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I S S DKT+ +W    D  N G  +K L GH+  I+ +  S D     SGS D+T++LW
Sbjct: 526 IASGSNDKTIKLW----DSIN-GNLRKTLIGHTGEITAIAFSPDDKQIASGSNDRTIKLW 580

Query: 311 DLAAGKTTRRFEDHT 355
           D   G   +    HT
Sbjct: 581 DSINGNLRKTLIGHT 595



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 5/96 (5%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLI---VW--KLTRDENNYGIPQKRLYGHSHFISDV 247
           N W  QI ++      + S  R + L    VW  K ++ E  +  P +    +S+ +  +
Sbjct: 458 NFWPLQIYSSAMVFSPVTSIIRKRNLDKLPVWLRKFSQVEYPWSAPIEMYTDYSNRVRII 517

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS DKT++LWD   G   +    HT
Sbjct: 518 TFSPDGKQIASGSNDKTIKLWDSINGNLRKTLIGHT 553


>UniRef50_UPI000023D3AB Cluster: hypothetical protein FG08952.1; n=1;
            Gibberella zeae PH-1|Rep: hypothetical protein FG08952.1
            - Gibberella zeae PH-1
          Length = 1113

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 33/104 (31%), Positives = 52/104 (50%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L GH+  +  +  +      + SSS DKT+ +W     E      ++ L G
Sbjct: 820  AETGECEQVLEGHSDDIRSVVFSHD-SKKVASSSWDKTIRIWNAETGEC-----EQVLEG 873

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HSH ++ VV S D     SGS DKT+R+W+   G+  R  + H+
Sbjct: 874  HSHIVNSVVFSHDSKKVASGSSDKTIRIWNAETGECERELKGHS 917



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 31/95 (32%), Positives = 49/95 (51%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L+GH+  V  +  +      + S S DKT+ +W     E      ++ L G
Sbjct: 904  AETGECERELKGHSDDVRSVVFSHD-SKKVASGSDDKTIRIWNAETGEC-----ERVLEG 957

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            HS++++ VV S D     SGSWD T+R+WD   G+
Sbjct: 958  HSNWVNPVVFSHDSKKVASGSWDNTIRIWDAETGE 992



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/104 (31%), Positives = 49/104 (47%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L GH+  V  +  +      + S S DKT+ +W     E      ++ L G
Sbjct: 862  AETGECEQVLEGHSHIVNSVVFSHD-SKKVASGSSDKTIRIWNAETGEC-----ERELKG 915

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            HS  +  VV S D     SGS DKT+R+W+   G+  R  E H+
Sbjct: 916  HSDDVRSVVFSHDSKKVASGSDDKTIRIWNAETGECERVLEGHS 959



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/106 (30%), Positives = 49/106 (46%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET +    L GH+  V  +  +      + S S D T+ +W     E      ++ L G
Sbjct: 778  AETGECERVLEGHSHIVNSVVFSHD-SKKVASGSDDDTIWIWNAETGEC-----EQVLEG 831

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            HS  I  VV S D     S SWDKT+R+W+   G+  +  E H+ +
Sbjct: 832  HSDDIRSVVFSHDSKKVASSSWDKTIRIWNAETGECEQVLEGHSHI 877



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 22/63 (34%), Positives = 33/63 (52%)
 Frame = +2

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L + + N+      L GHSH ++ VV S D     SGS D T+R+W+   G+  R  E H
Sbjct: 731 LPKVKENWDACLLTLEGHSHIVNSVVFSHDSKKVASGSDDDTIRIWNAETGECERVLEGH 790

Query: 353 TKV 361
           + +
Sbjct: 791 SHI 793


>UniRef50_Q3MB32 Cluster: Peptidase C14, caspase catalytic subunit
            p20; n=1; Anabaena variabilis ATCC 29413|Rep: Peptidase
            C14, caspase catalytic subunit p20 - Anabaena variabilis
            (strain ATCC 29413 / PCC 7937)
          Length = 1240

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 35/82 (42%), Positives = 44/82 (53%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH G V  +A +P     I+S S D TL +W +    N   I Q  L GH   ++ V 
Sbjct: 905  LIGHEGEVKSVAFSPD-GQRIVSGSWDNTLRLWNV----NGQPIGQP-LIGHEGAVNSVA 958

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG   +SGSWD TLRLWD+
Sbjct: 959  FSPDGQCIVSGSWDNTLRLWDV 980



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 35/82 (42%), Positives = 42/82 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +P     I+S S D TL +W    D N   I Q  L GH   +  V 
Sbjct: 989  LIGHESGVYSVAFSPD-GQRIVSGSGDNTLRLW----DVNGQSIGQP-LIGHESGVYSVA 1042

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG   +SGSWD TLRLWD+
Sbjct: 1043 FSPDGQRIVSGSWDNTLRLWDV 1064



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 35/82 (42%), Positives = 42/82 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +P     I+S S D TL +W    D N   I Q  L GH   +  V 
Sbjct: 1031 LIGHESGVYSVAFSPD-GQRIVSGSWDNTLRLW----DVNGQSIGQP-LIGHESGVYSVA 1084

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG   +SGSWD TLRLWD+
Sbjct: 1085 FSPDGQRIVSGSWDNTLRLWDV 1106



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 35/88 (39%), Positives = 46/88 (52%)
 Frame = +2

Query: 53   LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
            + L   ++GH   V  +A +P     I+S S DKTL +W    D N   I Q  L GH  
Sbjct: 815  VNLPNIIQGHESGVNSVAFSPD-GQRIVSGSGDKTLRLW----DVNGQPIGQP-LIGHEG 868

Query: 233  FISDVVLSSDGNYALSGSWDKTLRLWDL 316
             +  V  S DG   +SGS DKTLRLW++
Sbjct: 869  AVKSVAFSPDGQRIVSGSGDKTLRLWNV 896



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 31/80 (38%), Positives = 38/80 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +P     I+S S D TL +W    D N   I Q  L GH   +  V 
Sbjct: 1073 LIGHESGVYSVAFSPD-GQRIVSGSWDNTLRLW----DVNGQPIGQP-LMGHKAAVISVA 1126

Query: 251  LSSDGNYALSGSWDKTLRLW 310
             S DG   +SGS D  L+LW
Sbjct: 1127 FSPDGQRIVSGSADNKLKLW 1146


>UniRef50_A0ZIJ6 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=2; Nodularia spumigena CCY 9414|Rep:
           Serine/Threonine protein kinase with WD40 repeats -
           Nodularia spumigena CCY 9414
          Length = 511

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 32/97 (32%), Positives = 48/97 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV+ +A +P     + S S D T+ +W L   +           GHS  +S V
Sbjct: 270 TLTGHSDWVSSVAISPD-GRTLASGSSDNTIKLWNLQTQQQI-----ATFTGHSEGVSSV 323

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +S DG    SGS D T++LW+L   +    F  H++
Sbjct: 324 AISPDGRTLASGSSDNTIKLWNLQTQQQIATFTGHSE 360



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 36/101 (35%), Positives = 52/101 (51%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHF 235
           L  TL GH+  V  +A +P     + S S DKT+ +W L T+ E         L GHS +
Sbjct: 225 LGATLTGHSEGVRSVAISPD-GRTLASGSNDKTIKLWNLQTQGEI------ATLTGHSDW 277

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +S V +S DG    SGS D T++LW+L   +    F  H++
Sbjct: 278 VSSVAISPDGRTLASGSSDNTIKLWNLQTQQQIATFTGHSE 318



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYG 223
           +T +   T  GH+ WV  +A +P     + S S DKT+ +W L T+ E         L G
Sbjct: 347 QTQQQIATFTGHSEWVWSVAISPD-GRTLASGSDDKTIKLWNLQTQGEI------ATLTG 399

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           HS  +  V +S DG    SGS DKT++LW+L
Sbjct: 400 HSQAVRSVAISPDGRTLASGSDDKTIKLWNL 430



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 1/99 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISD 244
           TL GH+  V  +A +P     + S S DKT+ +W L T+ E         L  HS  +  
Sbjct: 396 TLTGHSQAVRSVAISPD-GRTLASGSDDKTIKLWNLQTQGEI------ATLTRHSESVLS 448

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           V +S DG    SGS D T++LW+L        F  H+ V
Sbjct: 449 VAISPDGRTLASGSGDWTIKLWNLQTQGEIATFTGHSYV 487


>UniRef50_Q8YL09 Cluster: WD-repeat protein; n=3; Cyanobacteria|Rep:
           WD-repeat protein - Anabaena sp. (strain PCC 7120)
          Length = 1189

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 49/98 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+  V  +  +P    ++ ++  D T+ +W+L       G   K L GH H++  +
Sbjct: 683 TFLGHDACVWSVVFHP-VGQILATAGEDNTIKLWELQS-----GCCLKTLQGHQHWVKTI 736

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             +S G    SGS+D+ ++LWD+  GK     + HT V
Sbjct: 737 AFNSGGRILASGSFDQNVKLWDIHTGKCVMTLQGHTGV 774



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 26/91 (28%), Positives = 46/91 (50%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           HN W+  +A +   P ++ S  +D T+ +W  T  E         L+GH+  ++ V  S 
Sbjct: 603 HNSWIWDVAFSSVAP-VLASCGQDHTIKLWNTTTGECF-----NTLHGHTSIVTSVAFSP 656

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +G    S S+D ++++WDL  G+  + F  H
Sbjct: 657 EGKLLASSSYDHSVKVWDLDTGECLQTFLGH 687



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/96 (30%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH  WV  IA N     ++ S S D+ + +W +     + G     L GH+  ++ V
Sbjct: 725 TLQGHQHWVKTIAFNSG-GRILASGSFDQNVKLWDI-----HTGKCVMTLQGHTGVVTSV 778

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +   N  LSGS+D+++++WD   G+     + HT
Sbjct: 779 AFNPKDNLLLSGSYDQSVKVWDRKTGRCLDTLKKHT 814



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 4/99 (4%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT----RDENNYGIPQKRLYGHSHF 235
            T +GH+     IA N ++  ++ S   D+T+ +W L        N    P + L GHS+ 
Sbjct: 851  TFQGHSNATYTIAHNWEH-SLLASGHEDQTIKLWDLNLHSPHKSNVNTHPFRILQGHSNR 909

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  VV SS G    SGS D+T++LW    G+       H
Sbjct: 910  VFSVVFSSTGQLLASGSADRTIKLWSPHTGQCLHTLHGH 948



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/87 (31%), Positives = 43/87 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   V  I        MI SSS D+T+ +W ++  E         L  H H++  +
Sbjct: 1070 TFSGHTSQVICILFTKDGRRMI-SSSSDRTIKIWNVSTGEC-----LATLQAHDHWVWSL 1123

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
             L+ D    LS SWD+T++ W+++ G+
Sbjct: 1124 YLTPDEKTLLSSSWDETIKCWNISTGE 1150



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 24/94 (25%), Positives = 48/94 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+  V  +  +     ++ S S D+T+ +W       + G     L+GH  ++  + 
Sbjct: 903  LQGHSNRVFSVVFSST-GQLLASGSADRTIKLWS-----PHTGQCLHTLHGHGSWVWAIA 956

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S D     SGS+D T+++WD+++G+  +  + H
Sbjct: 957  FSLDDKLLASGSYDHTVKIWDVSSGQCLQTLQGH 990



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/93 (29%), Positives = 43/93 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  IA +     ++ S S D T+ +W ++      G   + L GH   +  V
Sbjct: 944  TLHGHGSWVWAIAFSLD-DKLLASGSYDHTVKIWDVSS-----GQCLQTLQGHPGSVLAV 997

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
              S DG    S  ++K ++ WD+  G   + +E
Sbjct: 998  AFSCDGKTLFSSGYEKLVKQWDVETGYCLQTWE 1030



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 29/96 (30%), Positives = 44/96 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH G V  +A +      + SS  +K +  W +   E  Y +  +     S+ +  V
Sbjct: 986  TLQGHPGSVLAVAFSCD-GKTLFSSGYEKLVKQWDV---ETGYCL--QTWEADSNRVWAV 1039

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +S D  Y  +G  D  +RLWD+  G   R F  HT
Sbjct: 1040 AVSRDNQYLATGGDDSVVRLWDIGKGVCVRTFSGHT 1075



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 16/88 (18%), Positives = 43/88 (48%)
 Frame = +2

Query: 89   WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGN 268
            W   ++ + +Y   + +   D  + +W + +     G+  +   GH+  +  ++ + DG 
Sbjct: 1037 WAVAVSRDNQY---LATGGDDSVVRLWDIGK-----GVCVRTFSGHTSQVICILFTKDGR 1088

Query: 269  YALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +S S D+T+++W+++ G+     + H
Sbjct: 1089 RMISSSSDRTIKIWNVSTGECLATLQAH 1116



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 22/83 (26%), Positives = 39/83 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+ H   +  +A +P+   + +S   D    +W+L       G   K   GHS+    +
Sbjct: 809  TLKKHTNRIWSVAFHPQ-GHLFVSGGDDHAAKIWEL-----GTGQCIKTFQGHSNATYTI 862

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              + + +   SG  D+T++LWDL
Sbjct: 863  AHNWEHSLLASGHEDQTIKLWDL 885


>UniRef50_Q9X4P4 Cluster: Putative regulatory protein WdlA; n=1;
            Streptomyces lincolnensis|Rep: Putative regulatory
            protein WdlA - Streptomyces lincolnensis
          Length = 971

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 48/94 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH   V  +A +P     + S S D+T+ VW +T  +  +  P   L GH HF+  +
Sbjct: 763  SLVGHTANVKPVAFSPD-GRTLASGSDDRTIRVWDVT--DPRHATPVAVLKGHRHFVDAL 819

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              S DG   LSGS D T +LWD++     RR  D
Sbjct: 820  AYSPDGRTLLSGSDDHTAKLWDISDLPRHRRLSD 853



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 21/74 (28%), Positives = 33/74 (44%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D ++    D  L +W + RD     +  KR  GH+  +  + L  DG  A +  +D  L 
Sbjct: 690 DTLVGVGSDHVLRLWDV-RDPRRPTLLCKRPTGHTEAVYSLALRHDGRLAATSGYDDVLH 748

Query: 305 LWDLAAGKTTRRFE 346
           LWD+      RR +
Sbjct: 749 LWDITDPARPRRLD 762


>UniRef50_Q16SH0 Cluster: Striatin, putative; n=2; Bilateria|Rep:
           Striatin, putative - Aedes aegypti (Yellowfever
           mosquito)
          Length = 477

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 32/104 (30%), Positives = 57/104 (54%), Gaps = 2/104 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYP--DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           L+    +R ++G ++ + T   +P  D+++++ RD T  VW +    N +      L GH
Sbjct: 238 LEYNKVIRHYHGHLSAVYTMALHPTIDVLVTAGRDSTARVWDMRTKANIH-----TLGGH 292

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ ++ VV  +     ++GS D T+RLWDLAAGK+     +H K
Sbjct: 293 TNTVASVVCQAANPQVITGSHDSTVRLWDLAAGKSMCTLTNHKK 336



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 28/108 (25%), Positives = 44/108 (40%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P  K     KL   + GH GWV  +A  P   +   + + D+ + +W L       G  +
Sbjct: 149 PKPKWHAPWKLCRVISGHLGWVRCVAVEPGN-EWFATGAADRVIKIWDLAS-----GKLK 202

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             L GH   +  + +S    Y  S   D+ ++ WDL   K  R +  H
Sbjct: 203 LSLTGHVSTVRGLCVSPRHPYLFSCGEDRQVKCWDLEYNKVIRHYHGH 250


>UniRef50_A0CH87 Cluster: Chromosome undetermined scaffold_18, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_18,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 403

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 33/95 (34%), Positives = 54/95 (56%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   V  +A +P     I S+S D ++ +W+L   +N+  +  K L GH H +S V
Sbjct: 142 TLKGHTSNVNCLAFDPT-GKYICSASSDLSIKLWEL---KNHTCV--KTLIGHEHSVSTV 195

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S  G++ LS S DK+++LW++  G   + F +H
Sbjct: 196 QFSDHGDFILSASRDKSIKLWEVQTGFCKKTFSEH 230



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           ++++S SRDK + +W      N +      L GH ++++ V    DG + LS S DKT+R
Sbjct: 303 NLLVSVSRDKEIKIWNTILGTNLF-----TLSGHDNWVNGVSFHPDGVHMLSVSDDKTIR 357

Query: 305 LWDLAAGKTTRRFED-HTK 358
           +W+L   K  ++ E+ H K
Sbjct: 358 VWNLKEQKQKKKIENAHDK 376



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 24/82 (29%), Positives = 43/82 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +A +P+Y  ++ S+S D ++ +W     +   G  +K L GH+  ++ + 
Sbjct: 101 LEGHRAGVNCVAFHPQY-QILGSASDDGSIKLW-----DYESGHFEKTLKGHTSNVNCLA 154

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
               G Y  S S D +++LW+L
Sbjct: 155 FDPTGKYICSASSDLSIKLWEL 176



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  ++ +P    M LS S DKT+ VW L   +    I       H  FI   
Sbjct: 327 TLSGHDNWVNGVSFHPDGVHM-LSVSDDKTIRVWNLKEQKQKKKIEN----AHDKFILKC 381

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
            ++       + S D+T++LW L+
Sbjct: 382 EINK--FIFATCSVDQTIKLWLLS 403


>UniRef50_Q10Y55 Cluster: WD-40 repeat; n=1; Trichodesmium erythraeum
            IMS101|Rep: WD-40 repeat - Trichodesmium erythraeum
            (strain IMS101)
          Length = 1858

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 48/82 (58%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GHN  V  +  +P+  ++I S+S DKT+ +W  +RD    G  QK L  H + +S + 
Sbjct: 1114 LEGHNNIVWSVIFHPE-GNLIASASADKTIKLW--SRD----GKLQKTLTNHKNRVSKIS 1166

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             SSDG Y  S S D T+++WDL
Sbjct: 1167 FSSDGKYLASASHDSTVKIWDL 1188



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   VTQ+  +P   + + S+S DKT+  W L  D  N       L GH H +  V
Sbjct: 1367 TFSGHGDTVTQVTFSPD-GETLASASYDKTIKFWSLKNDSLNV------LQGHKHRVLGV 1419

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    S S D T++LW    GK     E HT
Sbjct: 1420 SFSPDGQILASASQDNTIKLWS-PTGKLLNNLEGHT 1454



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 31/86 (36%), Positives = 42/86 (48%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  T+ GH   V   + +P    +I SSS DKT+ VW+L       G   K   GH   +
Sbjct: 1323 LEKTITGHKKQVINASFSPD-GKIIASSSTDKTIKVWQLD------GTLLKTFSGHGDTV 1375

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDL 316
            + V  S DG    S S+DKT++ W L
Sbjct: 1376 TQVTFSPDGETLASASYDKTIKFWSL 1401



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 31/96 (32%), Positives = 50/96 (52%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL GHN WV+ ++ +P    ++ S+S D T+ +W         G+  K +  HS +
Sbjct: 1662 KLLKTLVGHNEWVSSVSFSPD-GKILASASDDGTVKLW------TQKGVLLKTINAHSGW 1714

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            +  V  S +G    + S+D T++LW L  G+  R F
Sbjct: 1715 VLGVSFSPNGQAIATASYDNTVKLWSL-DGELLRTF 1749



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            LR  L+G +  VT ++ +P     I SSS D  + +W L       G   K L GH   +
Sbjct: 1746 LRTFLKGASDSVTSVSFSPD-GQAIASSSYDGKVKLWSLYD-----GSLLKTLNGHQDSV 1799

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLA 319
              V  S DG    SGS DKT+ LWDLA
Sbjct: 1800 MSVSFSPDGKLLASGSRDKTVILWDLA 1826



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 36/117 (30%), Positives = 55/117 (47%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            A+G   L+    K+ +TLK  G    HN  V     +P    M+ +S  D+T+ +W+  R
Sbjct: 1262 ANGTVQLWNLNGKLLKTLK-HGA-GNHNYPVYSANFSPDGKRMVTASG-DQTVKIWRFFR 1318

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               N  I +K + GH   + +   S DG    S S DKT+++W L  G   + F  H
Sbjct: 1319 ---NIPILEKTITGHKKQVINASFSPDGKIIASSSTDKTIKVWQL-DGTLLKTFSGH 1371



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/80 (35%), Positives = 41/80 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   +  ++ +P    +I SS +DKT+ +W      N  G   K L GH+ ++S V 
Sbjct: 1626 LIGHTDSLLSVSFSPNN-QVIASSGKDKTIRLW------NREGKLLKTLVGHNEWVSSVS 1678

Query: 251  LSSDGNYALSGSWDKTLRLW 310
             S DG    S S D T++LW
Sbjct: 1679 FSPDGKILASASDDGTVKLW 1698



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 27/95 (28%), Positives = 45/95 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T+  H+GWV  ++ +P     I ++S D T+ +W L  +     + +  L G S  ++ V
Sbjct: 1707 TINAHSGWVLGVSFSPN-GQAIATASYDNTVKLWSLDGE-----LLRTFLKGASDSVTSV 1760

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    S S+D  ++LW L  G   +    H
Sbjct: 1761 SFSPDGQAIASSSYDGKVKLWSLYDGSLLKTLNGH 1795



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/82 (32%), Positives = 43/82 (52%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  ++ +P    ++ S+S+D T+ +W  T      G     L GH+  ++ V 
Sbjct: 1409 LQGHKHRVLGVSFSPD-GQILASASQDNTIKLWSPT------GKLLNNLEGHTDRVASVS 1461

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             SSD     SGS+D T++LW L
Sbjct: 1462 FSSDAQILASGSYDNTVKLWYL 1483



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 2/102 (1%)
 Frame = +2

Query: 14   SSLFKPFSKMSETLKLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDE 187
            +S  K     S   KL+ TL  H   V++I+  ++ KY   + S+S D T+ +W L + E
Sbjct: 1136 ASADKTIKLWSRDGKLQKTLTNHKNRVSKISFSSDGKY---LASASHDSTVKIWDLQQLE 1192

Query: 188  NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
                +    L  HS  +  +  S +     SGS DKT+++W+
Sbjct: 1193 ----MKPLSLKSHSDSVVTINFSPNNKMLASGSLDKTIKIWN 1230



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
            TL GH   V  ++ +P    ++ S SRDKT+I+W L  D
Sbjct: 1791 TLNGHQDSVMSVSFSPD-GKLLASGSRDKTVILWDLALD 1828


>UniRef50_A7C2D9 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=2; Bacteria|Rep: Serine/Threonine protein
           kinase with WD40 repeats - Beggiatoa sp. PS
          Length = 309

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/94 (32%), Positives = 50/94 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +P    ++ S S+D T+ VW++   +  +      L GH   +  V
Sbjct: 22  TLYGHDDIVWSVAFSPD-GQLLASGSKDNTIKVWEVNTRKLLH-----TLQGHEKDVFSV 75

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             S +G    SGSWDKT++LW ++ GK    F++
Sbjct: 76  AFSPNGRLIASGSWDKTVKLWRMSDGKLLETFQE 109



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/88 (34%), Positives = 46/88 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +      + S+S DKT+ +W++     N G  Q+ L  H   +  V
Sbjct: 150 TLEGHEDAVWSVAFSNDN-QRLASASYDKTIKLWEM-----NEGTLQRTLTKHQDSVFAV 203

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKT 331
             + DG+Y  S S DKT +LWD+  G++
Sbjct: 204 AFNPDGHYLASASHDKTFKLWDVEEGQS 231



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           LYGH   +  V  S DG    SGS D T+++W++   K     + H K
Sbjct: 23  LYGHDDIVWSVAFSPDGQLLASGSKDNTIKVWEVNTRKLLHTLQGHEK 70



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 29/103 (28%), Positives = 46/103 (44%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           V  +A +P    ++ +   + T+ VWK+    + Y      L GH   +  V  S+D   
Sbjct: 116 VNTVAFSPD-GSLLAAGLWNNTIKVWKVNLAHHLY-----TLEGHEDAVWSVAFSNDNQR 169

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNAD 400
             S S+DKT++LW++  G   R    H    Q+S F    N D
Sbjct: 170 LASASYDKTIKLWEMNEGTLQRTLTKH----QDSVFAVAFNPD 208



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 23/81 (28%), Positives = 38/81 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T++G    V  +A +P     + + + D T+ VW + + +       + L GH   +  V
Sbjct: 234 TMKGFKEVVFSVAFSPD-GQFLATGNDDATIFVWGIEKKQL-----LETLSGHQESVYSV 287

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
           V S DG    S S D T++LW
Sbjct: 288 VFSPDGQLLASASGDNTIKLW 308



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 24/98 (24%), Positives = 42/98 (42%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL  H   V  +A NP     + S+S DKT  +W +   ++ +      + G    +
Sbjct: 189 LQRTLTKHQDSVFAVAFNPD-GHYLASASHDKTFKLWDVEEGQSLF-----TMKGFKEVV 242

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  S DG +  +G+ D T+ +W +   +       H
Sbjct: 243 FSVAFSPDGQFLATGNDDATIFVWGIEKKQLLETLSGH 280


>UniRef50_A0YUL3 Cluster: Peptidase C14, caspase catalytic subunit
            p20; n=2; Cyanobacteria|Rep: Peptidase C14, caspase
            catalytic subunit p20 - Lyngbya sp. PCC 8106
          Length = 1245

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 36/117 (30%), Positives = 60/117 (51%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            + G ++  K +++  ET +L  TL GHN  V  ++ +      I+S S D T+ VW L  
Sbjct: 1030 SGGDNNTIKVWNR--ETGELIRTLTGHNSLVYSVSISND-SKTIVSGSWDNTIKVWNLET 1086

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             E       + L GH + ++ V +S+D    +SGSWD T+++W+   G+  R    H
Sbjct: 1087 GELI-----RTLTGHGNPVNSVSISNDSKTIVSGSWDNTIKVWNRETGELIRTLTGH 1138



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 31/97 (31%), Positives = 52/97 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ +V  ++ +      I+S S D T+ VW L   E       + L GH + +  V
Sbjct: 673 TLKGHDNYVWSVSISND-SKTIVSGSGDNTIKVWNLETGELI-----RTLTGHRYGVRSV 726

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +S+D    +SGS DKT+++W+L  G+  R  + H +
Sbjct: 727 SISNDSKTIVSGSDDKTIKVWNLETGELIRTLKGHDR 763



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/102 (32%), Positives = 52/102 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET +L  TL+GH+  V+ ++ +      I+S S DKT+ VW         G   + L GH
Sbjct: 750  ETGELIRTLKGHDREVSSVSISND-SKTIVSGSDDKTIKVWN-----RETGAEIRTLTGH 803

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + +  V +S+D    +SGS D T+++W+L  GK       H
Sbjct: 804  RYGVRSVSISNDSKTIVSGSGDNTIKVWNLQTGKEISNLTGH 845



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/95 (32%), Positives = 49/95 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH G V  ++ +      I+S S D T+ VW L   E       + L GH + ++ V
Sbjct: 924  TLTGHGGQVYSVSISND-SKTIVSGSDDNTIKVWNLQTGEEI-----RTLTGHDNPVTSV 977

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +S+D    +SGS D T+++W+L  G+  R  + H
Sbjct: 978  SISNDSKTIVSGSEDNTIKVWNLETGEEIRTLKGH 1012



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 28/95 (29%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH  +V  ++ +      I+S   + T+ VW         G   + L GH+  +  V
Sbjct: 1008 TLKGHGSYVRSVSISND-SKTIVSGGDNNTIKVWN-----RETGELIRTLTGHNSLVYSV 1061

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +S+D    +SGSWD T+++W+L  G+  R    H
Sbjct: 1062 SISNDSKTIVSGSWDNTIKVWNLETGELIRTLTGH 1096



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 33/102 (32%), Positives = 49/102 (48%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET +L  TL GH   V  ++ +      I+S S D T+ VW         G   + L GH
Sbjct: 1085 ETGELIRTLTGHGNPVNSVSISND-SKTIVSGSWDNTIKVWN-----RETGELIRTLTGH 1138

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +S V +S+D    +SGS D T+++W+L  G+  R    H
Sbjct: 1139 GSRVSSVSISNDSKTIVSGSSDNTIKVWNLETGELIRTLTGH 1180



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/98 (28%), Positives = 47/98 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  VT ++ +      I+S S D T+ VW L   E       + L GH  ++  V
Sbjct: 966  TLTGHDNPVTSVSISND-SKTIVSGSEDNTIKVWNLETGEEI-----RTLKGHGSYVRSV 1019

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             +S+D    +SG  + T+++W+   G+  R    H  +
Sbjct: 1020 SISNDSKTIVSGGDNNTIKVWNRETGELIRTLTGHNSL 1057



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 30/95 (31%), Positives = 47/95 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH+  V  ++ +      I+S S D T+ VW L   E       + L GH   +  V
Sbjct: 883  TLKGHDNHVWSVSISND--GTIVSCSWDNTIKVWNLETGEEI-----RTLTGHGGQVYSV 935

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +S+D    +SGS D T+++W+L  G+  R    H
Sbjct: 936  SISNDSKTIVSGSDDNTIKVWNLQTGEEIRTLTGH 970



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +      I+S S D T+ VW L       G     L GH+  +  V
Sbjct: 799  TLTGHRYGVRSVSISND-SKTIVSGSGDNTIKVWNLQT-----GKEISNLTGHNGQVWSV 852

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +S+D    +SGS D T+++W+L  G+  R  + H
Sbjct: 853  SISNDSKTIVSGSEDSTIKVWNLETGEEIRTLKGH 887



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/90 (33%), Positives = 47/90 (52%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET +L  TL GH   V+ ++ +      I+S S D T+ VW L   E       + L GH
Sbjct: 1127 ETGELIRTLTGHGSRVSSVSISND-SKTIVSGSSDNTIKVWNLETGELI-----RTLTGH 1180

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
               +S V +S+D    +SGS D T+++W++
Sbjct: 1181 GSPVSSVSISNDSKTIVSGSADNTIKVWNI 1210



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I+S S D T+ VW         G   + L GH +++  V +S+D    +SGS D T+++W
Sbjct: 651 IVSGSWDYTIKVWN-----RETGAEIRTLKGHDNYVWSVSISNDSKTIVSGSGDNTIKVW 705

Query: 311 DLAAGKTTRRFEDH 352
           +L  G+  R    H
Sbjct: 706 NLETGELIRTLTGH 719



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           G  + RL GH      + +SSDG   +SGSWD T+++W+   G   R  + H
Sbjct: 626 GRERNRLLGHRSPAYSLSISSDGKTIVSGSWDYTIKVWNRETGAEIRTLKGH 677


>UniRef50_Q9LV27 Cluster: Gb|AAD25820.1; n=10; Viridiplantae|Rep:
           Gb|AAD25820.1 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 305

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/96 (32%), Positives = 53/96 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+ HNG + +   +P    +  +SS DKT+ +W +    + + + +K L GH  ++ D V
Sbjct: 207 LQAHNGHILKCLLSPANKYLATASS-DKTVKIWNV----DGFKL-EKVLTGHQRWVWDCV 260

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S DG + ++ S D T RLW + AGK  + ++ H K
Sbjct: 261 FSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHK 296



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGI--PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           M+++++   T  VW+L R +       P  +L  H+  I   +LS    Y  + S DKT+
Sbjct: 176 MVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTV 235

Query: 302 RLWDLAAGKTTRRFEDHTK 358
           ++W++   K  +    H +
Sbjct: 236 KIWNVDGFKLEKVLTGHQR 254


>UniRef50_A0CRW5 Cluster: Chromosome undetermined scaffold_25, whole
            genome shotgun sequence; n=6; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_25, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2569

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/103 (29%), Positives = 55/103 (53%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH+ +V  +  +P     + S S D ++ +W +       G  + +L GH
Sbjct: 2330 KTGQQKAKLDGHSNYVMSVNFSPD-STTLASGSYDNSIRLWDVKT-----GQQKAKLDGH 2383

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S+++  V  S DG    SGS+DK++ LWD+  G+   +F+ H+
Sbjct: 2384 SNYVMSVNFSPDGTTLASGSYDKSIHLWDVKTGQQKAKFDGHS 2426



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 30/104 (28%), Positives = 53/104 (50%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH+ +V  +  +P     + S S DK++ +W +       G  + +  GH
Sbjct: 2372 KTGQQKAKLDGHSNYVMSVNFSPD-GTTLASGSYDKSIHLWDVKT-----GQQKAKFDGH 2425

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S+ +  V  S DG    SGS+D ++RLWD+  G+     E H++
Sbjct: 2426 SNTVYSVNFSPDGTTLASGSYDNSIRLWDVKTGQQKPILEGHSR 2469



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/47 (38%), Positives = 28/47 (59%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            L GHS  ++ V  S DG    SGS+D ++RLWD+  G+   + + H+
Sbjct: 2296 LIGHSSAVASVNFSPDGTILASGSYDNSIRLWDVKTGQQKAKLDGHS 2342


>UniRef50_Q09715 Cluster: Transcriptional repressor tup11; n=2;
           Schizosaccharomyces pombe|Rep: Transcriptional repressor
           tup11 - Schizosaccharomyces pombe (Fission yeast)
          Length = 614

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 7/101 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL--TRDENNYGI-PQ---KRLY-GHS 229
           L GH   V  IA +P    ++LS S DKT+ VW+L  TR      I P+   K  Y GH+
Sbjct: 480 LEGHKESVYSIAFSPD-SSILLSGSLDKTIKVWELQATRSVGLSAIKPEGICKATYTGHT 538

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            F+  V +S D  + LSGS D++++ WDL  G++    + H
Sbjct: 539 DFVLSVAVSPDSRWGLSGSKDRSMQFWDLQTGQSYLTCQGH 579



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           NG VT IA +P     I   S D+ + VW ++      G   +RL GH   +  +  S D
Sbjct: 444 NG-VTAIAISPN-DQFIAVGSLDQIIRVWSVS------GTLVERLEGHKESVYSIAFSPD 495

Query: 263 GNYALSGSWDKTLRLWDLAAGKT 331
            +  LSGS DKT+++W+L A ++
Sbjct: 496 SSILLSGSLDKTIKVWELQATRS 518



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 24/86 (27%), Positives = 43/86 (50%)
 Frame = +2

Query: 89  WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGN 268
           +V  IA +P     +++ + D+ + +W L+  +  Y        GH   I  +  S +G 
Sbjct: 362 YVRTIAFSPD-GKYLVTGTEDRQIKLWDLSTQKVRYVFS-----GHEQDIYSLDFSHNGR 415

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFE 346
           + +SGS D+T RLWD+  G+   + E
Sbjct: 416 FIVSGSGDRTARLWDVETGQCILKLE 441



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 26/85 (30%), Positives = 40/85 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           + T  GH  +V  +A +P      LS S+D+++  W L   ++ Y   Q    GH + + 
Sbjct: 531 KATYTGHTDFVLSVAVSPD-SRWGLSGSKDRSMQFWDLQTGQS-YLTCQ----GHKNSVI 584

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL 316
            V  S DG    SGS D   R+W +
Sbjct: 585 SVCFSPDGRQFASGSGDLRARIWSI 609



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = +2

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  +  S DG Y ++G+ D+ ++LWDL+  K    F  H
Sbjct: 362 YVRTIAFSPDGKYLVTGTEDRQIKLWDLSTQKVRYVFSGH 401


>UniRef50_Q9BVA0 Cluster: Katanin p80 WD40-containing subunit B1;
           n=24; Tetrapoda|Rep: Katanin p80 WD40-containing subunit
           B1 - Homo sapiens (Human)
          Length = 655

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/103 (32%), Positives = 50/103 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH   +  +  +P Y + + S S+D  + +W + R    +     R  GH
Sbjct: 93  EAAKILRTLMGHKANICSLDFHP-YGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGH 146

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  +  S DG +  S + D T++LWDL AGK    F  HT
Sbjct: 147 SQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT 189



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 24/97 (24%), Positives = 43/97 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +  N    ++I++ S+  ++ VW L   +       + L GH   I  +
Sbjct: 58  SLTGHTSPVESVRLNTP-EELIVAGSQSGSIRVWDLEAAKI-----LRTLMGHKANICSL 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  ++LWD+       R+  H++
Sbjct: 112 DFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQ 148



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH+  V  +  +P     + S++ D T+ +W LT  +     P     GH+  ++ V  
Sbjct: 144 RGHSQAVRCLRFSPD-GKWLASAADDHTVKLWDLTAGKMMSEFP-----GHTGPVNVVEF 197

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
             +     SGS D+T+R WDL
Sbjct: 198 HPNEYLLASGSSDRTIRFWDL 218


>UniRef50_UPI0000498AC0 Cluster: WD repeat protein; n=2; Entamoeba
           histolytica HM-1:IMSS|Rep: WD repeat protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 116

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 31/103 (30%), Positives = 57/103 (55%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           TL L  +   H+ + T    +P   ++  +S+ D+T+ +WK+   + NY + Q  L GH+
Sbjct: 6   TLSLITSFEAHSTFGTCCKYSPNTLNLATASA-DRTIKIWKV---KQNYSLVQT-LNGHN 60

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++ D+  S++  Y +S S D T +LWDL +G+  + +  H K
Sbjct: 61  GWVWDITFSNNSEYLISASTDTTAKLWDLKSGEAIQTYAVHEK 103



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQK 211
           K+ +   L  TL GHNGWV  I T     + ++S+S D T  +W L   E    Y + +K
Sbjct: 45  KVKQNYSLVQTLNGHNGWVWDI-TFSNNSEYLISASTDTTAKLWDLKSGEAIQTYAVHEK 103


>UniRef50_Q8YMQ6 Cluster: WD-repeat protein; n=3; Nostocaceae|Rep:
           WD-repeat protein - Anabaena sp. (strain PCC 7120)
          Length = 598

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P   L GH H +  + +S DG   +SGSWD+T+++W LA G+  R  + HT
Sbjct: 476 PLHTLMGHGHIVRSLAMSKDGQLLISGSWDQTIKIWHLATGRLIRTLKGHT 526



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 32/98 (32%), Positives = 49/98 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A + K   +++S S D+T+ +W L       G   + L GH+  +  +
Sbjct: 479 TLMGHGHIVRSLAMS-KDGQLLISGSWDQTIKIWHLAT-----GRLIRTLKGHTDKVYAI 532

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            LS D     SGS D+T++LW L  G+    F  HT +
Sbjct: 533 ALSPDEQIIASGSSDQTIKLWHLETGELLATFTGHTDI 570



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 29/87 (33%), Positives = 45/87 (51%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  TL+GH   V  IA +P    +I S S D+T+ +W L   E           GH+
Sbjct: 515 TGRLIRTLKGHTDKVYAIALSPD-EQIIASGSSDQTIKLWHLETGEL-----LATFTGHT 568

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             ++ +  ++ G   +SGS DKT++LW
Sbjct: 569 DIVTALTFTTSGEMLVSGSLDKTIKLW 595


>UniRef50_Q3M9A6 Cluster: WD-40 repeat; n=1; Anabaena variabilis ATCC
            29413|Rep: WD-40 repeat - Anabaena variabilis (strain
            ATCC 29413 / PCC 7937)
          Length = 1196

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 31/95 (32%), Positives = 49/95 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV  ++ +P    ++ S S DK++ +W +       G     LYGH+  ++ V 
Sbjct: 909  LQGHTNWVWSVSFSPD-GSILASGSHDKSIKLWDVIS-----GHCITTLYGHNGGVTSVS 962

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    S S DK+++LWD+   K  +  E HT
Sbjct: 963  FSPDGQTLASASRDKSVKLWDIHERKCVKTLEGHT 997



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 31/95 (32%), Positives = 50/95 (52%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH G V  +  +P     + SSS D ++ +W +++     G   K  +GH + +  V 
Sbjct: 737  LQGHAGNVRAVCFSPD-GKTLASSSSDHSVRLWNVSK-----GTCIKTFHGHKNEVWSVC 790

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             SSDG    +GS+D ++RLWD+  G   + F  HT
Sbjct: 791  FSSDGQTIATGSYDSSVRLWDVQQGTCVKIFHGHT 825



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 34/96 (35%), Positives = 49/96 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GHNG VT ++ +P     + S+SRDK++ +W +   +       K L GH+  I  V
Sbjct: 950  TLYGHNGGVTSVSFSPD-GQTLASASRDKSVKLWDIHERKC-----VKTLEGHTGDIWSV 1003

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DGN   + S D  ++LWD+  GK       HT
Sbjct: 1004 SFSPDGNTLATASADYLVKLWDVDEGKCITTLPGHT 1039



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H G V  +  +P    ++ S S D ++ +W + R E       K L+GH+  +  V
Sbjct: 652 TLAQHEGIVWSVRFSPDGQTLV-SGSLDASIRLWDIRRGEC-----LKILHGHTSGVCSV 705

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + DG+   SGS D  +RLWDL   K  +  + H
Sbjct: 706 RFNPDGSILASGSQDCDIRLWDLNTDKCIKVLQGH 740



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 49/105 (46%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +  E LK+   L GH   V  +  NP    ++ S S+D  + +W L  D+       K L
Sbjct: 687 RRGECLKI---LHGHTSGVCSVRFNPD-GSILASGSQDCDIRLWDLNTDKCI-----KVL 737

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            GH+  +  V  S DG    S S D ++RLW+++ G   + F  H
Sbjct: 738 QGHAGNVRAVCFSPDGKTLASSSSDHSVRLWNVSKGTCIKTFHGH 782



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            TL+GH+     ++ N   P     M+ + S D  + +W +       G   K L GH+++
Sbjct: 861  TLQGHSCGAFSVSFNSVCPTGVDCMLATGSMDGLVRLWDVAS-----GYCTKILQGHTNW 915

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            +  V  S DG+   SGS DK+++LWD+ +G
Sbjct: 916  VWSVSFSPDGSILASGSHDKSIKLWDVISG 945



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/96 (31%), Positives = 48/96 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P    ++ + S D ++ +W    D +N+    K L GH+  I  V
Sbjct: 1034 TLPGHTDGVWSLSFSPD-GKILATGSVDHSIRLW----DTSNFTC-LKVLQGHTSTIWSV 1087

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S +G+   S S D+T+RLWD+      R  + HT
Sbjct: 1088 SFSPNGSTLASASSDQTIRLWDMNNFTCVRVLDSHT 1123



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 28/96 (29%), Positives = 42/96 (43%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH   V  +A +P     + S   D  + +W +       G   K L  H   +  V
Sbjct: 610 TFKGHECVVWTVAFSPD-GQTLASGGHDGLIKLWDVQT-----GNCLKTLAQHEGIVWSV 663

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG   +SGS D ++RLWD+  G+  +    HT
Sbjct: 664 RFSPDGQTLVSGSLDASIRLWDIRRGECLKILHGHT 699



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS---DGNYAL--SGSWDK 295
            I+S+++D ++ +W +++     G+  + L GHS     V  +S    G   +  +GS D 
Sbjct: 839  IVSAAQDFSVRIWNISK-----GVCVRTLQGHSCGAFSVSFNSVCPTGVDCMLATGSMDG 893

Query: 296  TLRLWDLAAGKTTRRFEDHT 355
             +RLWD+A+G  T+  + HT
Sbjct: 894  LVRLWDVASGYCTKILQGHT 913


>UniRef50_Q3L9F7 Cluster: Putative WD-40 repeat protein; n=1;
            Rhodococcus erythropolis PR4|Rep: Putative WD-40 repeat
            protein - Rhodococcus erythropolis (strain PR4)
          Length = 1298

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 28/85 (32%), Positives = 48/85 (56%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            R  L GH G V  +A +P    ++ S S D+++ +W +  D +    P+  L GH+  + 
Sbjct: 1135 RNALVGHTGAVNSVAFSPD-GQLLASGSDDQSIRIWSIGSDNDTDANPEV-LTGHTSTVR 1192

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDL 316
             V  S+DG +  SGS D+++R+WD+
Sbjct: 1193 SVAFSADGEHLASGSDDQSVRIWDV 1217



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 3/95 (3%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR---LYGHS 229
            +R  L G +GW+  +  +P   ++I   S D T+ +W    D +N  +P  R   L GH+
Sbjct: 1088 IRAALTGPSGWINSVTFSPG-GNLIAVGSSDNTVRIW----DASNPAMPVPRRNALVGHT 1142

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
              ++ V  S DG    SGS D+++R+W + +   T
Sbjct: 1143 GAVNSVAFSPDGQLLASGSDDQSIRIWSIGSDNDT 1177



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 2/93 (2%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWV--TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           S+   L   + GH G +  T +A N     ++ ++S D+T+ +W     +   G P   L
Sbjct: 634 SQNAPLASPMSGHTGAIYDTAVAGN----GIVATASYDRTIRLWDPLSGKQ-LGGP---L 685

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            GH+ +++ V  S DG+Y +SG  D TLRLWD+
Sbjct: 686 VGHTSWVTSVAFSPDGHYLVSGGGDGTLRLWDV 718



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L G L GH  WVT +A +P     ++S   D TL +W + RD +        + GHS  
Sbjct: 680 QLGGPLVGHTSWVTSVAFSPD-GHYLVSGGGDGTLRLWDV-RDPDRPSPLGSPVVGHSGA 737

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           I  V  S DG    +   D T RLWD+
Sbjct: 738 IYMVAFSPDGRTIATAGDDTTARLWDV 764



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/82 (32%), Positives = 41/82 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LR H   V  +A +P    M+ + S D ++ +W +  + N   + Q  L GH+  I  V 
Sbjct: 824  LRVHADTVHSVAFSPD-SRMLATGSDDHSVRIW-MVDNPNTPVMGQTPLIGHTAAIWSVS 881

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG   +S SWD T R+W +
Sbjct: 882  FSPDGQSLVSASWDGTARVWSV 903



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 26/91 (28%), Positives = 40/91 (43%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L G L G +G +T   T       +++  +D  + VW L         P   L GHS  +
Sbjct: 912  LGGPLVGSSGGLTT-TTFTNNGTKVITGGQDGLVRVWSL---------PSAVLAGHSRRV 961

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            +   +   G    +GS D T+ LWD+  G+T
Sbjct: 962  ATPAIDRSGQVMATGSLDGTVLLWDITGGRT 992



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 2/82 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR--LYGHSHFISDVV 250
           GH+G +  +A +P     I ++  D T  +W +   +N+  + Q+   L GH   +  V 
Sbjct: 733 GHSGAIYMVAFSPD-GRTIATAGDDTTARLWDV---DNSAAVTQRTPPLRGHEAPVRTVA 788

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S DG    +GS D T  LW++
Sbjct: 789 FSPDGRTLATGSDDHTAILWNV 810



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           GH+  I D  ++ +G  A + S+D+T+RLWD  +GK
Sbjct: 645 GHTGAIYDTAVAGNGIVA-TASYDRTIRLWDPLSGK 679


>UniRef50_A5UV81 Cluster: WD-40 repeat protein; n=2;
           Roseiflexus|Rep: WD-40 repeat protein - Roseiflexus sp.
           RS-1
          Length = 1041

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 32/102 (31%), Positives = 50/102 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           TL  RGT   H G +T +A +     +   +S D  + +W ++      G   +RL GH+
Sbjct: 478 TLDDRGTWFDHTGKITSLAWSADSTLLASGASDDNDIRIWDVST-----GTVIRRLSGHT 532

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +I  +  + DG    SGS D+T+R+WD A G+       HT
Sbjct: 533 GWIRSLAFAPDGTLLASGSTDQTVRIWDAATGQLLATLRGHT 574



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/95 (34%), Positives = 45/95 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH GW+  +A  P    ++ S S D+T+ +W         G     L GH+ FI  V 
Sbjct: 528 LSGHTGWIRSLAFAPD-GTLLASGSTDQTVRIWDAAT-----GQLLATLRGHTGFIGGVA 581

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S D     S S D ++RLWD+A+GK    F   T
Sbjct: 582 FSPDSATLASASRDGSVRLWDVASGKEISGFSFRT 616



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 4/106 (3%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  TLRGH G++  +A +P     + S+SRD ++ +W +   +   G   +     +
Sbjct: 563 TGQLLATLRGHTGFIGGVAFSPD-SATLASASRDGSVRLWDVASGKEISGFSFRTALDPT 621

Query: 230 ----HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               ++ + V  S DG     GS +  + L D  +G+   +   HT
Sbjct: 622 TNLRYWATGVTFSPDGKTLAVGSTEGVVYLIDATSGQIIHQLRGHT 667



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = +2

Query: 212 RLYGHSHFI--SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L GH+++I    +  S DG    S   D T+R+WD+  G  T   + H
Sbjct: 662 QLRGHTNWIVIRGLAFSPDGKTLYSAGLDATVRIWDVERGVQTAMLDVH 710


>UniRef50_A3ZW90 Cluster: Putative WD-repeat containing protein;
           n=1; Blastopirellula marina DSM 3645|Rep: Putative
           WD-repeat containing protein - Blastopirellula marina
           DSM 3645
          Length = 1131

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 31/102 (30%), Positives = 54/102 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L+ ++RGH+  +  +A +P    ++ + S DK +IVW L       G+P   L GH+
Sbjct: 214 TGRLKQSIRGHHDAIYSVAFSPD-AQVLATGSYDKDVIVWDLQS-----GLPLNTLTGHN 267

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             I D+   +D     + S D+T++LWD+  G+    F + T
Sbjct: 268 DAIYDLAFRNDSKVLATCSADRTVKLWDITTGERLETFGEAT 309


>UniRef50_Q10DN8 Cluster: Will die slowly protein, putative,
           expressed; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Will die slowly protein, putative,
           expressed - Oryza sativa subsp. japonica (Rice)
          Length = 324

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/89 (37%), Positives = 46/89 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR TL GH   V+ +  +P    ++ S+S DK L VW  +    +   P   L GH   +
Sbjct: 11  LRATLAGHRRAVSAVKFSPD-GRLLASASADKLLRVWSTS----DLASPVAELAGHGEGV 65

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           SD+  S DG    S S D+T+R+WDL  G
Sbjct: 66  SDLAFSPDGRLIASASDDRTVRIWDLGDG 94



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY----GHSHFI 238
           L GH   V+ +A +P    +I S+S D+T+ +W L       G  + RL     GH+++ 
Sbjct: 58  LAGHGEGVSDLAFSPD-GRLIASASDDRTVRIWDLGDGGGGGGGGEPRLMKTLSGHTNYA 116

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  S  GN   SGS+D+T+R+W++ +G+  R    H++
Sbjct: 117 FCLAFSPHGNMLASGSFDETVRVWEVRSGRCLRVLPAHSE 156



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 31/98 (31%), Positives = 50/98 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL GH  +   +A +P + +M+ S S D+T+ VW++       G   + L  HS  
Sbjct: 104 RLMKTLSGHTNYAFCLAFSP-HGNMLASGSFDETVRVWEVRS-----GRCLRVLPAHSEP 157

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           ++ V  + DG   +SGS+D   R+WD A G   +   D
Sbjct: 158 VTSVDFNRDGAMIVSGSYDGLCRIWDSATGHCIKTLID 195



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++G Y +SGS DK + +WDL + K  ++ E HT
Sbjct: 253 TNGKYIVSGSEDKCVYIWDLQSRKILQKLEGHT 285



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 26/94 (27%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  H+  VT +  N +   MI+S S D    +W    D       +  +   S  +S   
Sbjct: 151 LPAHSEPVTSVDFN-RDGAMIVSGSYDGLCRIW----DSATGHCIKTLIDDESPPVSFAK 205

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S +G + L+ + D  LRLW+ +AGK  + +  H
Sbjct: 206 FSPNGKFVLAATLDSKLRLWNFSAGKFLKTYTGH 239


>UniRef50_A2XLK4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 380

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/89 (37%), Positives = 46/89 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR TL GH   V+ +  +P    ++ S+S DK L VW  +    +   P   L GH   +
Sbjct: 11  LRATLAGHRRAVSAVKFSPD-GRLLASASADKLLRVWSTS----DLASPVAELAGHGEGV 65

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           SD+  S DG    S S D+T+R+WDL  G
Sbjct: 66  SDLAFSPDGRLIASASDDRTVRIWDLGDG 94



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY----GHSHFI 238
           L GH   V+ +A +P    +I S+S D+T+ +W L       G  + RL     GH+++ 
Sbjct: 58  LAGHGEGVSDLAFSPD-GRLIASASDDRTVRIWDLGDGGGGGGGGEPRLMKTLSGHTNYA 116

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  S  GN   SGS+D+T+R+W++ +G+  R    H++
Sbjct: 117 FCLAFSPHGNMLASGSFDETVRVWEVRSGRCLRVLPAHSE 156



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 31/98 (31%), Positives = 50/98 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL GH  +   +A +P + +M+ S S D+T+ VW++       G   + L  HS  
Sbjct: 104 RLMKTLSGHTNYAFCLAFSP-HGNMLASGSFDETVRVWEVRS-----GRCLRVLPAHSEP 157

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           ++ V  + DG   +SGS+D   R+WD A G   +   D
Sbjct: 158 VTSVDFNRDGAMIVSGSYDGLCRIWDSATGHCIKTLID 195



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++G Y +SGS DK + +WDL + K  ++ E HT
Sbjct: 309 TNGKYIVSGSEDKCVYIWDLQSRKILQKLEGHT 341


>UniRef50_Q4N2R1 Cluster: Putative uncharacterized protein; n=2;
           Theileria|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 470

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 29/76 (38%), Positives = 39/76 (51%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + +LS S D T+ +W    D N    P  RL GH   I+ V  SS+G Y  S S+DK++R
Sbjct: 330 ERLLSGSDDNTMFIWLPNSDSNK---PLHRLTGHQQLINHVSFSSNGRYFASASFDKSIR 386

Query: 305 LWDLAAGKTTRRFEDH 352
           +W    GK  R    H
Sbjct: 387 IWCGITGKYLRTLRGH 402



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GH+  +  +  S DG Y  SGS D T+R+WDLA     + F  HT
Sbjct: 96  LEGHTESVLCLEFSPDGVYLASGSGDTTVRIWDLATQTPIKTFTGHT 142



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           S++ K    L GH   +  ++  +N +Y     S+S DK++ +W         G   + L
Sbjct: 348 SDSNKPLHRLTGHQQLINHVSFSSNGRY---FASASFDKSIRIWC-----GITGKYLRTL 399

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            GH   +  V  S  GNY +S S D TL+LWD  +GK
Sbjct: 400 RGHIGRVYRVAWSCRGNYLVSASSDSTLKLWDAESGK 436



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 27/97 (27%), Positives = 42/97 (43%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +  +P     + S S D T+ +W L         P K   GH++++  +
Sbjct: 95  SLEGHTESVLCLEFSPDGV-YLASGSGDTTVRIWDLATQT-----PIKTFTGHTNWVMSI 148

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    SG  D  + +W+   G  T   + HTK
Sbjct: 149 SWSPDGYTLSSGGMDNKVIIWNPKTGSGT-DLKGHTK 184



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           L GH   ++Q+  + ++ + + SSSRD  + VW       N G   K L GH H+I+
Sbjct: 228 LSGHTKGISQVLWSAEFKERLFSSSRDTLIKVW-----NTNDGSLVKDLKGHGHWIN 279



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 7/104 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH  WV  I+ +P     + S   D  +I+W     +   G   K   GH+  ++ +
Sbjct: 137 TFTGHTNWVMSISWSPD-GYTLSSGGMDNKVIIWN---PKTGSGTDLK---GHTKAVTAL 189

Query: 248 ----VLSSDGN-YAL--SGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               + + D N Y L  SGS D T+R+W++ +    R    HTK
Sbjct: 190 SWQPLHNLDANEYPLLASGSMDYTVRIWNVKSFVCVRVLSGHTK 233


>UniRef50_A0CR02 Cluster: Chromosome undetermined scaffold_247, whole
            genome shotgun sequence; n=3; Eukaryota|Rep: Chromosome
            undetermined scaffold_247, whole genome shotgun sequence
            - Paramecium tetraurelia
          Length = 1876

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 32/105 (30%), Positives = 54/105 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH+  V  +  +P     + S S+D ++ VW +       GI + +L GH
Sbjct: 1583 KTRQQKAKLDGHSDRVLSVNFSPD-GITLASGSQDNSIRVWDVKT-----GIQKAKLNGH 1636

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S  +  V  S DG    SGS+D T+RLWD+  G+   + + H+ +
Sbjct: 1637 SDRVLSVNFSPDGTTLASGSYDNTIRLWDIKKGQQKAKLDGHSSI 1681



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 29/96 (30%), Positives = 49/96 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L GH+G V  +  +P     + S S D ++ +W +       G  + +L GHS ++  V
Sbjct: 1464 SLVGHSGTVQSVHFSPD-GTTLASGSDDNSIRLWDVKT-----GQQKAKLDGHSDYVRSV 1517

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    SGS+D T+ LWD+  G+   + + H+
Sbjct: 1518 NFSPDGTTLASGSYDNTIILWDIKKGQQKAKLDGHS 1553



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 30/103 (29%), Positives = 53/103 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH+ +V  +  +P     + S S D T+I+W + +     G  + +L GH
Sbjct: 1499 KTGQQKAKLDGHSDYVRSVNFSPD-GTTLASGSYDNTIILWDIKK-----GQQKAKLDGH 1552

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  V  S DG    SGS DK++RLW++   +   + + H+
Sbjct: 1553 SDRVLSVNFSPDGITLASGSQDKSIRLWNIKTRQQKAKLDGHS 1595



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/103 (28%), Positives = 53/103 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH+G +  +  +P     + S SRD ++ +W +       G  + +L GH
Sbjct: 1751 KTGQQKAKLGGHSGIIYSVNFSPD-GTTLASGSRDNSICLWDVKT-----GQQKAKLDGH 1804

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S  +  V  S DG+   S S D+++RLWD+  G+   + + H+
Sbjct: 1805 SQIVWSVNFSPDGSKLASCSDDQSIRLWDIKTGQQKAKLDGHS 1847



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 29/97 (29%), Positives = 47/97 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +P     + S S DK++ +W +       G  + +L GHS  I  V 
Sbjct: 1717 LDGHPREVMSVIFSPN-GTTLASGSADKSIRLWDVKT-----GQQKAKLGGHSGIIYSVN 1770

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG    SGS D ++ LWD+  G+   + + H+++
Sbjct: 1771 FSPDGTTLASGSRDNSICLWDVKTGQQKAKLDGHSQI 1807



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/99 (28%), Positives = 47/99 (47%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L GH+  V  +  +P     + S S D T+ +W + +     G  + +L GHS  + 
Sbjct: 1630 KAKLNGHSDRVLSVNFSPD-GTTLASGSYDNTIRLWDIKK-----GQQKAKLDGHSSIVW 1683

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             V  S DG    S S D ++RLWD+  G+   + + H +
Sbjct: 1684 AVNFSPDGTTIASCSDDNSIRLWDVKTGQQIEKLDGHPR 1722



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 28/100 (28%), Positives = 48/100 (48%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L GH+  V  +  +P     I S S D ++ +W +       G   ++L GH   + 
Sbjct: 1672 KAKLDGHSSIVWAVNFSPD-GTTIASCSDDNSIRLWDVKT-----GQQIEKLDGHPREVM 1725

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             V+ S +G    SGS DK++RLWD+  G+   +   H+ +
Sbjct: 1726 SVIFSPNGTTLASGSADKSIRLWDVKTGQQKAKLGGHSGI 1765


>UniRef50_Q5KKN8 Cluster: Nuclear matrix protein NMP200, putative;
           n=2; Filobasidiella neoformans|Rep: Nuclear matrix
           protein NMP200, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 507

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           E  K+ GTL+GH   VT +A   +   P + +S+S DKT+ VW    D+  +G  +  L 
Sbjct: 242 EASKVLGTLKGHTKAVTHVAFREHEGEPRLAISASADKTVRVWG--EDDGKWGA-RATLS 298

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           GH   I+ + +   G+Y  +GS D T  L+DL+  K   ++
Sbjct: 299 GHKGEINGLAVHPSGSYVAAGSADSTWSLYDLSTAKEVTKY 339



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           I+ + L+ DGN  ++G  DK ++++DL A K     + HTK
Sbjct: 215 ITALDLAQDGNTVVTGGADKAVQVFDLEASKVLGTLKGHTK 255


>UniRef50_Q5BBQ9 Cluster: Putative uncharacterized protein; n=1;
            Emericella nidulans|Rep: Putative uncharacterized protein
            - Emericella nidulans (Aspergillus nidulans)
          Length = 1311

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 35/98 (35%), Positives = 51/98 (52%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L+ TL  H G +  IA +P    ++  S+ D T+  W +T      G  Q+ + GHS  +
Sbjct: 888  LQKTLERHPGAIMSIAFSPDVKQLVTCST-DSTIKRWDIT-----IGGVQEAV-GHSKHV 940

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + +VLS DG    SGS DKT++LWD A G   +    H
Sbjct: 941  TTMVLSPDGKVIASGSADKTIKLWDAATGDLQKTLTGH 978



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 29/71 (40%), Positives = 36/71 (50%)
 Frame = +2

Query: 143 SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           SRD T I+   T      G  QK L GHSH  S +  SSD    ++GS D T+RLW+   
Sbjct: 750 SRDSTCIMLFDTAT----GDLQKILKGHSHECSTMAFSSDSRQLVTGSVDCTVRLWNTTT 805

Query: 323 GKTTRRFEDHT 355
           G   + F  HT
Sbjct: 806 GDLEKTFVGHT 816



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 27/89 (30%), Positives = 46/89 (51%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L+  L+GH+   + +A +     ++ + S D T+ +W  T      G  +K   GH+  +
Sbjct: 766  LQKILKGHSHECSTMAFSSDSRQLV-TGSVDCTVRLWNTTT-----GDLEKTFVGHTGTV 819

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
              V +SSDG   +SGS +  ++LWD A G
Sbjct: 820  LSVAISSDGRQIVSGSIE-AVKLWDAATG 847



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 12/86 (13%)
 Frame = +2

Query: 95   TQIATNPKYPD--MILSSSRDKTLIVWKLTRDENNYGIPQ----------KRLYGHSHFI 238
            TQI      PD  +ILS+S D+ + +W     +    +P            R  G+ ++I
Sbjct: 1084 TQITGLVFSPDAKLILSTSTDRAIKLWDAATGDLQKRLPCHSDSIITDAFSRSSGYPNWI 1143

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDL 316
              V  SSDG +  + S DKT+R+W +
Sbjct: 1144 FSVAFSSDGQHIAAASADKTIRVWSI 1169


>UniRef50_Q4P1X6 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1768

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/104 (31%), Positives = 52/104 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET ++    RGH   +  +A +P   D++++  RD T+ VW +   E  +      + GH
Sbjct: 289 ETNRVIRQFRGHLSGIYSLALHPTL-DVVVTGGRDATVRVWDMRTREAIF-----TMTGH 342

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              ++ VV        +SGS D T++LWDLAAGK+      H K
Sbjct: 343 RGTVASVVCQDSEPQIISGSMDATVKLWDLAAGKSITTLTHHKK 386



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 26/99 (26%), Positives = 42/99 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  +A  P       + + D+ + +W L   E         L GH   
Sbjct: 208 KLARVISGHLGWVRCVAVEPDNK-WFATGAGDRMIKIWDLASGELKLS-----LTGHISP 261

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  + +S+   Y  S   D+ ++ WDL   +  R+F  H
Sbjct: 262 VRGLAISARHPYLFSAGEDRIIKCWDLETNRVIRQFRGH 300


>UniRef50_Q12417 Cluster: Pre-mRNA-splicing factor PRP46; n=6;
           Saccharomycetales|Rep: Pre-mRNA-splicing factor PRP46 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 451

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/99 (33%), Positives = 47/99 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  +A +P   +  ++ S D T+ VW L       G  +  L GH   
Sbjct: 130 KLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLAT-----GKLKTTLAGHVMT 184

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + DV +S    Y  S S DKT++ WDL   +  R +  H
Sbjct: 185 VRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGH 223



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 1/95 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDVVL 253
           GH   V  ++ +P   D+I ++ RD  + +W + TR      IP   L GH   I+ V  
Sbjct: 222 GHLSGVRTVSIHPTL-DLIATAGRDSVIKLWDMRTR------IPVITLVGHKGPINQVQC 274

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +      +S S D T+RLWD+ AGKT +    H +
Sbjct: 275 TPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKR 309



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 28/89 (31%), Positives = 43/89 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL+ TL GH   V  +A + ++P  + S S DKT+  W L   E N  I  +  YGH 
Sbjct: 171 TGKLKTTLAGHVMTVRDVAVSDRHP-YLFSVSEDKTVKCWDL---EKNQII--RDYYGHL 224

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
             +  V +    +   +   D  ++LWD+
Sbjct: 225 SGVRTVSIHPTLDLIATAGRDSVIKLWDM 253


>UniRef50_UPI00006CBE41 Cluster: Will die slowly protein, putative;
           n=1; Tetrahymena thermophila SB210|Rep: Will die slowly
           protein, putative - Tetrahymena thermophila SB210
          Length = 309

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           +K     ++   L+GH G + Q+  N K  +  +S S+D+++I+W       N G   K+
Sbjct: 12  TKFEVPQQVHAVLKGHKGCIYQVKFN-KNGEYCMSCSQDRSIILWN-----PNKGTLIKQ 65

Query: 215 LYG-HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             G H++ I DV +  D +   S   DK+  LWD+ + K  R+FE HT
Sbjct: 66  FSGLHNYEILDVAIGEDNSKFCSVGGDKSAFLWDVKSDKLLRKFEGHT 113



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 17/56 (30%), Positives = 32/56 (57%)
 Frame = +2

Query: 149 DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           DK+  +W +  D+       ++  GH++ I+ V  + D +  ++GS+D T+R WDL
Sbjct: 92  DKSAFLWDVKSDKL-----LRKFEGHTNRINTVSFNDDESVVITGSFDTTIRFWDL 142


>UniRef50_Q98J75 Cluster: Probable transcriptional repressor; n=1;
           Mesorhizobium loti|Rep: Probable transcriptional
           repressor - Rhizobium loti (Mesorhizobium loti)
          Length = 586

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 39/105 (37%), Positives = 53/105 (50%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K+++   L     G NG V ++A +P     + S      +IVW L    NN  +    L
Sbjct: 361 KLADGAVLHVFQAGQNGGVNKLAISPDGKRAV-SGHDTGNVIVWDLV---NNSVLHV--L 414

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            GH   IS V +S DG  ALSGS D TL+LWD+ +GK  R +  H
Sbjct: 415 TGHDWSISAVAVSPDGKQALSGSIDGTLKLWDIESGKQLRSWHGH 459



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 29/94 (30%), Positives = 49/94 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  ++ +A +P      LS S D TL +W +       G   +  +GH       V
Sbjct: 414 LTGHDWSISAVAVSPD-GKQALSGSIDGTLKLWDIES-----GKQLRSWHGHEQGTYGAV 467

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            ++D +  ++GS D T+++WDL +G+  +RFE H
Sbjct: 468 FTADAHRLITGSGDLTIKVWDLDSGREVKRFEGH 501



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 28/75 (37%), Positives = 38/75 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D T+ VW L     + G   KR  GH   +  + LS+DG   LSGS D T RLW
Sbjct: 475 LITGSGDLTIKVWDL-----DSGREVKRFEGHEGTVYALALSADGKRLLSGSLDGTARLW 529

Query: 311 DLAAGKTTRRFEDHT 355
           D+  G     F+  T
Sbjct: 530 DMETGNQIALFDSQT 544


>UniRef50_Q9XBD8 Cluster: Putative WD-repeat containing protein; n=1;
            Amycolatopsis orientalis|Rep: Putative WD-repeat
            containing protein - Amycolatopsis orientalis
          Length = 1241

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 35/95 (36%), Positives = 49/95 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   VT IA +P    +  +++ DKT+ +W +    +  G P   L GH+  + DVV
Sbjct: 1046 LTGHTNSVTGIAFSPDGRSLA-TAANDKTIRLWDVP-SRSPIGEP---LTGHTSVVRDVV 1100

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    S   DKT+RLWD+A+       E HT
Sbjct: 1101 FSPDGKLLASAGDDKTVRLWDVASRTLIATLEGHT 1135



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 28/88 (31%), Positives = 47/88 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L   L GH G V  +A +P     + ++S D+T+ +W + R     G P     GH++ +
Sbjct: 660 LGNPLTGHTGMVNGLAFSPD-GTTLATASADRTVRLWDVAR-HRPIGEPMS---GHTNTV 714

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           + +  SSDG   ++GS D T+R WD+ +
Sbjct: 715 TSIAFSSDGRLLVTGSADGTVRTWDITS 742



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 28/81 (34%), Positives = 41/81 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH      +A +P    ++ S+S DKT+ +W +       G P   L GH++    V 
Sbjct: 793  LTGHTSVTNGVAFSPD-GQILASTSGDKTVRLWNVAT-RAPIGDP---LTGHTNVTYGVA 847

Query: 251  LSSDGNYALSGSWDKTLRLWD 313
             S DG    + SWDKT+R+WD
Sbjct: 848  FSPDGRTLATSSWDKTVRIWD 868



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/81 (37%), Positives = 42/81 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +T +A +P       +SS DKT+ +W +       G P   L GH+   + V  S
Sbjct: 752 GHKGPITAVALSPDGVTAA-TSSNDKTVRLWNVAT-RAPIGDP---LTGHTSVTNGVAFS 806

Query: 257 SDGNYALSGSWDKTLRLWDLA 319
            DG    S S DKT+RLW++A
Sbjct: 807 PDGQILASTSGDKTVRLWNVA 827



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/83 (36%), Positives = 44/83 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   VT IA +     ++++ S D T+  W +T      G P   + GH   I+ V 
Sbjct: 707 MSGHTNTVTSIAFSSD-GRLLVTGSADGTVRTWDIT-SRTPIGEP---MVGHKGPITAVA 761

Query: 251 LSSDGNYALSGSWDKTLRLWDLA 319
           LS DG  A + S DKT+RLW++A
Sbjct: 762 LSPDGVTAATSSNDKTVRLWNVA 784



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +2

Query: 59   LRGTL-RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            LRGTL   H   V  +A +P+   ++ + + D+ + +W+ T        P   L GH+  
Sbjct: 912  LRGTLVPAHADAVYAVALSPE-GRVLGTGADDRKVRLWE-TSTHRELVAP---LTGHTAE 966

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLA 319
            +  +  S  G    +GSWD TLRLWD A
Sbjct: 967  VRSMAFSPQGGILATGSWDGTLRLWDAA 994



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 28/88 (31%), Positives = 41/88 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +  +P    ++ S+  DKT+ +W +             L GH+  +  + 
Sbjct: 1089 LTGHTSVVRDVVFSPD-GKLLASAGDDKTVRLWDVASRTLI-----ATLEGHTGEVLKLA 1142

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTT 334
            +S DG    S S DKT+RLWD A   TT
Sbjct: 1143 ISPDGRELASTSLDKTVRLWDTANRSTT 1170



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 26/88 (29%), Positives = 43/88 (48%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L   L GH   V  +A +P+   ++ + S D TL +W    D  N       L GH  +
Sbjct: 955  ELVAPLTGHTAEVRSMAFSPQ-GGILATGSWDGTLRLW----DAANRAPIGSPLTGHVDW 1009

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLA 319
            +  +  S DG++  +   D T+RLW++A
Sbjct: 1010 VRGLAFSPDGHFVATAGMDMTVRLWNVA 1037



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 17/43 (39%), Positives = 26/43 (60%)
 Frame = +2

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           Y +P  RL GH+  + DV  S DG    + + D ++RLWD+A+
Sbjct: 615 YPLPT-RLLGHTGEVRDVAFSPDGRVLATAAGDSSVRLWDIAS 656


>UniRef50_Q11NX0 Cluster: Putative uncharacterized protein; n=1;
           Cytophaga hutchinsonii ATCC 33406|Rep: Putative
           uncharacterized protein - Cytophaga hutchinsonii (strain
           ATCC 33406 / NCIMB 9469)
          Length = 1097

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 1/99 (1%)
 Frame = +2

Query: 35  SKMSETLKLRGTL-RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           S  ++TLKL   + +GH+  V  +A +P    ++ + SRDK++ +W     +   G+  +
Sbjct: 40  SSYAQTLKLETVIQKGHSASVKAVAVSPD-GKILATGSRDKSVKLW-----DQQSGMEIR 93

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            L GH H ++ +  S DG    + S D T R+WD+  GK
Sbjct: 94  SLIGHDHTVNGLAFSPDGKLLATSSADGTARVWDILTGK 132



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           GH+  +S +   +D N AL+ SWD T R+WD+  G   ++F+
Sbjct: 548 GHTDVVSSIAFGADPNKALTASWDGTARIWDVTTGMMLQKFK 589



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
           R+  H+  I DV LS DG Y  +GSWD ++ ++D+  G+ +
Sbjct: 461 RIKPHTEPIFDVSLSRDGKYVATGSWDASIEVYDVQTGEVS 501



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF--EDHT 355
           GHS  +  V +S DG    +GS DK+++LWD  +G   R     DHT
Sbjct: 55  GHSASVKAVAVSPDGKILATGSRDKSVKLWDQQSGMEIRSLIGHDHT 101



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 23/93 (24%), Positives = 45/93 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  V  +A +P    ++ +SS D T  VW +   +  +  P+     +S +I+DV
Sbjct: 94  SLIGHDHTVNGLAFSPD-GKLLATSSADGTARVWDILTGKEIFTSPK-----NSKYITDV 147

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
             + DG       +  +  ++ + +GK  +R E
Sbjct: 148 AFNPDGKSFAYAGYPDSASIYAIPSGKLIKRLE 180



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I++   D+ + +W +       G   K L GH   I+ + LS DG   +S S D  ++ W
Sbjct: 607 IITGGDDRIIRIWDIQS-----GQVLKTLNGHQSEITSLSLSKDGKMLVSYSTDGVVKFW 661

Query: 311 DLAAG 325
           +L +G
Sbjct: 662 NLESG 666


>UniRef50_Q23YA8 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1125

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 33/95 (34%), Positives = 46/95 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH G V  ++  P  PD ++S S DKT+ VW +     N G   + L GH  F+  +
Sbjct: 608 TITGHEGGVRSLSQPPDEPDKLISGSEDKTVKVWDI-----NSGNCLQTLQGHDDFVRVI 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S+   A SGS D TLR+W L   +       H
Sbjct: 663 KAISNQKIA-SGSRDNTLRIWSLQTSQVETILRGH 696



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 30/96 (31%), Positives = 45/96 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ +V  I         I S SRD TL +W L   +      +  L GH   I  +
Sbjct: 651 TLQGHDDFVRVIKAISN--QKIASGSRDNTLRIWSLQTSQ-----VETILRGHQLPIWSI 703

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +    G    +GS D T+R+W++   KT ++   HT
Sbjct: 704 LEIEPGKKMATGSSDYTIRIWNMETNKTIQQLHGHT 739



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 28/99 (28%), Positives = 49/99 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L   L GH    T +A  P     +LS+ +D+ + +W +       G   +  YGH  +
Sbjct: 323 ELEKALTGHVK--TILALQPLPDGNLLSAGQDQVIKLWNVKT-----GQLLRSYYGHDDY 375

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  + L+ D N  +S S DK++++WDL  G+    F+ +
Sbjct: 376 IRRLHLTKD-NKIISCSDDKSVKIWDLKTGEILNSFDSN 413



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 35/103 (33%), Positives = 47/103 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T ++   LRGH   +  I        M   SS D T+ +W +   E N  I Q  L+GH
Sbjct: 685 QTSQVETILRGHQLPIWSILEIEPGKKMATGSS-DYTIRIWNM---ETNKTIQQ--LHGH 738

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +  +V  SD   A SGS D  LRLWD   G   R    H+
Sbjct: 739 TGPVWCLVKLSDTIIA-SGSEDCMLRLWDWEQGDCIRSLLSHS 780



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           K   GH+  + D+ + +DG   +S S DKTLR WD    + T+
Sbjct: 245 KMYVGHTDHVMDMTVLNDGTL-VSCSKDKTLRFWDTETHQCTQ 286


>UniRef50_A0EFN4 Cluster: Chromosome undetermined scaffold_93, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_93,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 609

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 32/94 (34%), Positives = 49/94 (52%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH+  V  +  +P    ++ S S DK++ VW +       G  + +L GH  F+  V  
Sbjct: 234 QGHSDCVFSVCFSPD-GTLLASGSADKSIRVWNVKT-----GQQKTQLDGHRDFVRSVCF 287

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S DG    SGS D+++RLW L  GK   +F+ HT
Sbjct: 288 SPDGIILASGSDDRSIRLWHLKKGKQISQFDGHT 321



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/92 (33%), Positives = 45/92 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH  +V  +  +P     I S S D ++ +W +       G  +K+L GHS  +  V  S
Sbjct: 319 GHTNYVFSVCFSPN-GTKIASGSVDNSIRIWDVKT-----GQLKKKLDGHSSIVRSVCFS 372

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           SDG    SGS DK++RLWD   G+   +   H
Sbjct: 373 SDGITVASGSDDKSIRLWDATTGQLKAKLFGH 404



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/97 (25%), Positives = 51/97 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  +V  +  +P    ++ S S D+++ +W L +     G    +  GH++++  V 
Sbjct: 275 LDGHRDFVRSVCFSPD-GIILASGSDDRSIRLWHLKK-----GKQISQFDGHTNYVFSVC 328

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S +G    SGS D ++R+WD+  G+  ++ + H+ +
Sbjct: 329 FSPNGTKIASGSVDNSIRIWDVKTGQLKKKLDGHSSI 365



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 24/74 (32%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++SSS DK++ +W     + N G    +  GHS  +  V  S DG    SGS DK++R+W
Sbjct: 210 LVSSSEDKSIRLW-----DTNTGRKIAKFQGHSDCVFSVCFSPDGTLLASGSADKSIRVW 264

Query: 311 DLAAGKTTRRFEDH 352
           ++  G+   + + H
Sbjct: 265 NVKTGQQKTQLDGH 278



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 32/104 (30%), Positives = 50/104 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +L+  L GH+  V  +  +      + S S DK++ +W  T      G  + +L+GH
Sbjct: 351 KTGQLKKKLDGHSSIVRSVCFSSD-GITVASGSDDKSIRLWDATT-----GQLKAKLFGH 404

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              I  V  S DG    S S D++ RLWD+   + T   E H+K
Sbjct: 405 ISGIRSVCFSPDGRQIASSSVDQSTRLWDIKTLQQTAILEGHSK 448



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 29/93 (31%), Positives = 44/93 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L+  L GH   +  +  +P     I SSS D++  +W +   +         L GHS
Sbjct: 394 TGQLKAKLFGHISGIRSVCFSPD-GRQIASSSVDQSTRLWDIKTLQQT-----AILEGHS 447

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
             +  V  S DG+Y  SGS D  + L D+ +GK
Sbjct: 448 KTVFAVCFSPDGSYLASGSADNFIYLRDVKSGK 480



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S DG+  +S S DK++RLWD   G+   +F+ H+
Sbjct: 204 SPDGSSLVSSSEDKSIRLWDTNTGRKIAKFQGHS 237


>UniRef50_Q8NA23 Cluster: WD repeat-containing protein 31; n=23;
           Euteleostomi|Rep: WD repeat-containing protein 31 - Homo
           sapiens (Human)
          Length = 367

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/89 (31%), Positives = 50/89 (56%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T++A  PK      S+SRD+ +++W L         P+++L GH+  ++ + +
Sbjct: 100 KGHEHEITKVACIPK-SSQFFSASRDRMVMMWDLHGSSQ----PRQQLCGHAMVVTGLAV 154

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           S D +   +GS D TL LWD+  G++  R
Sbjct: 155 SPDSSQLCTGSRDNTLLLWDVVTGQSVER 183



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R  L GH   VT +A +P     + + SRD TL++W +   ++      +R     + ++
Sbjct: 139 RQQLCGHAMVVTGLAVSPD-SSQLCTGSRDNTLLLWDVVTGQS-----VERASVSRNVVT 192

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y L  S DKTLRLWD
Sbjct: 193 HLCWVPREPYILQTSEDKTLRLWD 216



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D+ +S  +DKT++ +         G   KR  GH H I+ V      +   S S D+ + 
Sbjct: 74  DLCVSGGKDKTVVAYNWKT-----GNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVM 128

Query: 305 LWDLAAGKTTRR 340
           +WDL      R+
Sbjct: 129 MWDLHGSSQPRQ 140


>UniRef50_Q7NLE9 Cluster: WD-repeat protein; n=1; Gloeobacter
           violaceus|Rep: WD-repeat protein - Gloeobacter violaceus
          Length = 1183

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 35/100 (35%), Positives = 49/100 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L+ TL GHN  V  +A  P    +I S S D T+ +W     +   G  +  L GH + 
Sbjct: 641 QLQATLTGHNKGVRSVAFAPD-GHLIASGSLDGTIKLW-----DAQSGQCRLTLTGHRNV 694

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++ VV S DG Y  SGS D T++ W    G+  R    HT
Sbjct: 695 VASVVWSPDGQYLASGSNDGTVKFWRPVGGRCLRTLRGHT 734



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 30/95 (31%), Positives = 49/95 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+GWV  +A +P   +++ S+  D T+ +W++       G  Q  L GH+  +  V  +
Sbjct: 606 GHSGWVEGLAFSPD-SEILASAGLDGTIRLWQVVS-----GQLQATLTGHNKGVRSVAFA 659

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            DG+   SGS D T++LWD  +G+       H  V
Sbjct: 660 PDGHLIASGSLDGTIKLWDAQSGQCRLTLTGHRNV 694



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 34/98 (34%), Positives = 48/98 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH   V  +A  P     +LS S D TL +W     + + G  ++ L GH   +  V
Sbjct: 729  TLRGHTDEVWSVAFGPD-SRTLLSGSSDGTLRMW-----DTHGGTCKQALSGHQDKVRTV 782

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
              S DG    SGSWD T+R+W+ A G+       H+ +
Sbjct: 783  AWSLDGQRLASGSWDATVRVWN-ADGRCQSILRGHSGI 819



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 33/95 (34%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +      + S S D T+ VW      N  G  Q  L GHS  I  V 
Sbjct: 772  LSGHQDKVRTVAWSLD-GQRLASGSWDATVRVW------NADGRCQSILRGHSGIIRSVA 824

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             + DG    +GS D+T++LWDL +G+    F+ H+
Sbjct: 825  FAPDGGLLATGSIDQTVKLWDLQSGQCVYSFKGHS 859



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 30/95 (31%), Positives = 44/95 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV  +A +P     + S   D+T+ +W     +   G   +      H +  V 
Sbjct: 938  LQGHTSWVWSVAFSPD-GRRLASGGADRTVRLW-----DTATGQCLRTSTEADHRVLAVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               DG   L+GS D+T+RLWD A G+  R    HT
Sbjct: 992  FMPDG-LTLAGSVDQTVRLWDAATGRCLRTLAGHT 1025



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 122  PD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKT 298
            PD + L+ S D+T+ +W         G   + L GH+ +I  +  S+DG    +GS D++
Sbjct: 994  PDGLTLAGSVDQTVRLWDAAT-----GRCLRTLAGHTSWIWSLAASADGRLMATGSADRS 1048

Query: 299  LRLWDLAAGKTTRRFEDH 352
            +R+W++A G+  +  E+H
Sbjct: 1049 VRIWEVATGRCLKHLEEH 1066



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 30/96 (31%), Positives = 44/96 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            + +GH+G V  +A        + S   D  + +W  T D    G   + L GH+H I  V
Sbjct: 854  SFKGHSGGVAAVAVGGH--GTLASGDADHRVRIWS-TED----GRCTRVLSGHTHPIWSV 906

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              +  G    S S D  +RLWD A+G+ T   + HT
Sbjct: 907  AFAPGGATLASASADHAVRLWDGASGRCTHILQGHT 942



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/97 (30%), Positives = 40/97 (41%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R TL GH   V  +  +P     + S S D T+  W+        G   + L GH+  + 
Sbjct: 685 RLTLTGHRNVVASVVWSPD-GQYLASGSNDGTVKFWRPVG-----GRCLRTLRGHTDEVW 738

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            V    D    LSGS D TLR+WD   G   +    H
Sbjct: 739 SVAFGPDSRTLLSGSSDGTLRMWDTHGGTCKQALSGH 775



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 25/90 (27%), Positives = 41/90 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  W+  +A +     ++ + S D+++ +W++       G   K L  H  ++  V
Sbjct: 1020 TLAGHTSWIWSLAASAD-GRLMATGSADRSVRIWEVAT-----GRCLKHLEEHGGWVWSV 1073

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
              S D      GS D T+RLW    G+  R
Sbjct: 1074 AFSPDERRLAVGSMDGTIRLWSFPEGELLR 1103



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/89 (31%), Positives = 41/89 (46%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   +  +A  P    +  S+S D  + +W     +   G     L GH+ ++  V 
Sbjct: 896  LSGHTHPIWSVAFAPGGATLA-SASADHAVRLW-----DGASGRCTHILQGHTSWVWSVA 949

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
             S DG    SG  D+T+RLWD A G+  R
Sbjct: 950  FSPDGRRLASGGADRTVRLWDTATGQCLR 978



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 23/89 (25%), Positives = 36/89 (40%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L  H GWV  +A +P    + + S  D T+ +W     E        R       +  + 
Sbjct: 1063 LEEHGGWVWSVAFSPDERRLAVGSM-DGTIRLWSFPEGE------LLRSMACESAVRSIA 1115

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
              S G   ++G  D T+R W +A G+  R
Sbjct: 1116 FESHGQVLIAGCEDGTIRFWSVACGECLR 1144


>UniRef50_Q3MCN9 Cluster: WD-40 repeat; n=3; Nostocaceae|Rep: WD-40
           repeat - Anabaena variabilis (strain ATCC 29413 / PCC
           7937)
          Length = 1176

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 31/81 (38%), Positives = 42/81 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH G V  +  +P    M+ S+S D T+ +WKL       G   K   GH+  +  V
Sbjct: 601 TLKGHQGAVRSVRFSPD-GQMVASASEDGTIKLWKLN------GTLLKTFKGHTASVWGV 653

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             S DG +  S SWD T+RLW
Sbjct: 654 AFSRDGQFLASASWDTTVRLW 674



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 33/95 (34%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V Q+A +P    ++ S+S D T+ +W L       G     L GHS  +  V 
Sbjct: 981  LKGHQAEVWQVAFSPN-SKIVASASGDSTVKLWTLD------GKLLTTLAGHSSVVWSVA 1033

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S D     +GS D T++LW +  GK  R F  HT
Sbjct: 1034 FSPDNKMVATGSGDNTVKLWTI-DGKLLRTFTGHT 1067



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/95 (30%), Positives = 48/95 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+ H  WV  +A +P     + SSS DKT+ +W+    + +Y +   +    +  I+ V 
Sbjct: 731  LKSHTAWVVGVAFSPD-GQTLASSSEDKTVKLWRRDPADGSYRLD--KTLKQTTGIAGVA 787

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S+DG    S S DKT++LW++  G   R    H+
Sbjct: 788  FSADGQTIASASLDKTIKLWNI-DGTELRTLRGHS 821



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 31/93 (33%), Positives = 44/93 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P    +I S+S D+T+ +W+  RD    G     L GH   +  V  S
Sbjct: 563 GHTAAVMAVDVSPD-SSLIASASIDRTIKLWR--RD----GTKITTLKGHQGAVRSVRFS 615

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    S S D T++LW L  G   + F+ HT
Sbjct: 616 PDGQMVASASEDGTIKLWKL-NGTLLKTFKGHT 647



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 30/93 (32%), Positives = 44/93 (47%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL GH+  V  +A +P    M+ + S D T+ +W +       G   +   GH+  
Sbjct: 1017 KLLTTLAGHSSVVWSVAFSPDNK-MVATGSGDNTVKLWTID------GKLLRTFTGHTAA 1069

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
            I  V  S DG    SGS D T++LW +   + T
Sbjct: 1070 IWGVAFSPDGKILASGSVDATVKLWKMDGTELT 1102



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 29/87 (33%), Positives = 41/87 (47%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  T  GH   +  +A +P    ++ S S D T+ +WK+       G     L GH+  
Sbjct: 1058 KLLRTFTGHTAAIWGVAFSPD-GKILASGSVDATVKLWKMD------GTELTTLTGHTAA 1110

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDL 316
            I  + +S DG    SG  D TL LW+L
Sbjct: 1111 IRKIAISRDGTILASGGDDNTLILWNL 1137



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I S+S DKT+ +W +       G   + L GHS  +  V  S DG++  S   +  +RLW
Sbjct: 795 IASASLDKTIKLWNID------GTELRTLRGHSASVWGVTFSPDGSFIASAGAENVIRLW 848



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +++ D T+ +W+          P + L  H+ ++  V  S DG    S S DKT++L
Sbjct: 702 IVAAANLDGTVKLWQRQGSGWQEAKPLQPLKSHTAWVVGVAFSPDGQTLASSSEDKTVKL 761

Query: 308 W 310
           W
Sbjct: 762 W 762


>UniRef50_Q3M8V4 Cluster: WD-40 repeat; n=2; Nostocaceae|Rep: WD-40
            repeat - Anabaena variabilis (strain ATCC 29413 / PCC
            7937)
          Length = 1367

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 34/97 (35%), Positives = 46/97 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV     +P     IL++SRD+T  +W L       G    +  GH + +S   
Sbjct: 972  LQGHEDWVNSATFSPD-GQRILTASRDETARLWNLQ------GWQIAKFQGHENVVSSAT 1024

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG   L+ S DKT RLWDL  G+     + H  V
Sbjct: 1025 FSPDGQRILTASPDKTARLWDL-QGRQIAELQGHENV 1060



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/94 (35%), Positives = 46/94 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH GWV     +P     IL++S D+T  +W L       G    +  GH  ++    
Sbjct: 808  LQGHEGWVRSATFSPD-GQRILTASVDETARLWDLQ------GRQIAKFQGHKSWLFSAT 860

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG   L+ S DKT RLWDL  G+   +F+ H
Sbjct: 861  FSPDGQRILTASSDKTARLWDL-QGRQIAKFQGH 893



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/94 (34%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH  WV     +P     IL++S DKT  +W L       G    +  GH   ++   
Sbjct: 685 MAGHENWVNSATFSPD-GQRILTASSDKTARLWDLQ------GRQIAKFQGHESSVNSAT 737

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   L+ S DKT RLWDL  G+   +F+ H
Sbjct: 738 FSPDGQRILTASSDKTARLWDL-QGRQIAKFQGH 770



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 33/97 (34%), Positives = 46/97 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH  WV     +P     IL++S DKT  +W L       G     L GH  +++   
Sbjct: 931  LQGHEDWVNSATFSPD-GQRILTASSDKTARLWDL------QGRQIAELQGHEDWVNSAT 983

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S DG   L+ S D+T RLW+L  G    +F+ H  V
Sbjct: 984  FSPDGQRILTASRDETARLWNL-QGWQIAKFQGHENV 1019



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/93 (34%), Positives = 46/93 (49%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH G V     +P     IL++SRDK   +W L       G    +  GH  +++  + 
Sbjct: 1218 QGHEGDVITAIFSPD-GQRILTASRDKIARLWDLQ------GREIAKFQGHEDWVNSAIF 1270

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   L+ S DKT RLWDL  G+   +F+ H
Sbjct: 1271 SPDGQRILTASRDKTARLWDL-QGREIAKFQGH 1302



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 30/92 (32%), Positives = 43/92 (46%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH GW+     +P     IL++S D T  +W L       G    +  GH + +     S
Sbjct: 1137 GHKGWLFSATFSPD-GQRILTASSDSTARLWNLQ------GREIAKFQGHKNLVISASFS 1189

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             DG   L+ S DKT RLW+L  G+   +F+ H
Sbjct: 1190 PDGQRILTASSDKTARLWEL-QGREIAKFQGH 1220



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/81 (34%), Positives = 39/81 (48%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH  WV     +P     IL++SRDKT  +W L       G    +  GH  +++    
Sbjct: 1259 QGHEDWVNSAIFSPD-GQRILTASRDKTARLWDLQ------GREIAKFQGHEDWVNSATF 1311

Query: 254  SSDGNYALSGSWDKTLRLWDL 316
            S DG   L+ S DKT RLW +
Sbjct: 1312 SPDGQRILTASRDKTARLWQV 1332



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 32/93 (34%), Positives = 43/93 (46%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH   V+    +P     IL++S DKT  +W L       G     L GH + +S    
Sbjct: 1014 QGHENVVSSATFSPD-GQRILTASPDKTARLWDLQ------GRQIAELQGHENVVSSATF 1066

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   L+ S DKT RLWDL  G+     + H
Sbjct: 1067 SPDGQRILTASPDKTARLWDL-QGRQIAELQGH 1098



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 30/93 (32%), Positives = 42/93 (45%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH  W+     +P     IL++S DKT  +W L       G    +  GH + +     
Sbjct: 850  QGHKSWLFSATFSPD-GQRILTASSDKTARLWDLQ------GRQIAKFQGHENSVISATF 902

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   L+ S DKT RLWDL  G+     + H
Sbjct: 903  SPDGQRILTLSVDKTARLWDL-QGRQIAELQGH 934



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 30/82 (36%), Positives = 40/82 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V+    +P     IL++S DKT  +W L       G     L GH  ++   +
Sbjct: 1054 LQGHENVVSSATFSPD-GQRILTASPDKTARLWDLQ------GRQIAELQGHKGWLFSAI 1106

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG   L+ S DKT RLWDL
Sbjct: 1107 FSPDGQRILTASDDKTARLWDL 1128



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 30/93 (32%), Positives = 44/93 (47%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH   V   + +P     IL++S DKT  +W+L       G    +  GH   +   + 
Sbjct: 1177 QGHKNLVISASFSPD-GQRILTASSDKTARLWELQ------GREIAKFQGHEGDVITAIF 1229

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   L+ S DK  RLWDL  G+   +F+ H
Sbjct: 1230 SPDGQRILTASRDKIARLWDL-QGREIAKFQGH 1261



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 31/93 (33%), Positives = 41/93 (44%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            +GH   V     +P     IL+ S DKT  +W L       G     L GH  +++    
Sbjct: 891  QGHENSVISATFSPD-GQRILTLSVDKTARLWDLQ------GRQIAELQGHEDWVNSATF 943

Query: 254  SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG   L+ S DKT RLWDL  G+     + H
Sbjct: 944  SPDGQRILTASSDKTARLWDL-QGRQIAELQGH 975



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 29/93 (31%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V     +P     IL++S DKT  +W L       G    +  GH   +     
Sbjct: 727 QGHESSVNSATFSPD-GQRILTASSDKTARLWDLQ------GRQIAKFQGHESSVISATF 779

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           S DG   L+ S D+T RLWDL  G+     + H
Sbjct: 780 SPDGQRILTLSGDRTTRLWDL-QGRQIAELQGH 811


>UniRef50_A7BTI4 Cluster: G-protein beta WD-40 repeat; n=1;
           Beggiatoa sp. PS|Rep: G-protein beta WD-40 repeat -
           Beggiatoa sp. PS
          Length = 348

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 32/99 (32%), Positives = 54/99 (54%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L GTL+GH   V  +A +P   + + S S+DKT+ +W++     N G    R + H   
Sbjct: 102 ELLGTLQGHKNSVYSVAFSPN-GNFLASGSKDKTIKLWEI-----NTGRVW-RTWRHRDS 154

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V    +G    SGS D+T++LW++ +GK  + F+ H
Sbjct: 155 VWSVAFHPNGKLLASGSQDQTVKLWEVKSGKLLKTFKQH 193



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 32/101 (31%), Positives = 48/101 (47%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL GH   V  +A +      + S S D+T+ +W L   E         L GH + +
Sbjct: 61  LEMTLNGHRKKVYSVAFSLD-GRFLASGSGDQTIKLWWLPSGEL-----LGTLQGHKNSV 114

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             V  S +GN+  SGS DKT++LW++  G+  R +     V
Sbjct: 115 YSVAFSPNGNFLASGSKDKTIKLWEINTGRVWRTWRHRDSV 155



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 27/94 (28%), Positives = 45/94 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L   N W    + + +Y   + S S D ++ +W ++      G  +  L GH + +  V 
Sbjct: 233 LEHSNIWSVAFSPDGRY---LASGSNDSSIKIWDVST-----GKKRLTLKGHGNGVLSVA 284

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            ++DG    SGS D T+RLWD+  GK     ++H
Sbjct: 285 FTTDGQILASGSDDSTIRLWDVQTGKLLNTLKEH 318



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/87 (32%), Positives = 40/87 (45%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K R TL+GH   V  +A       ++ S S D T+ +W +       G     L  H 
Sbjct: 266 TGKKRLTLKGHGNGVLSVAFTTD-GQILASGSDDSTIRLWDVQT-----GKLLNTLKEHG 319

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +  V  S DG +  S S DKT++LW
Sbjct: 320 NSVLSVAFSPDGRFFASASQDKTIKLW 346



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 22/94 (23%), Positives = 43/94 (45%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  +A +P    ++ S S+D+T+ +W++       G   K    H+  +  V  S+
Sbjct: 151 HRDSVWSVAFHPN-GKLLASGSQDQTVKLWEVKS-----GKLLKTFKQHNSAVLSVTFSA 204

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           DG +  SG  D  + +WD+   +      +H+ +
Sbjct: 205 DGRFMASGDQDGLINIWDVEKREVLHMILEHSNI 238


>UniRef50_A0YMI4 Cluster: WD-40 repeat protein; n=2;
            Cyanobacteria|Rep: WD-40 repeat protein - Lyngbya sp. PCC
            8106
          Length = 1368

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 30/96 (31%), Positives = 52/96 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P    ++ ++S D T+ +W     + + G   K L GH+++++ V
Sbjct: 788  TLTGHTNSVNGVSFSPD-GKLLATASGDNTVKLW-----DASTGKEIKTLTGHTNWVNGV 841

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    + S D T++LWDL+ GK  +   +HT
Sbjct: 842  SFSPDGKLLATASGDNTVKLWDLSTGKVIKMLTEHT 877



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 30/96 (31%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  ++ +P    ++ ++S D T+ +W     + + G   K L GH++ ++ V
Sbjct: 746  TLGGHVNWVRAVSFSPD-GKLLATASGDNTVKLW-----DASTGKEIKTLTGHTNSVNGV 799

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    + S D T++LWD + GK  +    HT
Sbjct: 800  SFSPDGKLLATASGDNTVKLWDASTGKEIKTLTGHT 835



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 30/96 (31%), Positives = 48/96 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  ++ +P     + ++S D T+ +W     + + G   K L GH++ +  V
Sbjct: 956  TLTGHTNWVNGVSFSPD--GKLATASADNTVKLW-----DASTGKEIKTLTGHTNSVIGV 1008

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    + S D T++LWD + GK  +    HT
Sbjct: 1009 SFSPDGKLLATASGDNTVKLWDASTGKEIKTLTGHT 1044



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/96 (31%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P    ++ ++S D T+ +W     + + G   K L GH+++++ V
Sbjct: 997  TLTGHTNSVIGVSFSPD-GKLLATASGDNTVKLW-----DASTGKEIKTLTGHTNWVNGV 1050

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    +GS D T++LWD + GK  +    HT
Sbjct: 1051 SFSPDGKLLATGSGDNTVKLWDASTGKEIKTLTGHT 1086



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/96 (32%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  ++ +P    ++ + S D T+ +W     + + G   K L GH++ ++ V
Sbjct: 1039 TLTGHTNWVNGVSFSPD-GKLLATGSGDNTVKLW-----DASTGKEIKTLTGHTNSVNGV 1092

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG  A + S D T++LWD + GK  +    HT
Sbjct: 1093 SFSPDGKLA-TASADNTVKLWDASTGKEIKTLTGHT 1127



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/96 (31%), Positives = 50/96 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P    ++ ++S D T+ +W     + + G   K L GH++ ++ V
Sbjct: 1122 TLTGHTNSVIGVSFSPD-GKLLATTSGDNTVKLW-----DASTGKEIKTLTGHTNSVNGV 1175

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    + S DKT++LWD + GK  +    HT
Sbjct: 1176 SFSPDGKLLATASGDKTVKLWDASTGKEIKTLSGHT 1211



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 30/96 (31%), Positives = 51/96 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P    ++ ++S D T+ +W     + + G   K L GH+++++ V
Sbjct: 914  TLTGHTNSVNGVSFSPD-GKLLATASGDNTVKLW-----DASTGKEIKTLTGHTNWVNGV 967

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG  A + S D T++LWD + GK  +    HT
Sbjct: 968  SFSPDGKLA-TASADNTVKLWDASTGKEIKTLTGHT 1002



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/96 (30%), Positives = 47/96 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P     + ++S D T+ +W     + + G   K L GH++ +  V
Sbjct: 1081 TLTGHTNSVNGVSFSPD--GKLATASADNTVKLW-----DASTGKEIKTLTGHTNSVIGV 1133

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    + S D T++LWD + GK  +    HT
Sbjct: 1134 SFSPDGKLLATTSGDNTVKLWDASTGKEIKTLTGHT 1169



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDM-------ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            TL GH  WV  ++ +P    +       + ++S D T+ +W     + + G   K L GH
Sbjct: 1206 TLSGHTHWVNGVSFSPVGASLPSGIGKTLATASGDNTVKLW-----DASTGKEIKTLTGH 1260

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++ ++ V  S DG    + S D T++LW+ + GK  +    HT
Sbjct: 1261 TNSVNGVSFSPDGKTLATASGDNTVKLWNASTGKEIKTLTGHT 1303



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/102 (28%), Positives = 50/102 (49%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K+   L  H   V  ++ +P    ++ ++S D T+ +W     + + G   K L GH+
Sbjct: 866  TGKVIKMLTEHTNSVNGVSFSPD-GKLLATTSGDNTVKLW-----DASTGKEIKTLTGHT 919

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            + ++ V  S DG    + S D T++LWD + GK  +    HT
Sbjct: 920  NSVNGVSFSPDGKLLATASGDNTVKLWDASTGKEIKTLTGHT 961



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 8/104 (7%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P    ++ ++S DKT+ +W     + + G   K L GH+H+++ V
Sbjct: 1164 TLTGHTNSVNGVSFSPD-GKLLATASGDKTVKLW-----DASTGKEIKTLSGHTHWVNGV 1217

Query: 248  VLSSDGNYALSG--------SWDKTLRLWDLAAGKTTRRFEDHT 355
              S  G    SG        S D T++LWD + GK  +    HT
Sbjct: 1218 SFSPVGASLPSGIGKTLATASGDNTVKLWDASTGKEIKTLTGHT 1261



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 27/83 (32%), Positives = 42/83 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V  ++ +P     + ++S D T+ +W  +      G   K L GH+H++  V
Sbjct: 1256 TLTGHTNSVNGVSFSPD-GKTLATASGDNTVKLWNAST-----GKEIKTLTGHTHWVRAV 1309

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              S DG  A + S D T++LW L
Sbjct: 1310 SFSPDGKLA-TASEDNTVKLWQL 1331


>UniRef50_A4U9X8 Cluster: Lissencephaly protein 1-like; n=1;
           Chlamydomonas reinhardtii|Rep: Lissencephaly protein
           1-like - Chlamydomonas reinhardtii
          Length = 347

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 29/98 (29%), Positives = 49/98 (50%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ T++ H   V  +  +P    ++ ++S DKT+ VW+L   E      +  L GH+  +
Sbjct: 174 LQKTVKAHTSTVYSVVLSPD-GKLLATASADKTVKVWELGTGEL-----KDTLIGHTSHV 227

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  + DG   LS  WD+T++ WD+  G+    F  H
Sbjct: 228 VGVAFTPDGKKLLSSGWDETIKCWDVETGEVLHTFTGH 265



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/99 (33%), Positives = 51/99 (51%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR TL GH   V  +  + K    I++ S D+T+ VW++ +     G  QK +  H+  +
Sbjct: 132 LRMTLEGHAAPVYGVCVS-KDSQKIITCSHDETIRVWEIMK-----GNLQKTVKAHTSTV 185

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             VVLS DG    + S DKT+++W+L  G+       HT
Sbjct: 186 YSVVLSPDGKLLATASADKTVKVWELGTGELKDTLIGHT 224



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/99 (30%), Positives = 49/99 (49%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR    GHN  V  +        ++ S S+D+T+I W L R     GI +  L GH+  +
Sbjct: 90  LRTIFTGHNAKVHALNFIGS-GTILFSVSKDRTIIEWDLLR-----GILRMTLEGHAAPV 143

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             V +S D    ++ S D+T+R+W++  G   +  + HT
Sbjct: 144 YGVCVSKDSQKIITCSHDETIRVWEIMKGNLQKTVKAHT 182



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 29/92 (31%), Positives = 44/92 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L+ TL GH   V  +A  P     +LSS  D+T+  W +   E  +        GH 
Sbjct: 213 TGELKDTLIGHTSHVVGVAFTPD-GKKLLSSGWDETIKCWDVETGEVLHTFT-----GHQ 266

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             +  V  + DG+   SG  DKT++LW ++ G
Sbjct: 267 GKVHCVCTAPDGDTFFSGGEDKTIKLWRISTG 298



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL--Y 220
           ET ++  T  GH G V  + T P   D   S   DKT+ +W+++     + I    L   
Sbjct: 254 ETGEVLHTFTGHQGKVHCVCTAPD-GDTFFSGGEDKTIKLWRISTGACFHTIQPDPLGKT 312

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            HS  +  V ++ D +   S S D ++R W
Sbjct: 313 AHSDEVLAVAIAPDQSIMASASADNSIRTW 342



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH+  ++ +  S D     SGS D T+R+WD+ +G     F  H
Sbjct: 52  LKGHADSVTSLCFSPDSFLLASGSDDNTVRMWDVQSGNLRTIFTGH 97


>UniRef50_A4S1E8 Cluster: Predicted protein; n=2; Eukaryota|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 389

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 30/94 (31%), Positives = 45/94 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  IA +P   D++++  RD    VW +      Y      L GH + +  ++  
Sbjct: 161 GHLSGVYSIAMHPTL-DLLMTGGRDSVCRVWDMRTKRQVYC-----LTGHENTVGSILAQ 214

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +    ++GS+D T+RLWDLA GKT      H K
Sbjct: 215 DENPQLVTGSYDSTVRLWDLATGKTIHTLTHHKK 248



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/99 (31%), Positives = 46/99 (46%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV   A +P   +  ++ S D+T+ VW L       G  +  L GH   
Sbjct: 70  KLYRVISGHQGWVRSCAVDPGN-EWFVTGSADRTIKVWDLAS-----GSLKLTLTGHIEQ 123

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ +V+S    Y  S   DK ++ WDL   K  R +  H
Sbjct: 124 VTGIVVSQRHPYMFSCGLDKKVKCWDLEYNKVIRNYHGH 162



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 27/97 (27%), Positives = 43/97 (44%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           K +   S +LKL  TL GH   VT I  + ++P M  S   DK +  W L      Y   
Sbjct: 104 KVWDLASGSLKL--TLTGHIEQVTGIVVSQRHPYMF-SCGLDKKVKCWDL-----EYNKV 155

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            +  +GH   +  + +    +  ++G  D   R+WD+
Sbjct: 156 IRNYHGHLSGVYSIAMHPTLDLLMTGGRDSVCRVWDM 192


>UniRef50_Q5AY27 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 790

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 32/95 (33%), Positives = 45/95 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  WV  +A +P    ++ S+S D+T  +W         G  +  L GH  +++ V
Sbjct: 503 TLEGHRDWVNSVAFSPD-GQVVASASDDRTTRLWDAAT-----GAEKHILKGHKDWVNAV 556

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S D T+RLWD+A        E H
Sbjct: 557 AFSPDGQRVASASDDWTIRLWDVATSAEKHILEGH 591



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/94 (32%), Positives = 45/94 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH  WV  +A +P     + S+S D T+ +W +      +      L GH  +++ V 
Sbjct: 546 LKGHKDWVNAVAFSPD-GQRVASASDDWTIRLWDVATSAEKH-----ILEGHKDWVNAVA 599

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG    S S D T+RLWD A G   +  E H
Sbjct: 600 FSPDGQIVASASNDWTVRLWDTATGAEKQTLEGH 633



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/85 (35%), Positives = 42/85 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  WV  +A +P    ++ S+S D T+ +W     +   G  ++ L GH   +  V 
Sbjct: 588 LEGHKDWVNAVAFSPD-GQIVASASNDWTVRLW-----DTATGAEKQTLEGHKGNVKAVA 641

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAG 325
            S DG    S S DKT+RLWD   G
Sbjct: 642 FSPDGQIVASASNDKTIRLWDATTG 666



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 30/95 (31%), Positives = 42/95 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +  +P    ++ S+S D T+ +W        Y      L GH  +++ V
Sbjct: 461 TLEGHKHSVNSVVFSPD-GQIVASASDDGTIRLWDAATGAEKY-----TLEGHRDWVNSV 514

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    S S D+T RLWD A G      + H
Sbjct: 515 AFSPDGQVVASASDDRTTRLWDAATGAEKHILKGH 549


>UniRef50_A5AB88 Cluster: Contig An08c0230, complete genome.
           precursor; n=1; Aspergillus niger|Rep: Contig An08c0230,
           complete genome. precursor - Aspergillus niger
          Length = 772

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 35/96 (36%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+G V  ++ +P     I S S D  + +W     + N GI    L GHS  ++ +
Sbjct: 442 TLKGHSGLVECVSFSPN-GKTIGSGSLDNQVRLW-----DANRGITTFVLNGHSDRVNTI 495

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           V S DG    SGS DKT+RLWD   G        H+
Sbjct: 496 VFSPDGRLLASGSRDKTVRLWDTTKGTMQVELNGHS 531



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/92 (34%), Positives = 49/92 (53%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  +  TL GH   +  +A +P    ++ S S D+T+ +W     +   GI  K L GHS
Sbjct: 645 TCMMCSTLSGHRERINIMAFSPDGA-VVASGSSDRTVRLW-----QTGTGIMMKILAGHS 698

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             ++ V  S +G    SGS D+T+RLWD++ G
Sbjct: 699 KPVNAVAFSPNGTMMASGSDDRTVRLWDVSTG 730



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 31/93 (33%), Positives = 44/93 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V  I  +P    ++ S SRDKT+ +W  T+     G  Q  L GHS  ++ + 
Sbjct: 485 LNGHSDRVNTIVFSPD-GRLLASGSRDKTVRLWDTTK-----GTMQVELNGHSGPVNTIR 538

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            S DG+   S S +   +LW  A G   R   D
Sbjct: 539 FSPDGSLVASESLNGDYKLWHSATGNIHRISND 571



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           L GH   I+ +  S DG    SGS D+T+RLW    G   +    H+K
Sbjct: 652 LSGHRERINIMAFSPDGAVVASGSSDRTVRLWQTGTGIMMKILAGHSK 699



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 21/59 (35%), Positives = 26/59 (44%)
 Frame = +2

Query: 179 RDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           R+ N        L GHS  +  V  S +G    SGS D  +RLWD   G TT     H+
Sbjct: 431 RNNNIKQFSHTTLKGHSGLVECVSFSPNGKTIGSGSLDNQVRLWDANRGITTFVLNGHS 489


>UniRef50_A7PUB2 Cluster: Chromosome chr7 scaffold_31, whole genome
           shotgun sequence; n=3; core eudicotyledons|Rep:
           Chromosome chr7 scaffold_31, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 315

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 36/100 (36%), Positives = 52/100 (52%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL  H+  V+ +  +     ++ S+S DKTLIVW      +     + RL GHS  
Sbjct: 17  RLLRTLAAHDRAVSCVKFSSD-GTLLASASLDKTLIVWS-----SQTLTLKSRLVGHSGG 70

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ISD+  SSD +Y  S S D TLR+WD  + +  +    HT
Sbjct: 71  ISDLAWSSDSHYICSASDDLTLRIWDAQSAECVKTLRGHT 110



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 33/104 (31%), Positives = 53/104 (50%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+TL L+  L GH+G ++ +A +      I S+S D TL +W     E       K L G
Sbjct: 55  SQTLTLKSRLVGHSGGISDLAWSSD-SHYICSASDDLTLRIWDAQSAEC-----VKTLRG 108

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H+  +  V  +   N  +SGS+D+T+R+WD+  G+       H+
Sbjct: 109 HTDLVFCVNFNPQSNLIVSGSFDETVRIWDVKTGRPLHTIAAHS 152



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/81 (32%), Positives = 44/81 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH   V  +  NP+  ++I+S S D+T+ +W +       G P   +  HS  ++ V
Sbjct: 105 TLRGHTDLVFCVNFNPQ-SNLIVSGSFDETVRIWDVKT-----GRPLHTIAAHSMPVTSV 158

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             + DG+  +SGS D + ++W
Sbjct: 159 YFNRDGSLIVSGSHDGSCKIW 179



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 24/95 (25%), Positives = 45/95 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H+  VT +  N +   +I+S S D +  +W      +   + +  +  +   IS  
Sbjct: 147 TIAAHSMPVTSVYFN-RDGSLIVSGSHDGSCKIWA----SDTGALLKTLIEDNGPAISFA 201

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S +G Y L  + D TL+LW+ + GK+ + +  H
Sbjct: 202 KFSPNGKYILVATLDDTLKLWNYSTGKSLKIYTGH 236



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 32/107 (29%), Positives = 45/107 (42%), Gaps = 3/107 (2%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+T  L  TL   NG     A        IL ++ D TL +W  +      G   K   G
Sbjct: 181 SDTGALLKTLIEDNGPAISFAKFSPNGKYILVATLDDTLKLWNYST-----GKSLKIYTG 235

Query: 224 HS---HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H    + I+     + G Y +SGS DK + +WDL      ++ E HT
Sbjct: 236 HVNKVYCIASAFSVTYGKYIVSGSEDKCVYVWDLQGKNPLQKLEGHT 282


>UniRef50_Q54HF5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 595

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 32/96 (33%), Positives = 43/96 (44%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL     GH   V  I   PKY  ++LS+  D T+ +W    D        +   GHS  
Sbjct: 295 KLIHNYTGHTKGVAAIRYIPKYGHLLLSAGMDNTVKIWDAYGDRRCI----QTYMGHSQA 350

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + D+  S+DG   LS  +D+  RLWD   GK    F
Sbjct: 351 VRDICFSNDGRRFLSCGYDRQTRLWDTETGKILSSF 386


>UniRef50_Q237C6 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 815

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 30/82 (36%), Positives = 49/82 (59%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH G VT + +  K    +LSSS+D T+I+W +       G+P  ++  H   ++ + 
Sbjct: 575 LKGHTGTVTSLIS-VKDGRTLLSSSQDGTIIIWDVLN-----GVPLAQMREHGGPVNCMT 628

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           +S DG+  LSGS DKT+++W L
Sbjct: 629 ISKDGSMLLSGSSDKTIKVWGL 650



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 9/106 (8%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL--YGHSHFISD 244
           +R H G V  + T  K   M+LS S DKT+ VW LT    N G+ +K L  +     I D
Sbjct: 617 MREHGGPVNCM-TISKDGSMLLSGSSDKTIKVWGLTH-VFNVGLQRKVLDVFTFQKSIED 674

Query: 245 V-----VLSS--DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
                 + SS  D N   +G  D  +++W+LA     R    H  +
Sbjct: 675 TCHVYSINSSHMDPNIIFTGGSDSKIKIWNLANNTLEREIVGHQTI 720



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = +2

Query: 149 DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           D  +IVW + +       P + L GH+  ++ ++   DG   LS S D T+ +WD+  G 
Sbjct: 558 DHQVIVWDIQKHS-----PIRVLKGHTGTVTSLISVKDGRTLLSSSQDGTIIIWDVLNGV 612

Query: 329 TTRRFEDH 352
              +  +H
Sbjct: 613 PLAQMREH 620


>UniRef50_A0DE90 Cluster: Chromosome undetermined scaffold_47, whole
            genome shotgun sequence; n=3; Oligohymenophorea|Rep:
            Chromosome undetermined scaffold_47, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2171

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 29/103 (28%), Positives = 54/103 (52%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L  H GWV  +  +P    ++ S   D+++ +W +  ++  +     +L GH
Sbjct: 1795 KTGQQKSKLCNHTGWVRSVCFSPD-GTILASGGDDQSICLWDVQTEQQQF-----KLIGH 1848

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  +  V  S +G    SGS DKT+R WD+  GK  ++F+ H+
Sbjct: 1849 TSQVYSVCFSPNGQTLASGSNDKTIRFWDVKTGK--KKFKQHS 1889



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 29/104 (27%), Positives = 50/104 (48%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH   V  +  +P     + S S DKT+ +W     +  +      L GH
Sbjct: 1921 KTGQQKSRLYGHEYAVKSVCFSPD-GTTLASGSDDKTIRLWDTKTGQQKF-----ILKGH 1974

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            ++ +  +  S DG+   SGS D ++RLWD+  G   ++ + H K
Sbjct: 1975 ANAVYSLCFSPDGSTLASGSDDMSIRLWDIKTGLQKQKLDGHKK 2018


>UniRef50_A0DAZ5 Cluster: Chromosome undetermined scaffold_43, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_43,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 779

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 33/102 (32%), Positives = 53/102 (51%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           +G ++L K F      LK    L  H   V  +    K    I S S DK++ +W L  +
Sbjct: 494 AGCNNLIKVFEFSQGQLKQIQVLSEHQNDVHTLQFMKKSAQFI-SGSADKSIKIWSL--N 550

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +NN    Q++L GH+H+I  ++L +  N  ++GS DKT++ W
Sbjct: 551 QNNEWFCQQKLIGHTHYIRCMILDNTENLIITGSPDKTIKFW 592


>UniRef50_O74184 Cluster: WD repeat-containing protein pop3; n=5;
           Dikarya|Rep: WD repeat-containing protein pop3 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 314

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 27/95 (28%), Positives = 51/95 (53%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           + H  ++T+   +P    +   S+ D T+ +W     E+   + ++RL GH  ++ D   
Sbjct: 212 QAHQRYITRCVLSPDVKHLATCSA-DATVNIWST---EDMSFMLERRLQGHQRWVWDCAF 267

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S+D  Y ++ S D   RLW+L++G+T R++  H K
Sbjct: 268 SADSTYLVTASSDHVARLWELSSGETIRQYSGHHK 302



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 13/54 (24%), Positives = 28/54 (51%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +P     GH++ ++ +    DG +  + S D T+++WD+ A    R ++  + V
Sbjct: 74  MPLMTFEGHTNNVTAIAFHCDGKWLATSSEDGTVKVWDMRAPSVQRNYDHKSPV 127


>UniRef50_Q7NID9 Cluster: WD-repeat protein; n=1; Gloeobacter
            violaceus|Rep: WD-repeat protein - Gloeobacter violaceus
          Length = 1721

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 40/100 (40%), Positives = 50/100 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL GHN  V  +A +P     I S+S DKT+ VW   RD+   GI  K L GH+  
Sbjct: 1215 KLIKTLTGHNDKVIDVAFSPD-GKWIASASADKTVKVW---RDD---GILSKTLKGHTEQ 1267

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            I  V  S +     + S DKT++LW L  G   R    HT
Sbjct: 1268 IESVTFSPNSQMIATASVDKTVKLWQL-NGVLIRTVRGHT 1306



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 32/99 (32%), Positives = 51/99 (51%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  TL+GH   +  +  +P    MI ++S DKT+ +W+L       G+  + + GH+  +
Sbjct: 1257 LSKTLKGHTEQIESVTFSPN-SQMIATASVDKTVKLWQLN------GVLIRTVRGHTDGV 1309

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             DVV S DG    +GS D+T+ LW +  G   R    H+
Sbjct: 1310 YDVVFSQDGQTFATGSSDRTIMLWHV-DGTLIRTLRGHS 1347



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 32/96 (33%), Positives = 46/96 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH  W++ IA +P     I S+S DKT+ +W      N+ G   K L+  +  +  V 
Sbjct: 1097 LVGHKSWISSIAHSPD-GKAIASASADKTVKIW------NSNGTSFKTLFTDTSDVRAVS 1149

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    +G+ +  L LW LA GK  R    H +
Sbjct: 1150 YSPDGRLIATGNLNGGLNLW-LAEGKWLRFIPAHVQ 1184



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 31/94 (32%), Positives = 46/94 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLR H+  V  +A +P     ++S+  DK +IVWK        G   + L GHS  ++ V
Sbjct: 1464 TLREHSRPVFSVAISPN-GQYLVSAGADKNIIVWKAD------GTKLRVLKGHSSEVNRV 1516

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              ++ G   +SG  D  L LW++  G   R  ED
Sbjct: 1517 FFTASGQEIISGGADGKLILWNI-DGSKKRTIED 1549



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/89 (29%), Positives = 41/89 (46%)
 Frame = +2

Query: 92   VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
            V  IA  P+   +I   S D T+ +W       N G     L GH   + D+ +S D   
Sbjct: 1390 VRSIALGPQEQFLIAGGS-DGTIKIW------GNNGRQISTLRGHIRTVHDISISPDKKM 1442

Query: 272  ALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              S  WDKT++LW   +G+  +   +H++
Sbjct: 1443 IASAGWDKTIKLWH-TSGELIQTLREHSR 1470



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 26/76 (34%), Positives = 41/76 (53%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            I++SS D T+ VW++       G   K L GH+  + DV  S DG +  S S DKT+++W
Sbjct: 1198 IVTSSYDGTIKVWRIN------GKLIKTLTGHNDKVIDVAFSPDGKWIASASADKTVKVW 1251

Query: 311  DLAAGKTTRRFEDHTK 358
                G  ++  + HT+
Sbjct: 1252 -RDDGILSKTLKGHTE 1266



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +2

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            RL GH  +IS +  S DG    S S DKT+++W+         F D + V
Sbjct: 1096 RLVGHKSWISSIAHSPDGKAIASASADKTVKIWNSNGTSFKTLFTDTSDV 1145



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 1/95 (1%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T+RGH   V  +  +         SS D+T+++W +       G   + L GHS  ++ +
Sbjct: 1301 TVRGHTDGVYDVVFSQDGQTFATGSS-DRTIMLWHVD------GTLIRTLRGHSASVNSL 1353

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTT-RRFED 349
                     ++G  D  LR+W L+   T+ + FE+
Sbjct: 1354 SFGRSDRTLVTGGDDSNLRIWKLSNFNTSFQAFEN 1388


>UniRef50_Q2JM75 Cluster: WD-repeat/protein kinase domain protein;
           n=2; Synechococcus|Rep: WD-repeat/protein kinase domain
           protein - Synechococcus sp. (strain JA-2-3B'a(2-13))
           (Cyanobacteria bacteriumYellowstone B-Prime)
          Length = 759

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 34/98 (34%), Positives = 48/98 (48%), Gaps = 5/98 (5%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-----QKRLYGHSHFIS 241
           GH G V  +A +P     ++S   DKT  VW L    +    P     + +L GH+  I+
Sbjct: 470 GHEGSVEALAISPD-GTFLVSGGADKTARVWDLATLGDPALSPGDVLARLQLQGHTGLIN 528

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V +S DG +  SGS D+T+RLW    G+  R    HT
Sbjct: 529 SVAISPDGRWIASGSADRTIRLWQADNGQLIRTLSPHT 566



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 13/39 (33%), Positives = 22/39 (56%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ + +S DGN   +G  D  +RLWD  AG+  + +  H
Sbjct: 433 VTALAISPDGNLLAAGGDDGVIRLWDPQAGQLLQSWAGH 471


>UniRef50_Q3W4E8 Cluster: G-protein beta WD-40 repeat; n=3;
           Frankia|Rep: G-protein beta WD-40 repeat - Frankia sp.
           EAN1pec
          Length = 540

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/96 (34%), Positives = 48/96 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P    +  S+S+D T+ +W +        +    L  H+H++  V
Sbjct: 418 TLPGHTEPVMSVAFSPDRRTLA-SASQDNTVRLWDVAARTAPRLVGS--LSDHTHWVMSV 474

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    S S D+T+RLWD+AA  TT     HT
Sbjct: 475 AFSPDGRILASASQDRTVRLWDVAARTTTHTLTGHT 510



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/75 (38%), Positives = 38/75 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S++ D T+ +W +   E     P   L GHS  +  V  S DG    S S D T+RLW
Sbjct: 309 LASANGDSTVQLWDVA--EGTLPHPVASLPGHSDAVGSVAFSPDGRTLASASDDHTVRLW 366

Query: 311 DLAAGKTTRRFEDHT 355
           D+A G TT    DHT
Sbjct: 367 DVATGTTTHTLTDHT 381



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/88 (31%), Positives = 46/88 (52%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L G+L  H  WV  +A +P    ++ S+S+D+T+ +W +      +      L GH+  
Sbjct: 459 RLVGSLSDHTHWVMSVAFSPD-GRILASASQDRTVRLWDVAARTTTH-----TLTGHTGP 512

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           +  V  S DG    S S D T+RLWD++
Sbjct: 513 VFSVAFSLDGRTLASASDDNTVRLWDMS 540



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 31/97 (31%), Positives = 46/97 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  V  +A +P     + S+S D T+ +W +       G     L  H+  ++ V
Sbjct: 334 SLPGHSDAVGSVAFSPD-GRTLASASDDHTVRLWDVAT-----GTTTHTLTDHTGPVNSV 387

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    S S D T+RLWD+A G   R    HT+
Sbjct: 388 AFSRDGRTLASASDDHTVRLWDVAEGTLLRTLPGHTE 424



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 3/99 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H G V  +A + +    + S+S D T+ +W +       G   + L GH+  +  V
Sbjct: 376 TLTDHTGPVNSVAFS-RDGRTLASASDDHTVRLWDVAE-----GTLLRTLPGHTEPVMSV 429

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTR---RFEDHT 355
             S D     S S D T+RLWD+AA    R      DHT
Sbjct: 430 AFSPDRRTLASASQDNTVRLWDVAARTAPRLVGSLSDHT 468



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           L  H+  +  V  S DG    S S D T RLWD+A
Sbjct: 250 LRDHTDSVRSVAFSRDGRTLASASQDGTARLWDIA 284


>UniRef50_Q119Z9 Cluster: Serine/threonine protein kinase with WD40
           repeats; n=1; Trichodesmium erythraeum IMS101|Rep:
           Serine/threonine protein kinase with WD40 repeats -
           Trichodesmium erythraeum (strain IMS101)
          Length = 608

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/90 (34%), Positives = 46/90 (51%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+RG L+GH  WV  +A +     ++ S S DK + +W +   +  +      L GHS  
Sbjct: 444 KMRGFLQGHTAWVESLAISLD-GKVLASGSGDKMIKLWDVQTGKLLFN-----LTGHSDV 497

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           +  V ++ DG    SGS D T+RLW L  G
Sbjct: 498 VRSVAIAPDGQILASGSSDHTVRLWQLGTG 527



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 1/105 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L G +  H+GWV  I  +P     ++S S D TL +W L   +    +  K  +G
Sbjct: 352 NEPQTLGGWMFSHSGWVQAIVFSPD-GQTLISGSNDGTLKIWNLGTGKLVRTL--KGWFG 408

Query: 224 HS-HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                +  + +S DG    SG  DKT+++W LA+GK     + HT
Sbjct: 409 QEWGAVHAIAISQDGQILASGHNDKTVKVWYLASGKMRGFLQGHT 453



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 37/107 (34%), Positives = 50/107 (46%), Gaps = 3/107 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSR-DKTLIVWKLTRDENNYGIPQKRLY 220
           T KL  TL+G  G  W    A        IL+S   DKT+ VW L       G  +  L 
Sbjct: 396 TGKLVRTLKGWFGQEWGAVHAIAISQDGQILASGHNDKTVKVWYLAS-----GKMRGFLQ 450

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH+ ++  + +S DG    SGS DK ++LWD+  GK       H+ V
Sbjct: 451 GHTAWVESLAISLDGKVLASGSGDKMIKLWDVQTGKLLFNLTGHSDV 497



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/69 (31%), Positives = 35/69 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S   D  + VW L        +    ++ HS ++  +V S DG   +SGS D TL++W
Sbjct: 334 VVSGGEDNNIKVWTLGTGNEPQTLGGW-MFSHSGWVQAIVFSPDGQTLISGSNDGTLKIW 392

Query: 311 DLAAGKTTR 337
           +L  GK  R
Sbjct: 393 NLGTGKLVR 401



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 30/89 (33%), Positives = 43/89 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T KL   L GH+  V  +A  P    ++ S S D T+ +W+L    N  G+ Q     H
Sbjct: 483 QTGKLLFNLTGHSDVVRSVAIAPD-GQILASGSSDHTVRLWQLGTG-NLLGVLQ-----H 535

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              ++ V +SSDG    SG  D  L LW+
Sbjct: 536 PDAVNSVAISSDGLILASGCRDGNLYLWN 564


>UniRef50_A7C479 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Beggiatoa sp. PS|Rep: Serine/Threonine
           protein kinase with WD40 repeats - Beggiatoa sp. PS
          Length = 261

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 34/93 (36%), Positives = 49/93 (52%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL GH  WV  I+ +P     I+S+S +KT+ +W ++      G     L GH+
Sbjct: 68  TGKCLNTLLGHKNWVWSISFSPD-GQSIVSASYNKTIKLWNVSS-----GQCLNTLQGHT 121

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
             I  VV S DG    SGS D+T++ WD+  G+
Sbjct: 122 DKIRSVVFSPDGQTFASGSDDQTVKRWDVTTGQ 154



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 27/96 (28%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   +  +  NP     + S S D T+ +W +       G     L GH +++  +
Sbjct: 32  TLQGHTDRIRSVIFNPN-GQSVASGSDDHTIKLWDVYT-----GKCLNTLLGHKNWVWSI 85

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG   +S S++KT++LW++++G+     + HT
Sbjct: 86  SFSPDGQSIVSASYNKTIKLWNVSSGQCLNTLQGHT 121



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  S DG   +SGS D T++LWD++ G+     + HT
Sbjct: 1   MAFSPDGKIIVSGSEDHTIKLWDVSNGRCLNTLQGHT 37



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 24/77 (31%), Positives = 36/77 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+G+   +  I  NP    ++     DKT+  WK++      G     L+GH   I  V
Sbjct: 158 SLQGYRDGIWSIVFNPDGQTLVCCGD-DKTIKFWKVST-----GQYLNSLHGHGSRIRSV 211

Query: 248 VLSSDGNYALSGSWDKT 298
           V S DG   +SG  D+T
Sbjct: 212 VFSHDGRTLVSGGDDQT 228



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 24/95 (25%), Positives = 40/95 (42%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   +  +  +P       S S D+T+  W +T      G     L G+   I  +
Sbjct: 116 TLQGHTDKIRSVVFSPD-GQTFASGSDDQTVKRWDVTT-----GQCLNSLQGYRDGIWSI 169

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V + DG   +    DKT++ W ++ G+       H
Sbjct: 170 VFNPDGQTLVCCGDDKTIKFWKVSTGQYLNSLHGH 204


>UniRef50_A0ZIS9 Cluster: WD-40 repeat protein; n=1; Nodularia
           spumigena CCY 9414|Rep: WD-40 repeat protein - Nodularia
           spumigena CCY 9414
          Length = 587

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/103 (32%), Positives = 52/103 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K + TL GH   V  +A +P    +++SSS+DKT+ +W L        + Q       
Sbjct: 349 TRKHKLTLNGHTDTVYAVAMSPNC-QILVSSSKDKTIRIWDLETGRERCILTQDSA---- 403

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                V++S DG   +SGS D T++LW+L  G+ +     HT+
Sbjct: 404 --AKTVIISPDGETLISGSKDSTIKLWNLHTGELSCTLTGHTR 444



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 32/103 (31%), Positives = 48/103 (46%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
           +K  ET +   TL+GH+  V  +A +P     I S S DKT+ +W L     N G     
Sbjct: 212 TKNPETWRCVQTLKGHSAAVNALAISPDGQTFI-SGSNDKTVCLWDL-----NTGKCLYT 265

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            YG +  +  V +S +G   +SG  D+ +  W L   +  R F
Sbjct: 266 FYGQAEAVLSVAISPNGKQIISGCVDRKISSWQLDTKEYLRTF 308



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = +2

Query: 161 IVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           I+ + T++   +   Q  L GHS  ++ + +S DG   +SGS DKT+ LWDL  GK    
Sbjct: 207 IILQTTKNPETWRCVQT-LKGHSAAVNALAISPDGQTFISGSNDKTVCLWDLNTGKCLYT 265

Query: 341 F 343
           F
Sbjct: 266 F 266



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISD 244
           T  G    V  +A +P     I+S   D+ +  W+L T++           Y H+ F++ 
Sbjct: 265 TFYGQAEAVLSVAISPN-GKQIISGCVDRKISSWQLDTKEYLRTFSYLNSPYSHNGFVTS 323

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  S DG    S S DKT+R+W     K       HT
Sbjct: 324 LTYSLDGRIIASASTDKTIRIWGGYTRKHKLTLNGHT 360



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S S+D T+ +W L   E +       L GH+  +  + +  DG    S S D  ++
Sbjct: 414 ETLISGSKDSTIKLWNLHTGELSC-----TLTGHTRAVLSLAIHPDGKTLASSSSDGVIK 468

Query: 305 LWDLAAGK 328
           LW+L  G+
Sbjct: 469 LWNLQTGE 476


>UniRef50_Q6AWF2 Cluster: AT26369p; n=8; Diptera|Rep: AT26369p -
            Drosophila melanogaster (Fruit fly)
          Length = 1923

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 1409 KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 1463

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 1464 VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1502



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 1351 VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 1405 ATGGKLSQVLVGHS 1418



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 936  KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    +S S D ++ + DLA+GK   R   H
Sbjct: 992  AGANNTLIISSSEDASIAITDLASGKLRHRITHH 1025



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 1391 IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 1445

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 1446 WDLLTGEEVHTLAGH 1460



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 1247 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 1296



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 983  HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 1036

Query: 260  DGNYALSGSWDKTLRLWDL 316
              +  +SG  D+T+ +WDL
Sbjct: 1037 ACDVLISGGLDRTICVWDL 1055


>UniRef50_Q4QIC8 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 1407

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 33/96 (34%), Positives = 46/96 (47%), Gaps = 2/96 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDV 247
           L GH   V  +A NP   + +LS S D TL VW L + D +   +  + L GH+  +  V
Sbjct: 615 LAGHTDAVCDVAYNPTALNYLLSGSYDGTLRVWDLSSNDAHTISVSSRALKGHADRVRSV 674

Query: 248 VLSSDGNY-ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S   Y  +SGS D ++RLWD+  G        H
Sbjct: 675 AWCSLAPYLVISGSADASIRLWDIRNGVAITTVRGH 710



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +2

Query: 113 PKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSW 289
           P    MI   S D  + V+ L+    +   P   L GH+  + DV  +    NY LSGS+
Sbjct: 584 PAKSKMIAVGSHDHRIYVYNLSSSSEH---PVHVLAGHTDAVCDVAYNPTALNYLLSGSY 640

Query: 290 DKTLRLWDLAA 322
           D TLR+WDL++
Sbjct: 641 DGTLRVWDLSS 651



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           T+RGHN  V  I+++   P   LS++RD TL+ W +
Sbjct: 706 TVRGHNADVVAISSHVDRPLTFLSAARDSTLVAWNV 741


>UniRef50_A7RFR6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 292

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 35/103 (33%), Positives = 51/103 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     +L GH+G V  IA       ++ S+S+D+TL +W L    +        L GH
Sbjct: 127 ETCAFVNSLDGHDGHVRGIAITSDGRRLV-SASQDRTLRIWNLETFAH-----VSTLRGH 180

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  V  S D  +A+SGS D  +++WDL + K  R    HT
Sbjct: 181 SETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHT 223



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/102 (27%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K    L  H   V  +A +P + D ++S + D T+ +W    D +   +    L GH
Sbjct: 43  ETGKELNKLLDHTKLVYTLALSP-HADFLVSGAFDHTVKIW----DMDTLSLVHT-LKGH 96

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +++S V+++ D    +S S+DKT+++WD+         + H
Sbjct: 97  KNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGH 138



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 28/88 (31%), Positives = 41/88 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E+ K   +L GH   +  +A  P     ++SS  D  + VW L   E         L+GH
Sbjct: 211 ESAKEVRSLVGHTSDIFAVAVTPD-GSKVISSGDDTQVKVWSLESGEE-----LASLHGH 264

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
           S  +  V +S DG   +SGS D T ++W
Sbjct: 265 SESVRIVTVSPDGLTIVSGSEDATFKIW 292



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 27/104 (25%), Positives = 47/104 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TLRGH+  V  +  +P      +S S D  + +W L   +       + L GH
Sbjct: 169 ETFAHVSTLRGHSETVYCVCCSPD-DKFAISGSEDTMVKIWDLESAKE-----VRSLVGH 222

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +  I  V ++ DG+  +S   D  +++W L +G+       H++
Sbjct: 223 TSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSE 266



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           G S  I  + ++ D    ++G  D ++R+WD   GK   +  DHTK+
Sbjct: 11  GRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKL 57


>UniRef50_A7AP41 Cluster: WD domain, G-beta repeat containing
           protein; n=1; Babesia bovis|Rep: WD domain, G-beta
           repeat containing protein - Babesia bovis
          Length = 528

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 37/104 (35%), Positives = 51/104 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  +  GH   V  +A +P   D++ S  RD  + VW +   E  +      L GH
Sbjct: 288 EQNKVIRSYHGHLSGVYCLALHPAL-DVLFSGGRDAVVRVWDIRTKEAVHV-----LSGH 341

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S  I  +V  +     +SGS DKT+RLWDLAAGK      +H K
Sbjct: 342 SGTIMSLVSQNSEPQVISGSQDKTVRLWDLAAGKNIVTLTNHKK 385



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 25/99 (25%), Positives = 42/99 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  ++ +        + S D+ + +W L   +         L GH + 
Sbjct: 207 KLYRMIVGHQGWVHCVSVDVSN-QWFATGSSDRLIKIWDLATCQLKLS-----LTGHINA 260

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           + D+ +S    Y  S   D T++ WD+   K  R +  H
Sbjct: 261 VRDLKISDRHAYLFSCGEDNTVKCWDIEQNKVIRSYHGH 299


>UniRef50_A0DMB8 Cluster: Chromosome undetermined scaffold_56, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_56,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 481

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 28/81 (34%), Positives = 49/81 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ W+T +A   +  D +++S+ ++ +++W   +D  +Y   QK L GH+  I  + 
Sbjct: 271 LIGHDDWITALAIGNQ--DQLIASASNQEILIWSYKQD--HYAKVQK-LLGHTDSIYSLG 325

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
             S   Y +SGS+DKT+RLW+
Sbjct: 326 FLSQQEYLISGSFDKTVRLWE 346



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 19/63 (30%), Positives = 38/63 (60%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S S DKT+ +W+  +D+  +   Q+  Y HS  +  +  S++  +  S SWD+++R
Sbjct: 331 EYLISGSFDKTVRLWE-GKDKQQWNFKQQ-FYYHSDKVQSIACSNNKLFG-SCSWDQSIR 387

Query: 305 LWD 313
           L+D
Sbjct: 388 LYD 390


>UniRef50_Q5B810 Cluster: Putative uncharacterized protein; n=1;
           Emericella nidulans|Rep: Putative uncharacterized
           protein - Emericella nidulans (Aspergillus nidulans)
          Length = 2088

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 31/104 (29%), Positives = 48/104 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+ TL GH  WV  +  +     ++ S+S D T+ +W     +   G  Q  L GH 
Sbjct: 389 TGSLQHTLEGHRDWVRSVIFSHD-SQLLASASDDSTVKIW-----DTGTGSLQHTLEGHR 442

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            ++  V+ S D     S S D+T+R+WD   G      E H+ +
Sbjct: 443 DWVRSVIFSHDSRLLASASDDRTVRIWDTEKGSHKHTLEGHSSL 486



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 30/103 (29%), Positives = 48/103 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET  L+ TL GH+  V  +  +  +   +L+S+ D T+ +W     +   G  Q  L G
Sbjct: 304 TETGSLQHTLEGHSDLVRSVIFS--HDSRLLASASDSTVKIW-----DTGTGSLQHTLEG 356

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           H  ++  V+ S D     S S D T+++WD   G      E H
Sbjct: 357 HRDWVRSVIFSHDSQLLASASDDSTVKIWDTGTGSLQHTLEGH 399



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 30/99 (30%), Positives = 48/99 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L+ TL GH  WV  +  +     ++ S+S D+T+ +W     +   G  +  L GHS
Sbjct: 431 TGSLQHTLEGHRDWVRSVIFSHD-SRLLASASDDRTVRIW-----DTEKGSHKHTLEGHS 484

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
             ++ V  S D     S S D+T+R+WD+ A      F+
Sbjct: 485 SLVTSVSFSHDSRLLASASNDQTVRIWDIEARSLQHTFD 523



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 16/56 (28%), Positives = 25/56 (44%)
 Frame = +2

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           N++    + L GH   +  V  S D     S S D+T+++WD   G      E H+
Sbjct: 262 NHWSPCLQALEGHEAAVLSVSYSHDSRLLASASDDRTVKIWDTETGSLQHTLEGHS 317


>UniRef50_Q8YV57 Cluster: Uncharacterized WD repeat-containing protein
            all2124; n=2; Nostocaceae|Rep: Uncharacterized WD
            repeat-containing protein all2124 - Anabaena sp. (strain
            PCC 7120)
          Length = 1683

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 32/86 (37%), Positives = 46/86 (53%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL GH  WV  ++ +P     + S+S DKT+ +W++       G   K L GH+  
Sbjct: 1230 KLLKTLNGHQDWVNSLSFSPD-GKTLASASADKTIKLWRIAD-----GKLVKTLKGHNDS 1283

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWD 313
            + DV  SSDG    S S D T++LW+
Sbjct: 1284 VWDVNFSSDGKAIASASRDNTIKLWN 1309



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 35/104 (33%), Positives = 57/104 (54%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S+   L  TL G+   +  I+  P+  D+I S++ DKT+ +W++ RD    G   K L G
Sbjct: 1392 SQDGSLLKTLPGNKA-IYGISFTPQ-GDLIASANADKTVKIWRV-RD----GKALKTLIG 1444

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H + ++ V  S DG    S S D T++LW+++ GK  +  + HT
Sbjct: 1445 HDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDGKFKKTLKGHT 1488



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V  +  +P     I + S DKT+ +W   R +   G   K L GH  +++ +
Sbjct: 1192 TLTGHSAGVITVRFSPD-GQTIAAGSEDKTVKLWH--RQD---GKLLKTLNGHQDWVNSL 1245

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    S S DKT++LW +A GK  +  + H
Sbjct: 1246 SFSPDGKTLASASADKTIKLWRIADGKLVKTLKGH 1280



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 38/118 (32%), Positives = 55/118 (46%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG  SL K     S   +L  TL GH   V  ++ +P     I S   DKT+ +W+ T 
Sbjct: 1088 ASG--SLDKTIKLWSRDGRLFRTLNGHEDAVYSVSFSPD-GQTIASGGSDKTIKLWQ-TS 1143

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            D    G   K + GH   +++V  S DG    S S D +++LWD  +G+       H+
Sbjct: 1144 D----GTLLKTITGHEQTVNNVYFSPDGKNLASASSDHSIKLWDTTSGQLLMTLTGHS 1197



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH+  V ++  +P     + S+SRD T+ +W ++      G  +K L GH+  +  V
Sbjct: 1441 TLIGHDNEVNKVNFSPD-GKTLASASRDNTVKLWNVSD-----GKFKKTLKGHTDEVFWV 1494

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    S S DKT+RLWD  +G   +    H
Sbjct: 1495 SFSPDGKIIASASADKTIRLWDSFSGNLIKSLPAH 1529



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 34/108 (31%), Positives = 53/108 (49%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            K + TL+GH   V  ++ +P    +I S+S DKT+ +W     ++  G   K L  H+  
Sbjct: 1479 KFKKTLKGHTDEVFWVSFSPD-GKIIASASADKTIRLW-----DSFSGNLIKSLPAHNDL 1532

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*F 379
            +  V  + DG+   S S DKT++LW    G     F  H+ V  +S F
Sbjct: 1533 VYSVNFNPDGSMLASTSADKTVKLWRSHDGHLLHTFSGHSNVVYSSSF 1580



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 32/103 (31%), Positives = 46/103 (44%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            R  L GH   V  I+ + +    I S S DKT+ +W  +RD   +    + L GH   + 
Sbjct: 1065 RNRLEGHKDGVISISIS-RDGQTIASGSLDKTIKLW--SRDGRLF----RTLNGHEDAVY 1117

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QN 370
             V  S DG    SG  DKT++LW  + G   +    H +   N
Sbjct: 1118 SVSFSPDGQTIASGGSDKTIKLWQTSDGTLLKTITGHEQTVNN 1160



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 32/87 (36%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +2

Query: 56   KLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            KL  TL+GHN   W    +++ K    I S+SRD T+ +W      N +GI  +   GHS
Sbjct: 1272 KLVKTLKGHNDSVWDVNFSSDGK---AIASASRDNTIKLW------NRHGIELETFTGHS 1322

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLW 310
              +  V    D N   S S D T+RLW
Sbjct: 1323 GGVYAVNFLPDSNIIASASLDNTIRLW 1349



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 27/83 (32%), Positives = 42/83 (50%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            +L  HN  V  +  NP    M+ S+S DKT+ +W+     ++ G       GHS+ +   
Sbjct: 1525 SLPAHNDLVYSVNFNPD-GSMLASTSADKTVKLWR-----SHDGHLLHTFSGHSNVVYSS 1578

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              S DG Y  S S DKT+++W +
Sbjct: 1579 SFSPDGRYIASASEDKTVKIWQI 1601



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH+  V   + +P     I S+S DKT+ +W++       G     L  H   +   
Sbjct: 1567 TFSGHSNVVYSSSFSPD-GRYIASASEDKTVKIWQID------GHLLTTLPQHQAGVMSA 1619

Query: 248  VLSSDGNYALSGSWDKTLRLW--DLAAGKTTR 337
            + S DG   +SGS D T ++W  D    KT++
Sbjct: 1620 IFSPDGKTLISGSLDTTTKIWRFDSQQAKTSQ 1651


>UniRef50_UPI000045BE0A Cluster: COG2319: FOG: WD40 repeat; n=1;
           Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40
           repeat - Nostoc punctiforme PCC 73102
          Length = 343

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 28/70 (40%), Positives = 42/70 (60%)
 Frame = +2

Query: 152 KTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           K+  VW L   +     PQ  L GH++ I D+ LS+DG   +SGS DKT+++W+LA GK 
Sbjct: 80  KSFTVWHLPSQQ-----PQLTLKGHANDIYDLALSADGQTLVSGSLDKTIKVWNLATGKL 134

Query: 332 TRRFEDHTKV 361
               + H++V
Sbjct: 135 KFTLKGHSEV 144



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 32/101 (31%), Positives = 48/101 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL+ TL+GH+  V  +A  P     I+S+S DKT+ +W L   +    + Q       
Sbjct: 131 TGKLKFTLKGHSEVVNALAIAPNQ-QTIVSASSDKTIKMWNLATGQLTSTLAQT-----P 184

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +  +VLSSDG   +SG     + +WDL  G+       H
Sbjct: 185 DAVITLVLSSDGKTLVSGDSSNHITVWDLVTGRKRTTLTGH 225



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/89 (30%), Positives = 48/89 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH   +  +A +     ++ S S DKT+ VW L   +  +      L GHS  ++ +
Sbjct: 95  TLKGHANDIYDLALSADGQTLV-SGSLDKTIKVWNLATGKLKF-----TLKGHSEVVNAL 148

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
            ++ +    +S S DKT+++W+LA G+ T
Sbjct: 149 AIAPNQQTIVSASSDKTIKMWNLATGQLT 177



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 21/71 (29%), Positives = 33/71 (46%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S      + VW L       G  +  L GH   +S + +S DG    SGS  K +++W
Sbjct: 199 LVSGDSSNHITVWDLVT-----GRKRTTLTGHYGVVSALAISRDGQLLASGS-AKQVKVW 252

Query: 311 DLAAGKTTRRF 343
           +L  GK  + F
Sbjct: 253 NLTTGKLLQDF 263


>UniRef50_UPI0000ECB020 Cluster: PQQ repeat and WD repeat domain
           containing; n=2; Gallus gallus|Rep: PQQ repeat and WD
           repeat domain containing - Gallus gallus
          Length = 248

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 28/87 (32%), Positives = 45/87 (51%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   +T+   +P     + S S DK + +W +     +  I +    GHS+ ISD   +S
Sbjct: 129 HRSAITRCCFDPGN-QRVTSVSYDKAIKLWDMVARSTSITIKE----GHSNAISDCCFTS 183

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRR 340
           DG Y  + SWDK+L++WD+  G+   R
Sbjct: 184 DGRYLCTASWDKSLKIWDIKTGEFQSR 210



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/66 (34%), Positives = 38/66 (57%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ILS S D+T+ +W + +     G P + L  H+  +S+  LS DG   ++ S+D T++ W
Sbjct: 18  ILSCSYDRTVKLWDVAK-----GFPVQILEEHTAPVSECNLSPDGRRVVTSSYDNTVKTW 72

Query: 311 DLAAGK 328
           D+  GK
Sbjct: 73  DMETGK 78



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GHS  +S      + +  LS S+D+T++LWD+A G   +  E+HT
Sbjct: 1   GHSDTVSSCHFCCEDSKILSCSYDRTVKLWDVAKGFPVQILEEHT 45



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 16/61 (26%), Positives = 29/61 (47%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++S DK+L +W +   E     P     GH   +S    S D +  +SG +D  + +W
Sbjct: 188 LCTASWDKSLKIWDIKTGEFQSRGPVTLSQGHEGSVSSCCFSQDASLVVSGGYDNAIAIW 247

Query: 311 D 313
           +
Sbjct: 248 E 248


>UniRef50_Q3M407 Cluster: WD-40 repeat; n=1; Anabaena variabilis
           ATCC 29413|Rep: WD-40 repeat - Anabaena variabilis
           (strain ATCC 29413 / PCC 7937)
          Length = 443

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 33/87 (37%), Positives = 46/87 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   +  +A +     +  S S DKT+ +W L   +  Y      L GHS  ++ +
Sbjct: 283 TLTGHAESINSLAFSNNELTLA-SGSVDKTIKLWDLETGKEIY-----TLTGHSGTVNSI 336

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
            LS+DG    SGS DKT++LWDL  GK
Sbjct: 337 CLSNDGQILASGSVDKTIKLWDLETGK 363



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 36/94 (38%), Positives = 48/94 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   TL GH+G V  I  +     ++ S S DKT+ +W L       G     L GH
Sbjct: 318 ETGKEIYTLTGHSGTVNSICLSND-GQILASGSVDKTIKLWDLET-----GKEICTLIGH 371

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
              I  V +SSDG    S S DKT+++W++A GK
Sbjct: 372 LESIESVTISSDGQILASASVDKTVKIWEMATGK 405



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 32/96 (33%), Positives = 45/96 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ W     T      ++ S S DKT+ +W L       G     L GH+  I+ +
Sbjct: 241 TLTGHS-WAIYAVTFSSNRVVLASGSGDKTIKLWDLAT-----GQEISTLTGHAESINSL 294

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S++     SGS DKT++LWDL  GK       H+
Sbjct: 295 AFSNNELTLASGSVDKTIKLWDLETGKEIYTLTGHS 330



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/97 (30%), Positives = 44/97 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+ W     T      ++ S   D  + +W++       G   + L GHS  I  V
Sbjct: 199 SLTGHS-WSVYAITFSNDGQILASGGGDGNIKLWEVVS-----GQEIRTLTGHSWAIYAV 252

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             SS+     SGS DKT++LWDLA G+       H +
Sbjct: 253 TFSSNRVVLASGSGDKTIKLWDLATGQEISTLTGHAE 289



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 21/88 (23%), Positives = 41/88 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   TL GH   +  +  +     ++ S+S DKT+ +W++   +  + +       H
Sbjct: 360 ETGKEICTLIGHLESIESVTISSD-GQILASASVDKTVKIWEMATGKEVFTL------SH 412

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
           S  ++ +  S DGN   +G     +++W
Sbjct: 413 SSSVNSIAFSPDGNLLAAGDSGGNIKIW 440


>UniRef50_Q113P7 Cluster: Serine/threonine protein kinase with WD40
           repeats; n=1; Trichodesmium erythraeum IMS101|Rep:
           Serine/threonine protein kinase with WD40 repeats -
           Trichodesmium erythraeum (strain IMS101)
          Length = 733

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 30/89 (33%), Positives = 45/89 (50%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           V  I T     D++ S S D  + +W++   ++      + L GHS  +  V  SSDG  
Sbjct: 584 VNNICTEKNSNDILASCSADGAIKIWQVGCCQS-----LRTLRGHSGDVYSVAFSSDGKA 638

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             SG  DKT+RLWD+  G+    FE H++
Sbjct: 639 IASGGEDKTIRLWDVGTGELVNIFEGHSR 667



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+G V  +A +      I S   DKT+ +W +   E           GHS  +  V
Sbjct: 619 TLRGHSGDVYSVAFSSD-GKAIASGGEDKTIRLWDVGTGEL-----VNIFEGHSRAVLSV 672

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
            +S D     SGS D T++LW+L  GK
Sbjct: 673 AISPDDQILASGSIDGTVKLWNLRTGK 699



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 6/108 (5%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD---ENNY---GIPQ 208
           +T +L     GH   V  IA +      I+S+  D+T++VW L +    +  Y   G P 
Sbjct: 469 QTGQLLHKFLGHTAEVYAIAISVD-GRRIISAGDDRTILVWNLQKKTIADRFYSYSGSPY 527

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              YG    I  V +S +     SGS D+T+++W+   G+   +  +H
Sbjct: 528 SHRYGA---IFSVAISPNCETIASGSADQTVKIWNQRNGELLYKLHEH 572



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 25/109 (22%), Positives = 52/109 (47%), Gaps = 1/109 (0%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMIL-SSSRDKTLIVWKLTRDENNYGIPQ 208
           + ++S+  K    ++ +   +  IA + +  D+IL S S DK + +W L   +  +    
Sbjct: 422 YVELSQLWKTVQIIKDNTAPINTIAIDTQ--DLILVSGSDDKKIRLWNLQTGQLLH---- 475

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  GH+  +  + +S DG   +S   D+T+ +W+L       RF  ++
Sbjct: 476 -KFLGHTAEVYAIAISVDGRRIISAGDDRTILVWNLQKKTIADRFYSYS 523



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 5/87 (5%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ-----KRLYGHSHFISDVVLSSDGNYA 274
           N K  D ++     K   V K T+  N   + Q     + +  ++  I+ + + +     
Sbjct: 395 NSKLLDNVIEFEHKKANFVPKKTKIRNYVELSQLWKTVQIIKDNTAPINTIAIDTQDLIL 454

Query: 275 LSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +SGS DK +RLW+L  G+   +F  HT
Sbjct: 455 VSGSDDKKIRLWNLQTGQLLHKFLGHT 481


>UniRef50_A3IXZ8 Cluster: WD-40 repeat; n=3; Chroococcales|Rep: WD-40
            repeat - Cyanothece sp. CCY 0110
          Length = 1151

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 32/95 (33%), Positives = 49/95 (51%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH  WV  +A +P     I S   D+T+ +W+  +D    G   K + GHS  +  V
Sbjct: 914  TLKGHTDWVLTVAISPD-SQFIASGGLDRTIKLWR--KD----GTLIKTITGHSRGVLSV 966

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG Y +SG  D+T+++W L  G   +  + H
Sbjct: 967  DFSPDGQYLVSGGRDQTIKIWRL-DGSLVKTIKGH 1000



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 31/95 (32%), Positives = 50/95 (52%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T+ GH+  V  +  +P     ++S  RD+T+ +W+L       G   K + GH   +  V
Sbjct: 955  TITGHSRGVLSVDFSPD-GQYLVSGGRDQTIKIWRLD------GSLVKTIKGHEGPVESV 1007

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +S DG+  +SGS D TL+LW+   G+  + FE H
Sbjct: 1008 AISPDGSKIVSGSRDTTLKLWNW-QGELLQSFETH 1041



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/83 (37%), Positives = 41/83 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T++GH G V  +A +P     I+S SRD TL +W      N  G   +    H   +  V
Sbjct: 996  TIKGHEGPVESVAISPD-GSKIVSGSRDTTLKLW------NWQGELLQSFETHQERVWTV 1048

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              S +G    SGS DKT+R WDL
Sbjct: 1049 AFSPNGEMIASGSDDKTVRFWDL 1071



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +  +A +P    ++ ++SRD TL +W+   +E +  +    L  H+  +S VV S 
Sbjct: 836  HQAEIRGVAFSPDQTHVV-TASRDHTLKLWR--PEEESIML----LRDHTDGVSTVVYSP 888

Query: 260  DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG +  SGS D+T+RLW    G+  R  + HT
Sbjct: 889  DGQFFASGSRDETVRLWS-NQGENFRTLKGHT 919



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/80 (31%), Positives = 41/80 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LR H   V+ +  +P       S SRD+T+ +W      +N G   + L GH+ ++  V 
Sbjct: 874  LRDHTDGVSTVVYSPD-GQFFASGSRDETVRLW------SNQGENFRTLKGHTDWVLTVA 926

Query: 251  LSSDGNYALSGSWDKTLRLW 310
            +S D  +  SG  D+T++LW
Sbjct: 927  ISPDSQFIASGGLDRTIKLW 946



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 29/87 (33%), Positives = 44/87 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   L+GH+  V  +  +       LSSS+D T+ +W  T+D    G   K    H+H 
Sbjct: 664 KLLNKLKGHSAEVYDVEFSHN-GQFFLSSSKDHTIKLW--TKD----GQLLKTFQDHNHT 716

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDL 316
           + +V  S + +Y LS S D T++ W L
Sbjct: 717 VWEVEWSENDSYFLSASEDGTIKQWTL 743



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = +2

Query: 194 YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           YG  Q  R  GH   +  V +S DG   ++ SWD TL+LW+   GK  +   DH
Sbjct: 540 YGSLQFNRFTGHKDGVWGVDISGDGQMLVTASWDHTLKLWE-RDGKLLKTLTDH 592



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L GHS  + DV  S +G + LS S D T++LW    G+  + F+DH
Sbjct: 668 KLKGHSAEVYDVEFSHNGQFFLSSSKDHTIKLW-TKDGQLLKTFQDH 713



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 27/79 (34%), Positives = 36/79 (45%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   V  +A +P   +MI S S DKT+  W L       G   K LYG++  I  +  S 
Sbjct: 1041 HQERVWTVAFSPN-GEMIASGSDDKTVRFWDLE------GQLIKTLYGYNSMIRSIAFSP 1093

Query: 260  DGNYALSGSWDKTLRLWDL 316
            +      GS +  L LWDL
Sbjct: 1094 NSEQLAVGSRENMLILWDL 1112



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H+G V  I   PK   +  S+  D+T+ +W +       G        H   + D+
Sbjct: 750 TIFAHSGAVMDIEFVPKRK-VFFSAGEDQTIKLWTVE------GELIDSFSSHRDGVLDL 802

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            ++    +  S SWDKT++LW
Sbjct: 803 AVAPHNTFWASASWDKTVKLW 823



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 2/119 (1%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKL 175
            +S      K ++K  + LK   T + HN   W  + + N  Y    LS+S D T+  W L
Sbjct: 690  SSSKDHTIKLWTKDGQLLK---TFQDHNHTVWEVEWSENDSY---FLSASEDGTIKQWTL 743

Query: 176  TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              D N      K ++ HS  + D+          S   D+T++LW +  G+    F  H
Sbjct: 744  --DGNLI----KTIFAHSGAVMDIEFVPKRKVFFSAGEDQTIKLWTV-EGELIDSFSSH 795


>UniRef50_A0YIY4 Cluster: WD-40 repeat protein; n=3; Bacteria|Rep:
            WD-40 repeat protein - Lyngbya sp. PCC 8106
          Length = 1394

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  TL GH  WV  +  +PK  D++ ++SRDKT+ +WK        G     L GH   +
Sbjct: 944  LVNTLEGHENWVRGVTFSPK-GDLLATASRDKTVKLWKAD------GTLITTLRGHEDRV 996

Query: 239  SDVVLSSDGNYALSGSWDKTLRLW 310
             +V  S +GN   + S DKT++LW
Sbjct: 997  INVSFSQNGNLLATASVDKTVKLW 1020



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/95 (32%), Positives = 46/95 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH  WV  +  +PK  D++ ++S D T+ +WK        G     L GH   ++ V
Sbjct: 783  TLKGHENWVRGVTFSPK-GDLLATASYDSTVKLWKPD------GTLISTLKGHQSKVNSV 835

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S  G+   S S D T++LW+   G   R  E H
Sbjct: 836  AFSPKGDLLASASSDNTVKLWE-TDGTLIRILEGH 869



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 30/84 (35%), Positives = 44/84 (52%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  TL+GH   V  +A +PK  D++ S+S D T+ +W+        G   + L GH   +
Sbjct: 821  LISTLKGHQSKVNSVAFSPK-GDLLASASSDNTVKLWETD------GTLIRILEGHEDSV 873

Query: 239  SDVVLSSDGNYALSGSWDKTLRLW 310
             DV  S  G+   S S DKT++LW
Sbjct: 874  LDVAFSPKGDMIASASSDKTVKLW 897



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   +  IA +PK  D++ ++S DKT+ +WK        G   K L GH  F+ +V
Sbjct: 619 SLEGHEKDIFGIAFSPK-GDLLATASGDKTVKLWKPD------GTFVKTLEGHKDFVLNV 671

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S  G+   + S DKT++LW    G      +DH
Sbjct: 672 AFSPKGDLLATASSDKTVKLWK-PDGTLITTLKDH 705



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/81 (32%), Positives = 43/81 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H G V  +A +PK  D++ ++S D T+ +WK      + G     L GH +++  V
Sbjct: 742 TLTEHEGDVLSVAFSPK-GDLLATASADYTVKLWK------SDGTLITTLKGHENWVRGV 794

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             S  G+   + S+D T++LW
Sbjct: 795 TFSPKGDLLATASYDSTVKLW 815



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 33/97 (34%), Positives = 48/97 (49%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL  H   V  +A +PK  D++ ++S DKT+ +WK      + G     L GH   ++ V
Sbjct: 1029 TLTEHEDDVLDVAFSPK-EDLLATASVDKTVKLWK------SDGTLITTLRGHEEDVNSV 1081

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              S DG   L  S DKT++LW  A G     F++  K
Sbjct: 1082 AFSPDGK--LIASADKTVKLWK-ADGTLVETFDEEHK 1115



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 31/94 (32%), Positives = 45/94 (47%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  +A +PK  DMI S+S DKT+ +WK    ++ +    K L GH   +  V 
Sbjct: 866  LEGHEDSVLDVAFSPK-GDMIASASSDKTVKLWK---PDDTF---IKTLKGHKEDVLSVA 918

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S   +   + S D T++LW  + G      E H
Sbjct: 919  FSPKEDLLATASADNTVKLWK-SDGTLVNTLEGH 951



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 27/81 (33%), Positives = 40/81 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  +V  +A +PK  D++ ++S DKT+ +WK        G     L  H   +  V
Sbjct: 660 TLEGHKDFVLNVAFSPK-GDLLATASSDKTVKLWKPD------GTLITTLKDHEGGVRGV 712

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
                GN   + S DKT++LW
Sbjct: 713 AFHPLGNLIATASHDKTVKLW 733



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 30/95 (31%), Positives = 43/95 (45%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH   V  +A +P   D  L +S DKT+ +WK         + +     H   + DV
Sbjct: 1070 TLRGHEEDVNSVAFSP---DGKLIASADKTVKLWKADGT-----LVETFDEEHKGMVKDV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    + S D T++LW +  G     F+ H
Sbjct: 1122 AFSPDGKLIATASVDDTVKLWKV-DGTLVSTFKGH 1155



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 25/81 (30%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ H G V  +A +P   ++I ++S DKT+ +WK        G     L  H   +  V
Sbjct: 701 TLKDHEGGVRGVAFHP-LGNLIATASHDKTVKLWKPD------GTLITTLTEHEGDVLSV 753

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             S  G+   + S D T++LW
Sbjct: 754 AFSPKGDLLATASADYTVKLW 774



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH   V  ++ +    +++ ++S DKT+ +WK        G     L  H   + DV
Sbjct: 988  TLRGHEDRVINVSFSQN-GNLLATASVDKTVKLWKAD------GTLITTLTEHEDDVLDV 1040

Query: 248  VLSSDGNYALSGSWDKTLRLW 310
              S   +   + S DKT++LW
Sbjct: 1041 AFSPKEDLLATASVDKTVKLW 1061



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 23/76 (30%), Positives = 34/76 (44%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H G V  +A +P    +I ++S D T+ +WK+       G       GH   +  V  S 
Sbjct: 1114 HKGMVKDVAFSPD-GKLIATASVDDTVKLWKVD------GTLVSTFKGHEGDVWGVAFSP 1166

Query: 260  DGNYALSGSWDKTLRL 307
            DG    S S D T++L
Sbjct: 1167 DGKLLASASRDNTVKL 1182


>UniRef50_Q389W0 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma brucei
          Length = 444

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 32/94 (34%), Positives = 50/94 (53%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  ++T+P   D++LS  RDKT+ VW + R  +   +    L GHS  +  + + 
Sbjct: 223 GHKGSVHCVSTHPSL-DIVLSGGRDKTVRVWDV-RTRSCVHL----LLGHSDSVMSLAVQ 276

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +   A+SG  D  + LWD+A+G+   R   H K
Sbjct: 277 QEDPQAISGGSDGMVYLWDIASGRAFTRLTRHKK 310



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 42/141 (29%), Positives = 63/141 (44%)
 Frame = +2

Query: 23  FKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI 202
           F+P++    + K+   L GH GWV   A +P       +   D  + VW LT      G 
Sbjct: 122 FEPYTA-PPSWKMAKVLVGHRGWVWGAAVDPSN-SWFATGGGDGVVKVWDLTT-----GA 174

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
            +  L GH   +  + LS+   Y  +GS D +++ WDL   +  R F  H    + S  C
Sbjct: 175 LKLNLTGHKEGVRALSLSTLSPYMFTGSDDHSVKCWDLERNEIIRDFHGH----KGSVHC 230

Query: 383 *GVNADYALKIILSAYARQKT 445
             V+   +L I+LS   R KT
Sbjct: 231 --VSTHPSLDIVLSG-GRDKT 248



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 29/103 (28%), Positives = 45/103 (43%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G   + K +   +  LKL   L GH   V  ++ +   P M   S  D ++  W L R+E
Sbjct: 160 GGDGVVKVWDLTTGALKLN--LTGHKEGVRALSLSTLSPYMFTGSD-DHSVKCWDLERNE 216

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
                  +  +GH   +  V      +  LSG  DKT+R+WD+
Sbjct: 217 II-----RDFHGHKGSVHCVSTHPSLDIVLSGGRDKTVRVWDV 254


>UniRef50_Q17H46 Cluster: Wd-repeat protein; n=2; Culicidae|Rep:
           Wd-repeat protein - Aedes aegypti (Yellowfever mosquito)
          Length = 792

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 32/96 (33%), Positives = 47/96 (48%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R   RGHN  +  +A +P     + + SRD T  +W   R+      P +   GH+  + 
Sbjct: 530 RAVYRGHNHPIWSVAESPTGL-YLATGSRDTTARLWSTDRE-----FPLQIYVGHTQDVD 583

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            V    +GNY  +GS D T+RLW + +GK  R F D
Sbjct: 584 TVAFHPNGNYLATGSTDLTVRLWCVTSGKLFRIFTD 619



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 33/98 (33%), Positives = 49/98 (50%), Gaps = 1/98 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISD 244
           TLRGH+  VT +  +   P +++S SRD T+  W  +    +Y    + +Y GH+H I  
Sbjct: 490 TLRGHSNAVTDLLFSRHSP-LLMSVSRDLTMRAWHAS----DYTC--RAVYRGHNHPIWS 542

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           V  S  G Y  +GS D T RLW        + +  HT+
Sbjct: 543 VAESPTGLYLATGSRDTTARLWSTDREFPLQIYVGHTQ 580



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 26/93 (27%), Positives = 40/93 (43%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P   + + + S D T+ +W +T  +        R   H      V  S
Sbjct: 577 GHTQDVDTVAFHPN-GNYLATGSTDLTVRLWCVTSGKLFRIFTDCRQPIHR-----VCFS 630

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG Y  +   +  +R++DLAAG       DHT
Sbjct: 631 PDGKYLAAAGEENRVRIFDLAAGSQLTELRDHT 663


>UniRef50_A0D5I2 Cluster: Chromosome undetermined scaffold_388, whole
            genome shotgun sequence; n=6; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_388, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 1497

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 31/97 (31%), Positives = 50/97 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH G +  +  +P     + S S D+T+I+W +   +        +L GHS  I  V 
Sbjct: 1115 LDGHIGTIHSVCFSPD-GSKLASCSWDRTIILWNVNTRQQ-----MTQLSGHSETIYSVC 1168

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             S +G    SGS DK++RLW+++ G+   + + HT V
Sbjct: 1169 FSPNGETLASGSQDKSIRLWEVSTGQQKVKLDGHTYV 1205



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 36/101 (35%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMIL-SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
            K +  LRGH   +  I  +  Y   IL S S D T+ VW +       G    +L GH +
Sbjct: 1242 KCKILLRGHINCINSICFS--YDGTILISGSDDNTIRVWDVET-----GKQTAKLDGHRN 1294

Query: 233  FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  V LSSDG    SGS D  + LWD+   K   +F+ HT
Sbjct: 1295 SVMSVCLSSDGTTLASGSLDHLIYLWDIKTEKQIAKFDGHT 1335



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 30/97 (30%), Positives = 47/97 (48%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L GH   V  +  +P     + SSS D ++ +W +       G  + +L GH+  I 
Sbjct: 1028 KAILDGHTYIVNSVCFSPD-GTTLASSSGDNSIRLWNVKT-----GQYKAKLDGHTSTIC 1081

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  S DG    SGSWD T+RLW++   + T + + H
Sbjct: 1082 QVCFSPDGTILASGSWDNTIRLWNVQDKQQTAKLDGH 1118



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 28/97 (28%), Positives = 48/97 (49%)
 Frame = +2

Query: 62   RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            +  L GH+  V  +  +P   + + S S DK++ +W ++      G  +  L GH   + 
Sbjct: 812  KAKLDGHSSAVYSVCFSPN-GETLASGSYDKSIRLWNVST-----GQQKAILNGHLFAVY 865

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             V  S +G+   SGS DK++ LWD+  G  T+  + H
Sbjct: 866  SVCFSPNGDTLASGSGDKSICLWDVRTGHQTKILDGH 902



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 24/80 (30%), Positives = 43/80 (53%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH   V  +  +P     + SS+ D ++ +W +     N G    +L+GH++ +  +  S
Sbjct: 1333 GHTYAVNSVCFSPN-GTTLASSNLDNSISLWDI-----NTGQLNAKLHGHTNTVCSICFS 1386

Query: 257  SDGNYALSGSWDKTLRLWDL 316
             DGN   S S+D+++RLWD+
Sbjct: 1387 PDGNTLASVSYDQSIRLWDI 1406



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 27/104 (25%), Positives = 49/104 (47%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L GH   + Q+  +P    ++ S S D T+ +W +   +        +L GH
Sbjct: 1065 KTGQYKAKLDGHTSTICQVCFSPD-GTILASGSWDNTIRLWNVQDKQQT-----AKLDGH 1118

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               I  V  S DG+   S SWD+T+ LW++   +   +   H++
Sbjct: 1119 IGTIHSVCFSPDGSKLASCSWDRTIILWNVNTRQQMTQLSGHSE 1162



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/55 (38%), Positives = 28/55 (50%)
 Frame = +2

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            G    +L GHS  +  V  S DG    SGS D  +RLWD+ +G    +F  HT +
Sbjct: 941  GQQSAQLDGHSGTVYTVCFSHDGTTLASGSHDNCIRLWDIKSGLEKSKFNKHTSI 995



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/75 (29%), Positives = 40/75 (53%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            + S S D ++++W   + E+   I    L GH++ ++ V  S DG    S S D ++RLW
Sbjct: 1008 LASGSWDNSILLWDF-KTEHQKAI----LDGHTYIVNSVCFSPDGTTLASSSGDNSIRLW 1062

Query: 311  DLAAGKTTRRFEDHT 355
            ++  G+   + + HT
Sbjct: 1063 NVKTGQYKAKLDGHT 1077



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +2

Query: 191 NYGIPQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           N GI ++ +LYGH+  ++ V  S DG    S S D ++RLWD   GK    F+   +V
Sbjct: 201 NLGINEEIKLYGHNRKVNQVCFSPDGKSLFSCSDDNSIRLWDFKTGKIKSLFKGKMEV 258



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 25/97 (25%), Positives = 41/97 (42%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+G V  +  +      + S S D  + +W +       G+ + +   H+  +  V 
Sbjct: 947  LDGHSGTVYTVCFSHD-GTTLASGSHDNCIRLWDIKS-----GLEKSKFNKHTSIVFSVC 1000

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             SSD     SGSWD ++ LWD          + HT +
Sbjct: 1001 FSSDLKTLASGSWDNSILLWDFKTEHQKAILDGHTYI 1037



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = +2

Query: 149 DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           D ++ +W +   E      + +L GHS  +  V  S +G    SGS+DK++RLW+++ G+
Sbjct: 798 DNSIRLWDVQEQE-----AKAKLDGHSSAVYSVCFSPNGETLASGSYDKSIRLWNVSTGQ 852

Query: 329 TTRRFEDH 352
                  H
Sbjct: 853 QKAILNGH 860



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 24/103 (23%), Positives = 44/103 (42%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET K    L GH   V  +  +      + S S D  + +W +  ++        +  GH
Sbjct: 1281 ETGKQTAKLDGHRNSVMSVCLSSD-GTTLASGSLDHLIYLWDIKTEKQI-----AKFDGH 1334

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++ ++ V  S +G    S + D ++ LWD+  G+   +   HT
Sbjct: 1335 TYAVNSVCFSPNGTTLASSNLDNSISLWDINTGQLNAKLHGHT 1377


>UniRef50_A0BP95 Cluster: Chromosome undetermined scaffold_12, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_12,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 661

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 32/92 (34%), Positives = 52/92 (56%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH G V  ++ +     MI+SSS DKT+  W + +  NN+      L GH++++    
Sbjct: 106 IKGHIGSVRSLSFSSD-SSMIVSSSDDKTIKGWNVLK--NNFMFS---LAGHTNWVRQAK 159

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           LS D    +SGS D T+RLWD+   K  ++F+
Sbjct: 160 LSPDSRLVVSGSDDSTVRLWDVNISKELQKFK 191



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 27/93 (29%), Positives = 43/93 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH  WV Q   +P    +++S S D T+ +W    D N     QK     S +  D 
Sbjct: 147 SLAGHTNWVRQAKLSPD-SRLVVSGSDDSTVRLW----DVNISKELQKFKCEDSIYTIDW 201

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +  SDG    +G  D  ++LWD  + +  + +E
Sbjct: 202 I--SDGTTICAGQMDGKIKLWDARSMRLIQYYE 232



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 25/93 (26%), Positives = 41/93 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  +  +P    +I S   D+T+ +WK     N+       + GH   +  +  S
Sbjct: 66  GHKGAVYSVQFSPD-GQIIASGGEDRTIRLWK-----NSVLGKCTAIKGHIGSVRSLSFS 119

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SD +  +S S DKT++ W++           HT
Sbjct: 120 SDSSMIVSSSDDKTIKGWNVLKNNFMFSLAGHT 152


>UniRef50_Q4P561 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 669

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH   ++ +   P+   ++LS+S D T+ +W +  D    G   +   GHS  + D+
Sbjct: 373 TFRGHTKGISTLKLLPRSGHLLLSASLDTTVKLWDVYHD----GQCLRTFMGHSKAVRDI 428

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             S+DG   LS  +D+ ++LWD   G     F +
Sbjct: 429 AFSNDGRRFLSSGYDRHVKLWDTETGACLDSFSN 462


>UniRef50_UPI000038D597 Cluster: COG2319: FOG: WD40 repeat; n=2;
            Nostoc punctiforme PCC 73102|Rep: COG2319: FOG: WD40
            repeat - Nostoc punctiforme PCC 73102
          Length = 1174

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            TLR H   V  +A  P     +L+S S D ++ +W     +   G   + L+GH+ ++  
Sbjct: 879  TLREHTNRVWSVAFQPASQHPLLASGSADYSIKLW-----DWKLGTCLQTLHGHTSWVWT 933

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            VV S DG    S S+D+T++LWD+  G+  + F+ H
Sbjct: 934  VVFSPDGRQLASSSYDQTVKLWDINTGECLKTFKGH 969



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 30/95 (31%), Positives = 51/95 (53%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T +GHN  V  +A +P    ++ SS  D  + +W +   E      ++ L GH++ +  V
Sbjct: 965  TFKGHNSPVVSVAFSPD-GQLLASSEFDGMIKLWNIDTGEC-----RQTLTGHTNSVWSV 1018

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S +G + LS S+D+TL+LW ++ GK  + F  H
Sbjct: 1019 TFSPNGQWLLSTSFDRTLKLWLVSTGKCLQTFVGH 1053



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 31/95 (32%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH G V  IA +P    ++ S S D T+ +W +    N + + Q    GH  ++  +
Sbjct: 670 TLVGHEGRVWAIAFHPN-GKILASCSEDYTIRLWDVATG-NCFCVWQ----GHDRWLRSI 723

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    SGS+D T++LWD+ + K  +    H
Sbjct: 724 TFSPDGKLLASGSYDNTIKLWDVKSQKCLQTLRGH 758



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/96 (30%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH  WV  +  +P     + SSS D+T+ +W +     N G   K   GH+  +  V
Sbjct: 923  TLHGHTSWVWTVVFSPD-GRQLASSSYDQTVKLWDI-----NTGECLKTFKGHNSPVVSV 976

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S DG    S  +D  ++LW++  G+  +    HT
Sbjct: 977  AFSPDGQLLASSEFDGMIKLWNIDTGECRQTLTGHT 1012



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 28/96 (29%), Positives = 45/96 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH+  +  +A +P    ++ S   D    +W L       G   K L GH++ +  +
Sbjct: 795  TFLGHSSRLWSVAYHPNEQQLV-SGGDDHATKLWNL-----QIGRCTKTLKGHTNSVLSL 848

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              S D NY  SG  D+T++LWD+  G   +   +HT
Sbjct: 849  APSPDSNYLASGHEDQTIKLWDIKNGTLVQTLREHT 884



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 32/96 (33%), Positives = 47/96 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TLRGH   VT IA +P     + SSS D+T+ +W ++      G   K   GHS  +  V
Sbjct: 754  TLRGHRQTVTAIAFSPN-GQQLASSSFDRTVKLWDVS------GNCLKTFLGHSSRLWSV 806

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                +    +SG  D   +LW+L  G+ T+  + HT
Sbjct: 807  AYHPNEQQLVSGGDDHATKLWNLQIGRCTKTLKGHT 842



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 29/105 (27%), Positives = 52/105 (49%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + R TL GH   V  +  +P     +LS+S D+TL +W ++      G   +   GH
Sbjct: 1000 DTGECRQTLTGHTNSVWSVTFSPN-GQWLLSTSFDRTLKLWLVST-----GKCLQTFVGH 1053

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               +     S D  + +SGS D+ L+LW ++ G+  +    H+++
Sbjct: 1054 QDPVMVAQFSPDAQFIVSGSVDRNLKLWHISTGECYQTLVGHSEL 1098



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/104 (26%), Positives = 53/104 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   T +GH   V  +A +PK  +++ S  +D ++ +W++  ++ N  +  + L GH
Sbjct: 618 ETGQCLHTYQGHTYSVNAVAFSPK-GNIVASCGQDLSIRLWEVAPEKLNPEV--QTLVGH 674

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              +  +    +G    S S D T+RLWD+A G     ++ H +
Sbjct: 675 EGRVWAIAFHPNGKILASCSEDYTIRLWDVATGNCFCVWQGHDR 718



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 25/94 (26%), Positives = 48/94 (51%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH+ W+  I  +P    ++ S S D T+ +W +   +       + L GH   ++ +  
Sbjct: 714 QGHDRWLRSITFSPD-GKLLASGSYDNTIKLWDVKSQKC-----LQTLRGHRQTVTAIAF 767

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S +G    S S+D+T++LWD+ +G   + F  H+
Sbjct: 768 SPNGQQLASSSFDRTVKLWDV-SGNCLKTFLGHS 800



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           R  GH H+   V  S DG Y  S S D  ++LWD+  G+    ++ HT
Sbjct: 583 RCRGHQHWAWSVAFSPDGRYLASASDDYLVKLWDVETGQCLHTYQGHT 630



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 28/93 (30%), Positives = 44/93 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+K     RGH  W   +A +P      L+S+ D  L+  KL   E    +   +  GH+
Sbjct: 577 TVKQLVRCRGHQHWAWSVAFSPD--GRYLASASDDYLV--KLWDVETGQCLHTYQ--GHT 630

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           + ++ V  S  GN   S   D ++RLW++A  K
Sbjct: 631 YSVNAVAFSPKGNIVASCGQDLSIRLWEVAPEK 663



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +A +P   + + S   D+T+ +W +       G   + L  H++ +  V
Sbjct: 837  TLKGHTNSVLSLAPSPD-SNYLASGHEDQTIKLWDIKN-----GTLVQTLREHTNRVWSV 890

Query: 248  VLSSDGNYAL--SGSWDKTLRLWDLAAGKTTRRFEDHT 355
                   + L  SGS D +++LWD   G   +    HT
Sbjct: 891  AFQPASQHPLLASGSADYSIKLWDWKLGTCLQTLHGHT 928



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 8/101 (7%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T K   T  GH   V     +P     I+S S D+ L +W ++  E       + L GHS
Sbjct: 1043 TGKCLQTFVGHQDPVMVAQFSPD-AQFIVSGSVDRNLKLWHISTGEC-----YQTLVGHS 1096

Query: 230  HFISDVVLSS----DGNYA----LSGSWDKTLRLWDLAAGK 328
              +  +V++S    D   A     SGS D+T+++WDL  GK
Sbjct: 1097 ELVYSLVVASISLGDATSARLTAFSGSLDETIKVWDLQTGK 1137


>UniRef50_UPI000038D4E2 Cluster: COG0515: Serine/threonine protein
           kinase; n=1; Nostoc punctiforme PCC 73102|Rep: COG0515:
           Serine/threonine protein kinase - Nostoc punctiforme PCC
           73102
          Length = 612

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = +2

Query: 35  SKMSETLKL--RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           S    T+K+  + TL GH   VT IA       +++S+S D+ +IVW L   E  Y    
Sbjct: 480 SSWDTTIKIWPKSTLTGHLKPVTSIAIGLN-SQILVSASVDRRIIVWNLNTGEKIY---- 534

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             L GHS  ++ V +S D    +SGS D+ +++W+L+ G+       H
Sbjct: 535 -TLDGHSDVVNSVAISPDSQKIVSGSDDEKIKVWNLSNGQEAYTVNGH 581



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 28/81 (34%), Positives = 44/81 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T++ ++G V  IA +P    MI+S S D  + +W L   E       K L  H++ +S V
Sbjct: 415 TIKANSGTVLSIAISPDQ-QMIVSGSSDSRVRLWNLKTGECI-----KTLATHAYRVSSV 468

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +S DG+   S SWD T+++W
Sbjct: 469 AISQDGSTVASSSWDTTIKIW 489



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A +P     I+S S D+ + VW L+  +  Y +      GH   ++ +
Sbjct: 535 TLDGHSDVVNSVAISPD-SQKIVSGSDDEKIKVWNLSNGQEAYTVN-----GHLDGVNAL 588

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
           V S DG   +SG  D T+++W
Sbjct: 589 VFSPDGQILVSGGKDTTIKVW 609



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/95 (28%), Positives = 43/95 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  +  +A +P     + S S D T+ +W L   E    I       +S  +  +
Sbjct: 373 TLTGHSKQINSVAISPD-SQTLASGSDDDTIKIWNLKTGEEISTIK-----ANSGTVLSI 426

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S D    +SGS D  +RLW+L  G+  +    H
Sbjct: 427 AISPDQQMIVSGSSDSRVRLWNLKTGECIKTLATH 461



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+  V  +A +P    ++ S S D  + VW L             L GHS  I+ V +S
Sbjct: 334 GHSKAVLALAISPDGQTLV-SGSEDNIIKVWNLNNSNEIL-----TLTGHSKQINSVAIS 387

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            D     SGS D T+++W+L  G+
Sbjct: 388 PDSQTLASGSDDDTIKIWNLKTGE 411



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHS  +  + +S DG   +SGS D  +++W+L           H+K
Sbjct: 334 GHSKAVLALAISPDGQTLVSGSEDNIIKVWNLNNSNEILTLTGHSK 379


>UniRef50_Q3M307 Cluster: Pentapeptide repeat; n=1; Anabaena
            variabilis ATCC 29413|Rep: Pentapeptide repeat - Anabaena
            variabilis (strain ATCC 29413 / PCC 7937)
          Length = 1190

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/86 (34%), Positives = 49/86 (56%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LRGH G +  IA +P     + S S D+T+ +W L       G   + L+ H  +++ V 
Sbjct: 1074 LRGHTGGIWTIAISPD-GKTLASGSGDQTVRLWNLQT-----GHCLQVLHEHRSWVTSVS 1127

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGK 328
             SS+G + LSGS D+T+++WD+  G+
Sbjct: 1128 FSSNGQFLLSGSDDRTIKVWDIGTGR 1153



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/96 (33%), Positives = 51/96 (53%)
 Frame = +2

Query: 65   GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            G L+GH+G V  +A    +   ++S S D+T+ +W L   E+      + L GH+  I  
Sbjct: 1030 GVLQGHSGGVFTLAFTA-HDQQLISGSFDQTIRLWDLQTRESI-----QILRGHTGGIWT 1083

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + +S DG    SGS D+T+RLW+L  G   +   +H
Sbjct: 1084 IAISPDGKTLASGSGDQTVRLWNLQTGHCLQVLHEH 1119



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 33/103 (32%), Positives = 49/103 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL  T  GH  WV  +A +P     + SS  D ++ +W +       G   + L  H+
Sbjct: 593 TTKLLATFEGHTSWVWSVAFSPD-GHKLASSGSDTSIRLWDV-----QSGQCLRVLTEHT 646

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             +  V  S DG    SGS D+T+R+W+L  G   +  + HTK
Sbjct: 647 GCVWSVNFSPDGQRLASGSDDQTVRVWNL-QGDCLQVLKGHTK 688



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/95 (30%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +  +P    ++ S S   ++ +W      N Y    K L+GH++++  + 
Sbjct: 725  LQGHTEGVHCVRYSPD-GQLLASGSFGGSIRLWSGQLHTNAY--QSKVLHGHTNWVWSMA 781

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S DG    SGS D TLRLW++  G+       HT
Sbjct: 782  FSPDGGILASGSDDGTLRLWNVQDGQCINVLSGHT 816



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/95 (30%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            LRGH   V  IA        + S S D+T+ +W++       G     L GHS  +  + 
Sbjct: 990  LRGHQDGVRAIAFGTD-GQRLASGSSDQTIRLWEVQT-----GACLGVLQGHSGGVFTLA 1043

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             ++     +SGS+D+T+RLWDL   ++ +    HT
Sbjct: 1044 FTAHDQQLISGSFDQTIRLWDLQTRESIQILRGHT 1078



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 28/96 (29%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  H G V  +  +P     + S S D+T+ VW L  D        + L GH+  +  V 
Sbjct: 642 LTEHTGCVWSVNFSPD-GQRLASGSDDQTVRVWNLQGD------CLQVLKGHTKNVYSVH 694

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            S D     SGS D+++R+W++  G      + HT+
Sbjct: 695 FSPDHQTLASGSKDESIRIWNVIDGNCLNVLQGHTE 730



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 21/99 (21%), Positives = 46/99 (46%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            ++  T  G   W + ++ +P     + ++ +D ++++W L  +  +      +  GH   
Sbjct: 902  RVTDTTAGLTSWTSYLSFSPD-SQTVATNGQDGSILIWNLQTESLS------QWSGHDAP 954

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V+ +  G    SGS D+T+RLWD+   +  +    H
Sbjct: 955  VWTVMFNPSGKTLASGSHDQTVRLWDVQTHQCLQVLRGH 993



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 26/82 (31%), Positives = 41/82 (50%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  IA   +   +++S+S+D+T+ +W L      +G   K L G +  I  + 
Sbjct: 812  LSGHTDDVLAIAIRGQ---LMVSASQDQTVRLWNL------HGQSLKTLRGCTSGIRSLS 862

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
            LS +G    S   D+T+ LW L
Sbjct: 863  LSPNGKTLASRGQDETIHLWHL 884


>UniRef50_Q10XQ9 Cluster: WD-40 repeat; n=2; Trichodesmium erythraeum
            IMS101|Rep: WD-40 repeat - Trichodesmium erythraeum
            (strain IMS101)
          Length = 1599

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/99 (33%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL GH  WV  +A +P     I ++  DKT+ +W      N  G   + + GH ++
Sbjct: 1123 KLLQTLTGHENWVYGVAFSPD-GKTIATAGGDKTVKLW------NRQGKLLQTIIGHENW 1175

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V  S DG    + S DKT++LW+   GK  +  +DH
Sbjct: 1176 VYGVAFSPDGKTIATASGDKTVKLWN-RQGKLLQTLKDH 1213



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 36/101 (35%), Positives = 52/101 (51%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL+GH+ WV  +A +P   + I ++S DKT+ +W      N  G   + L GH + 
Sbjct: 1246 KLLQTLKGHDNWVYGVAFSPD-KETIATASGDKTVKLW------NRQGKLLQTLTGHENS 1298

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +  V  S DG    + S D+T++LW      T  R ED TK
Sbjct: 1299 VYGVAFSPDGKTIATASGDQTVKLW------TNWRIEDLTK 1333



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 32/99 (32%), Positives = 49/99 (49%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  T+ GH  WV  +A +P     I ++S DKT+ +W      N  G   + L  H ++
Sbjct: 1164 KLLQTIIGHENWVYGVAFSPD-GKTIATASGDKTVKLW------NRQGKLLQTLKDHDNW 1216

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V  S DG    + S DKT++LW+   GK  +  + H
Sbjct: 1217 VYGVAFSLDGKTVATASGDKTVKLWN-RQGKLLQTLKGH 1254



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/86 (33%), Positives = 43/86 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  T+ GH+ WV  IA +P   + I S+S       WK  +  N  G   + L GH ++
Sbjct: 1083 KLLQTITGHDNWVYGIAFSPD-GETIASAS-------WKTVKLWNRQGKLLQTLTGHENW 1134

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWD 313
            +  V  S DG    +   DKT++LW+
Sbjct: 1135 VYGVAFSPDGKTIATAGGDKTVKLWN 1160



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 30/99 (30%), Positives = 48/99 (48%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL+ H+ WV  +A +      + ++S DKT+ +W      N  G   + L GH ++
Sbjct: 1205 KLLQTLKDHDNWVYGVAFSLD-GKTVATASGDKTVKLW------NRQGKLLQTLKGHDNW 1257

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V  S D     + S DKT++LW+   GK  +    H
Sbjct: 1258 VYGVAFSPDKETIATASGDKTVKLWN-RQGKLLQTLTGH 1295



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 31/99 (31%), Positives = 48/99 (48%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL  TL+GH   V  IA +    + I ++  DKT+ +W      N  G   + + GH ++
Sbjct: 1042 KLLQTLKGHENSVYGIAFSFD-GETIATAGADKTVKLW------NPQGKLLQTITGHDNW 1094

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +  S DG    S SW KT++LW+   GK  +    H
Sbjct: 1095 VYGIAFSPDGETIASASW-KTVKLWN-RQGKLLQTLTGH 1131



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 26/95 (27%), Positives = 41/95 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH  WV  +A +P             T+ +W      N+ G   + L GH + +  +
Sbjct: 1014 TLKGHENWVNGMAFSPD----------GGTVKLW------NHQGKLLQTLKGHENSVYGI 1057

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S DG    +   DKT++LW+   GK  +    H
Sbjct: 1058 AFSFDGETIATAGADKTVKLWN-PQGKLLQTITGH 1091



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 23/78 (29%), Positives = 38/78 (48%)
 Frame = +2

Query: 32   FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
            + K  E  ++  T + H  WV  IA +P   + I S S D T+ +W      N+ G   +
Sbjct: 962  YDKDDEFREINRT-QAHENWVNGIAFSPD-EETIASGSYDNTMKLW------NHQGNLLQ 1013

Query: 212  RLYGHSHFISDVVLSSDG 265
             L GH ++++ +  S DG
Sbjct: 1014 TLKGHENWVNGMAFSPDG 1031


>UniRef50_Q10XF2 Cluster: Serine/threonine protein kinase with WD40
           repeats; n=1; Trichodesmium erythraeum IMS101|Rep:
           Serine/threonine protein kinase with WD40 repeats -
           Trichodesmium erythraeum (strain IMS101)
          Length = 792

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 34/103 (33%), Positives = 47/103 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T  L  TL GH G +  +   P     I+S S D T+ +W L       G   K L GH
Sbjct: 667 DTGDLINTLNGHTGAIRSVKITPD-GKKIVSGSYDTTVKIWDLKT-----GKLIKTLSGH 720

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +  V +S DG Y  SG  D  +++WDL  G+       HT
Sbjct: 721 TAEVISVDISRDGRYIASGGKDNNIKVWDLEKGELLNTLTGHT 763



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/92 (30%), Positives = 43/92 (46%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   +  +  +P   +++ SSS DK + VW L      +  P      HS  I  + +SS
Sbjct: 594 HRAPIWSVVMSPD-DEIVASSSGDKRVKVWNLKTGSLIFSFPD-----HSDTIYSIDISS 647

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           DG   +SGS D+T+++ DL  G        HT
Sbjct: 648 DGKKLVSGSADQTIKIEDLDTGDLINTLNGHT 679



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S S D+T+ +     ++ + G     L GH+  I  V ++ DG   +SGS+D T+++W
Sbjct: 652 LVSGSADQTIKI-----EDLDTGDLINTLNGHTGAIRSVKITPDGKKIVSGSYDTTVKIW 706

Query: 311 DLAAGKTTRRFEDHT 355
           DL  GK  +    HT
Sbjct: 707 DLKTGKLIKTLSGHT 721



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 31/90 (34%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWV--TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           +T KL  TL GH   V    I+ + +Y   I S  +D  + VW L + E         L 
Sbjct: 709 KTGKLIKTLSGHTAEVISVDISRDGRY---IASGGKDNNIKVWDLEKGEL-----LNTLT 760

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           GH+  +  V  S DGN   SG  D+T++LW
Sbjct: 761 GHTDEVYTVAFSPDGNSIASGGKDRTIKLW 790



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +++ H   I  VV+S D     S S DK +++W+L  G     F DH+
Sbjct: 590 QIFEHRAPIWSVVMSPDDEIVASSSGDKRVKVWNLKTGSLIFSFPDHS 637


>UniRef50_A0C2Z9 Cluster: Chromosome undetermined scaffold_145, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_145, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 1111

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/102 (30%), Positives = 53/102 (51%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T KL   L GH+ +V+Q+  +P     + SSS D ++ +W + + +  Y     +L GH
Sbjct: 767  KTGKLNVKLNGHSKYVSQVCFSPD-GSSLASSSGDMSVRLWNVKQGKLTY-----KLDGH 820

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +  V  S DG    SG  D+++RLW++  G+   R  +H
Sbjct: 821  FEGVYSVCFSPDGTILASGGGDESIRLWEVNTGQLKSRITNH 862



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 30/94 (31%), Positives = 47/94 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +  +P     I S S D ++ +W +   + N      +L GHS ++S V 
Sbjct: 733 LVGHASGVYSVCFSPDCAQ-IASGSGDNSICLWDVKTGKLNV-----KLNGHSKYVSQVC 786

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S DG+   S S D ++RLW++  GK T + + H
Sbjct: 787 FSPDGSSLASSSGDMSVRLWNVKQGKLTYKLDGH 820



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/99 (29%), Positives = 51/99 (51%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L+  +  H+G V  I  +P    ++ S S D+++ +W +   E      + +L G+S
Sbjct: 852  TGQLKSRITNHDGGVFSICFSPNGSTLV-SCSADESIRLWNVKTGEQ-----KSKLSGNS 905

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
             ++  V  S DG    SGS DK++ LWD   G+ T + +
Sbjct: 906  GWVFQVCFSPDGTLIASGSRDKSIHLWDSETGQQTYKLD 944



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/102 (28%), Positives = 48/102 (47%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            +T + +  L G++GWV Q+  +P    +I S SRDK++ +W     +  Y     +L   
Sbjct: 893  KTGEQKSKLSGNSGWVFQVCFSPD-GTLIASGSRDKSIHLWDSETGQQTY-----KLDSL 946

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               +  V  SSDG    SG  +  + LWD+  G+   +   H
Sbjct: 947  DDAVQSVCFSSDGTILASGCANNNILLWDVKTGQQKFKLVGH 988



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 28/101 (27%), Positives = 47/101 (46%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L+  L+GH   V  +  +     ++ S S+D ++ +W +T      G     L GH+  
Sbjct: 687 QLKSKLKGHRSQVCSVNFSTDGATLV-SGSKDMSMRLWDIT------GQQPYNLVGHASG 739

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +  V  S D     SGS D ++ LWD+  GK   +   H+K
Sbjct: 740 VYSVCFSPDCAQIASGSGDNSICLWDVKTGKLNVKLNGHSK 780



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDK-TLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           L  ++G ++ +  +P    ++  S  DK ++ +W         G P+ +L GHS  +  +
Sbjct: 402 LDSNSGAISSVCFSPDSATVV--SGNDKGSISLWDFRT-----GQPKFKLIGHSSQVYSI 454

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DGN   SGS D ++RLWD+   K   +   H
Sbjct: 455 SFSPDGNTLASGSADNSIRLWDIKTRKKKSKLIGH 489



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 25/82 (30%), Positives = 41/82 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V  I+ +P   + + S S D ++ +W +   +      + +L GH   +  V 
Sbjct: 444 LIGHSSQVYSISFSPD-GNTLASGSADNSIRLWDIKTRKK-----KSKLIGHGGGVLCVC 497

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S DG+   S S D T+RLWD+
Sbjct: 498 FSPDGSKIASSSDDWTIRLWDI 519



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 16/65 (24%), Positives = 33/65 (50%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            ++ S   +  +++W +   +  +     +L GH   ++ V  S  G    SGS D ++RL
Sbjct: 961  ILASGCANNNILLWDVKTGQQKF-----KLVGHYRNVTSVCFSPLGTLLASGSMDNSIRL 1015

Query: 308  WDLAA 322
            WD+++
Sbjct: 1016 WDISS 1020


>UniRef50_Q5KGF2 Cluster: General transcriptional repressor,
           putative; n=1; Filobasidiella neoformans|Rep: General
           transcriptional repressor, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 564

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 13/107 (12%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT-------------RDENNYGIPQK 211
           L+GH   V  +A +P     ++S S D+TL +W LT               + N G  Q 
Sbjct: 422 LKGHKDSVYSVAFSPD-GKCLVSGSLDRTLRIWDLTGTKREVESLPPGKEAQKNLGTCQS 480

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            L GH  ++  V +S DG + +SGS D++++ W ++ G+     + H
Sbjct: 481 TLNGHKDYVLSVAISPDGQWVVSGSKDRSIQFWHISTGQAQLMLQGH 527



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/79 (34%), Positives = 41/79 (51%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A +P    ++ + S D  + VW ++      G   +RL GH   +  V  S DG  
Sbjct: 387 ITSVALSPD-GKLVAAGSLDTMVRVWNVST-----GQQVERLKGHKDSVYSVAFSPDGKC 440

Query: 272 ALSGSWDKTLRLWDLAAGK 328
            +SGS D+TLR+WDL   K
Sbjct: 441 LVSGSLDRTLRIWDLTGTK 459



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/83 (30%), Positives = 42/83 (50%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           + TL GH  +V  +A +P     ++S S+D+++  W ++      G  Q  L GH + + 
Sbjct: 479 QSTLNGHKDYVLSVAISPD-GQWVVSGSKDRSIQFWHIST-----GQAQLMLQGHKNSVI 532

Query: 242 DVVLSSDGNYALSGSWDKTLRLW 310
            + L+  G Y  SGS D   R+W
Sbjct: 533 SIDLARSGGYLASGSGDCMARIW 555



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 5/79 (6%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-----ISDVVLSSDGNYALSGSWDK 295
           ++S S DK+  +W + +    + +  +    + H      I+ V LS DG    +GS D 
Sbjct: 347 LVSGSGDKSARIWDVEKGTCVFNLQIEDFIHNEHGPIDAGITSVALSPDGKLVAAGSLDT 406

Query: 296 TLRLWDLAAGKTTRRFEDH 352
            +R+W+++ G+   R + H
Sbjct: 407 MVRVWNVSTGQQVERLKGH 425



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           L GH   I  +  S DG + +SGS DK+ R+WD+  G
Sbjct: 328 LQGHMQEIYSLDFSRDGRFLVSGSGDKSARIWDVEKG 364


>UniRef50_Q0U6J1 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 792

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/93 (34%), Positives = 45/93 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH  +V  IA NPK P+   S+  D+T+ +W L     NY +      G  +FI D    
Sbjct: 141 GHQHYVMGIAINPKDPNTFASACLDRTVKIWSLGSSTPNYTLEAHETKG-VNFI-DYYPQ 198

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SD  Y L+ S D+T+++WD          E HT
Sbjct: 199 SDKPYLLTTSDDRTVKVWDYTTKALIATLEGHT 231


>UniRef50_A1CF18 Cluster: Wd40 protein; n=1; Aspergillus
           clavatus|Rep: Wd40 protein - Aspergillus clavatus
          Length = 435

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/85 (36%), Positives = 50/85 (58%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+  V+ +   P    ++ S+SRD  + +W +T   N Y +  K + GH+ ++ DV
Sbjct: 172 TLQGHDHIVSAVRFIPN-GSLLASASRDMDVRLWDVT---NGYCV--KTIQGHTGWVRDV 225

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAA 322
             S DG + LS   D T+RLWD++A
Sbjct: 226 CASLDGRFILSTGDDMTVRLWDISA 250



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 3/103 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQI--ATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +L  TL+GH   V  +   + P    ++L+S S D T+ +W       N     + L GH
Sbjct: 121 ELEVTLKGHTRAVRDLDYGSPPGAVGVLLASCSSDLTIKLWDPADGYKNI----RTLQGH 176

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            H +S V    +G+   S S D  +RLWD+  G   +  + HT
Sbjct: 177 DHIVSAVRFIPNGSLLASASRDMDVRLWDVTNGYCVKTIQGHT 219



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + + + SRDKT+ +W         G     L GH +++  +V    G Y LS S DKTLR
Sbjct: 296 EFMATGSRDKTIKLWDAR------GTCLMTLTGHDNWVRAIVFHPGGRYLLSVSDDKTLR 349

Query: 305 LWDLA-AGKTTRRFED 349
            WDL+  GK  +   D
Sbjct: 350 CWDLSQEGKCVKTIRD 365



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 7/67 (10%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKL---RGT----LRGHNGWVTQIATNPKYPDMILSSSRDKTLI 163
           +G ++ F       +T+KL   RGT    L GH+ WV  I  +P     +LS S DKTL 
Sbjct: 291 AGSTAEFMATGSRDKTIKLWDARGTCLMTLTGHDNWVRAIVFHPG-GRYLLSVSDDKTLR 349

Query: 164 VWKLTRD 184
            W L+++
Sbjct: 350 CWDLSQE 356


>UniRef50_O14170 Cluster: WD repeat-containing protein pop2; n=1;
           Schizosaccharomyces pombe|Rep: WD repeat-containing
           protein pop2 - Schizosaccharomyces pombe (Fission yeast)
          Length = 703

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 33/95 (34%), Positives = 50/95 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  I+    Y D+++S S D ++ +W+++  E  Y      L GHS  I  V
Sbjct: 502 TLIGHTDSVRTISG---YGDILVSGSYDSSIRIWRVSTGECLY-----HLRGHSLRIYSV 553

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +   + N  +SGS DK++R+WDL+ G      E H
Sbjct: 554 LYEPERNICISGSMDKSIRVWDLSTGTCKYVLEGH 588



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/86 (34%), Positives = 47/86 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+  +  +   P+  ++ +S S DK++ VW L+     Y      L GH  F++  +
Sbjct: 543 LRGHSLRIYSVLYEPER-NICISGSMDKSIRVWDLSTGTCKYV-----LEGHDAFVT--L 594

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           L+   N  +SGS D T+R+WDL  GK
Sbjct: 595 LNVFQNRLISGSADSTIRIWDLNTGK 620



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 13/88 (14%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQK-----RLYGHSHFISDVV--------LSSDGNY 271
           I+S SRD TL VWKL ++ +   +P       R   + +F+  ++        +S  G+ 
Sbjct: 460 IVSGSRDHTLRVWKLPKNTDPPYLPDNTNSIDRWEKNPYFVHTLIGHTDSVRTISGYGDI 519

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +SGS+D ++R+W ++ G+       H+
Sbjct: 520 LVSGSYDSSIRIWRVSTGECLYHLRGHS 547



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           G+ + RL GH   +  V +    N  +SGS DKT+R+W++   K T  F  H  +
Sbjct: 381 GVLEARLEGHKEGVWAVKIHE--NTLVSGSIDKTVRVWNIEKAKCTHIFRGHISI 433


>UniRef50_Q6CG48 Cluster: Nuclear distribution protein PAC1; n=1;
           Yarrowia lipolytica|Rep: Nuclear distribution protein
           PAC1 - Yarrowia lipolytica (Candida lipolytica)
          Length = 437

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 28/76 (36%), Positives = 41/76 (53%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +++S S D T+ +W    D  N     K L GH H IS V  ++ GN+ +S S DKT+R+
Sbjct: 194 LLVSCSSDLTIRIW----DPQNEYANVKTLTGHDHTISAVKFTASGNHVISASRDKTVRV 249

Query: 308 WDLAAGKTTRRFEDHT 355
           W + +G   R    HT
Sbjct: 250 WSVQSGYCVRTVHGHT 265



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 30/73 (41%), Positives = 40/73 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S SRDKT+ VW      ++ G P   L GH +++  VVL   G Y +S S DKT+R W
Sbjct: 334 VVSWSRDKTIRVW------SSRGDPLLILRGHDNWVRGVVLHPAGRYLVSVSDDKTMRCW 387

Query: 311 DLAAGKTTRRFED 349
           DL  G    R  D
Sbjct: 388 DLEQGGRCIRVVD 400


>UniRef50_Q7ZUV2 Cluster: Katanin p80 WD40-containing subunit B1;
           n=3; Clupeocephala|Rep: Katanin p80 WD40-containing
           subunit B1 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 694

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 49/103 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH   ++ +  +P   + + S S D  + +W + R    +     R  GH
Sbjct: 93  EAAKILRTLMGHKASISSLDFHPM-GEYLASGSVDSNIKLWDVRRKGCVF-----RYKGH 146

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  +  +  S DG +  S S D T++LWDL AGK    F  HT
Sbjct: 147 TQAVRCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHT 189



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 27/97 (27%), Positives = 43/97 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  I  N    + +++ S   +L +W L   +       + L GH   IS +
Sbjct: 58  SLTGHTSAVGCIQFNSS-EERVVAGSLSGSLRLWDLEAAKI-----LRTLMGHKASISSL 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G Y  SGS D  ++LWD+       R++ HT+
Sbjct: 112 DFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYKGHTQ 148


>UniRef50_P90648 Cluster: Myosin heavy chain kinase B; n=2;
           Dictyostelium discoideum|Rep: Myosin heavy chain kinase
           B - Dictyostelium discoideum (Slime mold)
          Length = 732

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 35/97 (36%), Positives = 48/97 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +  N KY   + S S DKT+ VW L   E  Y      L  H+  +  +
Sbjct: 537 TLEGHDKPVHTVLLNDKY---LFSGSSDKTIKVWDLKTLECKY-----TLESHARAVKTL 588

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +S  G Y  SGS DKT+++WDL   +     + HTK
Sbjct: 589 CIS--GQYLFSGSNDKTIKVWDLKTFRCNYTLKGHTK 623



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 33/105 (31%), Positives = 51/105 (48%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+ ++   TL+GH G V  I  N +Y   + S S D ++ VW L +    +      L G
Sbjct: 489 SQNMECVQTLKGHEGPVESICYNDQY---LFSGSSDHSIKVWDLKKLRCIF-----TLEG 540

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H   +  V+L+    Y  SGS DKT+++WDL   +     E H +
Sbjct: 541 HDKPVHTVLLND--KYLFSGSSDKTIKVWDLKTLECKYTLESHAR 583



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 31/104 (29%), Positives = 53/104 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +TL+ + TL  H   V  +  + +Y   + S S DKT+ VW L     NY      L GH
Sbjct: 570 KTLECKYTLESHARAVKTLCISGQY---LFSGSNDKTIKVWDLKTFRCNY-----TLKGH 621

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           + +++ + +     Y  SGS+DKT+R+W+L + + +     H +
Sbjct: 622 TKWVTTICILGTNLY--SGSYDKTIRVWNLKSLECSATLRGHDR 663



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 30/102 (29%), Positives = 45/102 (44%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +   TL+GH  WVT I         + S S DKT+ VW L   E +       L GH
Sbjct: 610 KTFRCNYTLKGHTKWVTTICI---LGTNLYSGSYDKTIRVWNLKSLECS-----ATLRGH 661

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             ++  +V+        + S D T+++WDL   +     E H
Sbjct: 662 DRWVEHMVICD--KLLFTASDDNTIKIWDLETLRCNTTLEGH 701



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 24/88 (27%), Positives = 44/88 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ++L+   TLRGH+ WV  +    K   ++ ++S D T+ +W L     N       L GH
Sbjct: 650 KSLECSATLRGHDRWVEHMVICDK---LLFTASDDNTIKIWDLETLRCN-----TTLEGH 701

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +  +  + +  D    +S S D+++R+W
Sbjct: 702 NATVQCLAVWEDKKCVISCSHDQSIRVW 729


>UniRef50_P49177 Cluster: Guanine nucleotide-binding protein subunit
           beta; n=27; Magnoliophyta|Rep: Guanine
           nucleotide-binding protein subunit beta - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 377

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 2/103 (1%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T+ +   L GH G+V+     P     +++SS D+T I+W +T          +   GH+
Sbjct: 145 TVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHT 204

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDL-AAGKTTRRFEDH 352
             +  V +S S+ N+ +SGS D T RLWD  AA +  R F  H
Sbjct: 205 ADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGH 247



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDVV 250
           G NG VT IA +     +    + + T  VW     E   + G+ Q     H + IS + 
Sbjct: 292 GENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQD---SHRNRISCLG 348

Query: 251 LSSDGNYALSGSWDKTLRLW 310
           LS+DG+   +GSWD  L++W
Sbjct: 349 LSADGSALCTGSWDSNLKIW 368



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  ++ +   P+  +S S D T  +W  TR  +      +  +GH   ++ V   
Sbjct: 202 GHTADVLSVSISGSNPNWFISGSCDSTARLWD-TRAASR---AVRTFHGHEGDVNTVKFF 257

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG    +GS D T RL+D+  G   + ++ H
Sbjct: 258 PDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPH 289


>UniRef50_UPI0001509BB6 Cluster: hypothetical protein
           TTHERM_00497660; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00497660 - Tetrahymena
           thermophila SB210
          Length = 705

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/105 (32%), Positives = 51/105 (48%), Gaps = 3/105 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPD---MILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           E  KL  TL+GH G ++ +A  P Y D   +++S S D  + +W L   E  +     + 
Sbjct: 94  EAQKLSHTLKGHGGGISSLAIFP-YEDQKNLLISGSMDTNIKIWDLRTKECVH-----QF 147

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            GH+  ++ +  S DG    SG  D  +RLWD   GK +  F  H
Sbjct: 148 KGHTMLVNCLAGSPDGKMIASGGSDSQVRLWDQTTGKCSNIFTLH 192



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +2

Query: 215 LYGHSHFISDVVL---SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GH   IS + +       N  +SGS D  +++WDL   +   +F+ HT
Sbjct: 102 LKGHGGGISSLAIFPYEDQKNLLISGSMDTNIKIWDLRTKECVHQFKGHT 151


>UniRef50_Q8DLK2 Cluster: WD-40 repeat protein; n=1; Synechococcus
           elongatus|Rep: WD-40 repeat protein - Synechococcus
           elongatus (Thermosynechococcus elongatus)
          Length = 349

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 35/99 (35%), Positives = 52/99 (52%)
 Frame = +2

Query: 14  SSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENN 193
           S L  P SK  + + L  TLRGH   V  IA +P   + ++S+  D+ L  W L      
Sbjct: 44  SPLHTPTSKWQK-IALAMTLRGHEDEVNAIALSPD-GNFLVSAGDDRRLYFWNLAT---- 97

Query: 194 YGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            G    +  GH+ +I  +V++ DG   +SGS DKT++LW
Sbjct: 98  -GTALGQAKGHTDWIYALVMTPDGQTVISGSKDKTIKLW 135



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSH 232
           +L+ TL GH  +V  +A +P     + S+S D T+ +W + +R E         L  +  
Sbjct: 141 QLQATLSGHQDFVNGLALSPD-GRTLASASYDHTVKLWNVPSRQEIT------TLKANEG 193

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +  V +S DG +  +G  DK +R+WDL + +  R  E HT
Sbjct: 194 IMLSVAISRDGRFLATGGVDKLIRIWDLPSRRLLRTLEGHT 234



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 29/100 (29%), Positives = 48/100 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL GH   V  +A  P    ++  S +D  + +W LT  E      Q++       
Sbjct: 225 RLLRTLEGHTSDVNSLAFTPDSSQLVSGSDKDG-IKLWNLTTGEL-----QQQFGTEGGQ 278

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  V +S DG+   SG  D+T++LW L +G+  R  + H+
Sbjct: 279 VFSVAVSPDGSTLASGHGDQTVKLWSL-SGQLLRNLKGHS 317



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GH   ++ + LS DGN+ +S   D+ L  W+LA G    + + HT
Sbjct: 62  LRGHEDEVNAIALSPDGNFLVSAGDDRRLYFWNLATGTALGQAKGHT 108



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 20/92 (21%), Positives = 44/92 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ + G +  +A + +    + +   DK + +W L           + L GH+  ++ +
Sbjct: 187 TLKANEGIMLSVAIS-RDGRFLATGGVDKLIRIWDLPSRRL-----LRTLEGHTSDVNSL 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             + D +  +SGS    ++LW+L  G+  ++F
Sbjct: 241 AFTPDSSQLVSGSDKDGIKLWNLTTGELQQQF 272



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 24/77 (31%), Positives = 37/77 (48%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G V  +A +P     + S   D+T+ +W L+      G   + L GHS  +  VV   D 
Sbjct: 277 GQVFSVAVSPD-GSTLASGHGDQTVKLWSLS------GQLLRNLKGHSGAVYSVVFGQD- 328

Query: 266 NYALSGSWDKTLRLWDL 316
              +S S DKT+++W L
Sbjct: 329 -QLISASEDKTIKVWRL 344


>UniRef50_Q7NM62 Cluster: WD-repeat protein; n=1; Gloeobacter
           violaceus|Rep: WD-repeat protein - Gloeobacter violaceus
          Length = 551

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 36/96 (37%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV  +A +P     + S+ +D+T+ +W  + D    G     L GHS  +  + 
Sbjct: 392 LRGHGDWVFAVAFSPD-GRTLASAGKDETIRLWN-SAD----GKLLATLRGHSAPVRALD 445

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTR-RFEDHT 355
            S DG    S SWDKT+ LWD+  G+T R R   HT
Sbjct: 446 WSKDGRTLASASWDKTVALWDV-PGRTVRTRLSGHT 480



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 34/102 (33%), Positives = 50/102 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KLR TL+GH+  V  +A  P    ++ S S D+++ +W +      Y     RL GH 
Sbjct: 343 TGKLRHTLKGHSQPVWTLAMAPD-GRILASGSGDRSVRLWDIASGRQLY-----RLRGHG 396

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++  V  S DG    S   D+T+RLW+ A GK       H+
Sbjct: 397 DWVFAVAFSPDGRTLASAGKDETIRLWNSADGKLLATLRGHS 438



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/95 (30%), Positives = 47/95 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH G V  +   P     + S+  D+ + +W +       G  +  L GHS  +  +
Sbjct: 307 TLEGHTGTVRAVVFTPD-GRALASAGSDRRVRLWDV-----GTGKLRHTLKGHSQPVWTL 360

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            ++ DG    SGS D+++RLWD+A+G+   R   H
Sbjct: 361 AMAPDGRILASGSGDRSVRLWDIASGRQLYRLRGH 395



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 33/97 (34%), Positives = 49/97 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL  TLRGH+  V  +  + K    + S+S DKT+ +W +          + RL GH+  
Sbjct: 429 KLLATLRGHSAPVRALDWS-KDGRTLASASWDKTVALWDVPGRT-----VRTRLSGHTGR 482

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           ++ V L+ DG    SGS D T+RLW     +   RF+
Sbjct: 483 VTAVSLAPDGQLVASGSIDGTVRLWRPDTRRQIHRFD 519



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 27/97 (27%), Positives = 40/97 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H G V   A  P    M  S   D  + +W         G   + L GH+  +  V
Sbjct: 266 TVGAHPGPVWASAVRPD-GRMYASGDDDGAIRLWSPA------GTLLQTLEGHTGTVRAV 318

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           V + DG    S   D+ +RLWD+  GK     + H++
Sbjct: 319 VFTPDGRALASAGSDRRVRLWDVGTGKLRHTLKGHSQ 355



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 2/86 (2%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK--LTRDENNYGIPQKRLYGHSH 232
           +R  L GH G VT ++  P    ++ S S D T+ +W+    R  + + +P         
Sbjct: 472 VRTRLSGHTGRVTAVSLAPD-GQLVASGSIDGTVRLWRPDTRRQIHRFDLPD-------- 522

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLW 310
           ++  +  S DG   ++G  D TLRLW
Sbjct: 523 WVLSLGFSPDGRMLIAGGKDSTLRLW 548


>UniRef50_Q112W9 Cluster: WD-40 repeat; n=1; Trichodesmium
           erythraeum IMS101|Rep: WD-40 repeat - Trichodesmium
           erythraeum (strain IMS101)
          Length = 464

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/95 (31%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   +  +A +      + SSS D  + VW LT  +  + I       H+  I  +
Sbjct: 48  TLSGHKTPIYAVAISAD-GKTLTSSSHDGKIKVWNLTNGQLFHTIN-----AHADAIESL 101

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V+S DG + +SGSWD  ++LW++  GK  +  + H
Sbjct: 102 VISPDGKFIISGSWDNDIKLWNITNGKFIQTLKSH 136



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 21/86 (24%), Positives = 40/86 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   +  +  +P     I+S S D  + +W +T      G   + L  H+  +  +
Sbjct: 90  TINAHADAIESLVISPD-GKFIISGSWDNDIKLWNITN-----GKFIQTLKSHADDVKAI 143

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
            +S DG    SGS++  +++W+L  G
Sbjct: 144 AMSKDGQTLASGSYNGVIKIWNLKTG 169



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 23/88 (26%), Positives = 42/88 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL  H+  V  +  +P    ++  SS D  + +W++       G   +   GHS  
Sbjct: 253 QLHSTLENHDQAVLSVDFSPD-SKIVAGSSYDSKIHLWQVET-----GKLLETFTGHSQA 306

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           +  +  + DG   +SGS D+ ++LW L+
Sbjct: 307 VWSLKFTPDGQTLVSGSTDRNIKLWCLS 334



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 22/93 (23%), Positives = 39/93 (41%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   +  IA +P    ++ S S+D+ + +W++ +     G     L  H   +  V  S 
Sbjct: 219 HTKTIWAIAFSPD-GKILASGSQDQKVKLWEIEK-----GQLHSTLENHDQAVLSVDFSP 272

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           D       S+D  + LW +  GK    F  H++
Sbjct: 273 DSKIVAGSSYDSKIHLWQVETGKLLETFTGHSQ 305



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 17/56 (30%), Positives = 26/56 (46%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           E N G        H+  I  +  S DG    SGS D+ ++LW++  G+     E+H
Sbjct: 206 ELNTGKELHSFAAHTKTIWAIAFSPDGKILASGSQDQKVKLWEIEKGQLHSTLENH 261



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 27/97 (27%), Positives = 38/97 (39%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ H   V  IA + K    + S S +  + +W L        I Q       + I  +
Sbjct: 132 TLKSHADDVKAIAMS-KDGQTLASGSYNGVIKIWNLKTGSLKMKIKQP------YPIIAL 184

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S DG    SG     ++ W+L  GK    F  HTK
Sbjct: 185 AFSPDGEILASGCKKGNIKTWELNTGKELHSFAAHTK 221


>UniRef50_A6BZA5 Cluster: WD40-repeat containing protein; n=1;
            Planctomyces maris DSM 8797|Rep: WD40-repeat containing
            protein - Planctomyces maris DSM 8797
          Length = 1705

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/101 (33%), Positives = 46/101 (45%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET K   T RGH+ WV Q A        ILS+S D  L +W +        +  + L  H
Sbjct: 1044 ETTKALKTFRGHDSWV-QSAMILNDGKWILSASHDAQLKLWNIANYAEIRTLKGRVLAQH 1102

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
               I DV  S DG   ++ S DKT   WD++ G   + F +
Sbjct: 1103 VDAILDVSFSHDGKQLVTASRDKTAISWDVSTGNPNKEFTE 1143



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 28/91 (30%), Positives = 42/91 (46%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            HNG+V  +  +P     IL+SS D T  +W         G   + L      +   + S 
Sbjct: 1493 HNGYVNTVRYSPD-GKRILTSSEDGTSKIWNAES-----GAMLRSLDQSGTHVKSAIFSP 1546

Query: 260  DGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG+  ++ S DKTL +WD   GK  + F+ H
Sbjct: 1547 DGSQIVTASDDKTLVMWDAETGKKIKTFKGH 1577



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 48/105 (45%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            +ET K   T +GH   V ++A +     +I S S D T I+W +   +         L G
Sbjct: 1565 AETGKKIKTFKGHEWPVREVAYSHDGKRLI-SGSEDNTAIIWDIDTAKKTV------LSG 1617

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            H+  ++ VV S D + A + S D T +LWD   GK       H +
Sbjct: 1618 HTAPVASVVFSPDDSRAFTASDDGTAKLWDTDTGKEILTLSSHAQ 1662



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 24/75 (32%), Positives = 39/75 (52%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            ++++SRDKT I W ++    N    +    GH+   S  V   DG    + + D ++R+W
Sbjct: 1118 LVTASRDKTAISWDVSTGNPNKEFTE----GHAFLASSAVFLPDGKRLATAAVDNSVRIW 1173

Query: 311  DLAAGKTTRRFEDHT 355
            D+  G   +RFE HT
Sbjct: 1174 DIQTGTEHKRFE-HT 1187



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/77 (31%), Positives = 38/77 (49%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            ++++ S +KT+ +W +   E       K L GH   +S V +S D  Y +SG       L
Sbjct: 1201 LLVTGSDEKTVRIWDIATGEL-----LKELSGHHSEVSAVAISPDKKYCVSGDARGHCML 1255

Query: 308  WDLAAGKTTRRFEDHTK 358
            WD+ AGK   +   HT+
Sbjct: 1256 WDVEAGKLLHKLSGHTR 1272



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 29/100 (29%), Positives = 45/100 (45%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            E  KL   L GH   +T +   P     +LS+S D T+  W +   + N    Q ++  H
Sbjct: 1259 EAGKLLHKLSGHTRRITALDFLPD-GKTVLSASGDNTVGSWDVASGKEN----QAQILKH 1313

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
               I  + +   G  A +   D  +R+WDLA+ K TR  +
Sbjct: 1314 PDAILSMAIFDQGKQAATSCADGLVRIWDLASSKVTRTIQ 1353



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  +  +  S DG   L+ S+DKT RLWD+  G    R+  H
Sbjct: 868 GHTEGVLSISFSKDGKRLLTSSYDKTARLWDVKTGDQLNRYWGH 911



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 35   SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQK 211
            +K  +T K     +GH   V  I+ + K    +L+SS DKT  +W + T D+ N      
Sbjct: 854  TKFKDTSKKTPFDQGHTEGVLSISFS-KDGKRLLTSSYDKTARLWDVKTGDQLN------ 906

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GV 391
            R +GH+ ++ D   S+D    ++ S D T  +W+   G+    F  H     ++ F   +
Sbjct: 907  RYWGHNWWVWDANFSTDEKRIVTASQDGTAVIWNTETGEKGAPFTGHQGPVYSAHF--SL 964

Query: 392  NADYALKIILSAYARQ 439
            +AD +  ++ S Y R+
Sbjct: 965  DAD-STHVVTSGYDRR 979



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            GH   +  V  ++DG   +S S D T++LWD+   K  + F  H
Sbjct: 1012 GHQESVQSVEFTNDGKMLISASHDNTVKLWDIETTKALKTFRGH 1055



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 27/93 (29%), Positives = 44/93 (47%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T +L   L GH+  V+ +A +P     +   +R   ++ W +       G    +L GH+
Sbjct: 1218 TGELLKELSGHHSEVSAVAISPDKKYCVSGDARGHCML-WDVEA-----GKLLHKLSGHT 1271

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
              I+ +    DG   LS S D T+  WD+A+GK
Sbjct: 1272 RRITALDFLPDGKTVLSASGDNTVGSWDVASGK 1304



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +2

Query: 224  HSH-FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            H H  ++    S DG + ++GSWD + ++W+   G+  ++ E
Sbjct: 1449 HPHGVVASAAFSPDGKWLVTGSWDNSAKIWNTQTGQAEKKLE 1490



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +2

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            G   KR + H+   + + +S D    ++GS +KT+R+WD+A G+  +    H
Sbjct: 1178 GTEHKR-FEHTGRSAAIDVSFDSKLLVTGSDEKTVRIWDIATGELLKELSGH 1228


>UniRef50_O61585 Cluster: Katanin p80 WD40-containing subunit B1;
           n=4; Eumetazoa|Rep: Katanin p80 WD40-containing subunit
           B1 - Strongylocentrotus purpuratus (Purple sea urchin)
          Length = 690

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/103 (30%), Positives = 52/103 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH   +  +  +P + + + S S D  + +W + R    Y        GH
Sbjct: 89  EPAKIVRTLTGHRNSIRCMDFHP-FGEFVASGSTDTNVKLWDVRRKGCIYTYK-----GH 142

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  ++ +  S DG + ++ S D T++LWDL  GK  + F++HT
Sbjct: 143 SDQVNMIKFSPDGKWLVTASEDTTIKLWDLTMGKLFQEFKNHT 185



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 22/83 (26%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH+  V  I  +P     ++++S D T+ +W LT      G   +    H+  ++ +
Sbjct: 138 TYKGHSDQVNMIKFSPD-GKWLVTASEDTTIKLWDLTM-----GKLFQEFKNHTGGVTGI 191

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
               +     SGS D+T++ WDL
Sbjct: 192 EFHPNEFLLASGSSDRTVQFWDL 214



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 23/94 (24%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  H+  V  +A  P    ++++   DK + +W + +   N  I    L GH+  +  V 
Sbjct: 12  LVAHSSNVNCLALGPMSGRVMVTGGEDKKVNLWAVGKQ--NCIIS---LSGHTSPVDSVK 66

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S     ++GS   T++++DL   K  R    H
Sbjct: 67  FNSSEELVVAGSQSGTMKIYDLEPAKIVRTLTGH 100


>UniRef50_Q8Z020 Cluster: WD-40 repeat protein; n=2; Nostocaceae|Rep:
            WD-40 repeat protein - Anabaena sp. (strain PCC 7120)
          Length = 1747

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 36/117 (30%), Positives = 53/117 (45%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG +       ++++   LR TL GHN  VT +  +P     + S S D T+ +W+   
Sbjct: 1534 ASGSADKTIKIWRVNDGQLLR-TLTGHNDEVTSVNFSPD-GQFLASGSTDNTVKIWQTD- 1590

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                 G   K + GH   I+ V  S D +   S SWD T++LW +  GK       H
Sbjct: 1591 -----GRLIKNITGHGLAIASVKFSPDSHTLASASWDNTIKLWQVTDGKLINNLNGH 1642



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 34/97 (35%), Positives = 46/97 (47%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T   HNGWV  I+ +P    MI S   D  + +W+ T   N + I  K L GH   I+ V
Sbjct: 1267 TWNAHNGWVNSISFSPD-GKMIASGGEDNLVKLWQAT---NGHLI--KTLTGHKERITSV 1320

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              S DG    S S DKT++ W+   GK  +    H +
Sbjct: 1321 KFSPDGKILASASGDKTIKFWN-TDGKFLKTIAAHNQ 1356



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 27/106 (25%), Positives = 47/106 (44%)
 Frame = +2

Query: 35   SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
            + + + ++L  T  GH   VT +  +P     I+SSS DKT+ +W++       G     
Sbjct: 1215 NNLQKCIQLIKTFPGHTDIVTDVVFSPD-SKTIVSSSLDKTIKLWRID------GSIINT 1267

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
               H+ +++ +  S DG    SG  D  ++LW    G   +    H
Sbjct: 1268 WNAHNGWVNSISFSPDGKMIASGGEDNLVKLWQATNGHLIKTLTGH 1313



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 28/87 (32%), Positives = 41/87 (47%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH   VT ++ +P   +++ S S D T+ +W L           K L GH   
Sbjct: 1634 KLINNLNGHIDGVTSLSFSPD-GEILASGSADNTIKLWNLPN-----ATLLKTLLGHPGK 1687

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDL 316
            I+ +  S DG   LSG  D  + +W+L
Sbjct: 1688 INTLAFSPDGKTLLSGGEDAGVMVWNL 1714



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 25/87 (28%), Positives = 42/87 (48%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L   + GH   +  +  +P     + S+S D T+ +W++T      G     L GH   
Sbjct: 1592 RLIKNITGHGLAIASVKFSPD-SHTLASASWDNTIKLWQVTD-----GKLINNLNGHIDG 1645

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDL 316
            ++ +  S DG    SGS D T++LW+L
Sbjct: 1646 VTSLSFSPDGEILASGSADNTIKLWNL 1672



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 23/83 (27%), Positives = 40/83 (48%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   +T +  +P    ++ S+S DKT+  W      N  G   K +  H+  ++ +
Sbjct: 1309 TLTGHKERITSVKFSPD-GKILASASGDKTIKFW------NTDGKFLKTIAAHNQQVNSI 1361

Query: 248  VLSSDGNYALSGSWDKTLRLWDL 316
              SSD    +S   D T+++W +
Sbjct: 1362 NFSSDSKTLVSAGADSTMKVWKI 1384



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 5/73 (6%)
 Frame = +2

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV-----*QNS* 376
            RL GH+  ++ V  S DG    S S D+T++LWD+     T       +V       N  
Sbjct: 1132 RLQGHAQQVNAVSFSPDGKVLASASDDRTVKLWDIHGQLITTITASQKRVTAIAFSHNGK 1191

Query: 377  FC*GVNADYALKI 415
            +    NADY +K+
Sbjct: 1192 YLATANADYTIKL 1204



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 25/95 (26%), Positives = 44/95 (46%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T++ +   +T ++ +P     I ++S D T+ +W    D     +  K L GH   I+ +
Sbjct: 1471 TIQKNQNIITTVSYSPD-GKTIATASADNTIKLW----DSQTQQLI-KTLTGHKDRITTL 1524

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                D     SGS DKT+++W +  G+  R    H
Sbjct: 1525 SFHPDNQTIASGSADKTIKIWRVNDGQLLRTLTGH 1559


>UniRef50_A0YQ70 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=2; Bacteria|Rep: Serine/Threonine protein
           kinase with WD40 repeats - Lyngbya sp. PCC 8106
          Length = 584

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISD 244
           TL GH+ WV  +A +P     + S   DKT+ +W + TR E         L GHS++++ 
Sbjct: 465 TLTGHSDWVNSVAISPD-GRTLASGGNDKTIKLWDVQTRREI------ATLTGHSNWVNS 517

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           V  S D     SGS D T++LWD+
Sbjct: 518 VAFSPDSRTLASGSGDDTIKLWDV 541



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 33/104 (31%), Positives = 51/104 (49%), Gaps = 1/104 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYG 223
           +T +   TL G +  V  +A +P     + S S DKT+ +W + TR E         L G
Sbjct: 416 QTQRQIATLTGRSNSVRSVAFSPD-GRTLASGSEDKTIKLWDVQTRREIT------TLTG 468

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS +++ V +S DG    SG  DKT++LWD+   +       H+
Sbjct: 469 HSDWVNSVAISPDGRTLASGGNDKTIKLWDVQTRREIATLTGHS 512



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 26/88 (29%), Positives = 44/88 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +   TL GH+ WV  +A +P     + S S D T+ +W +        + ++     
Sbjct: 500 QTRREIATLTGHSNWVNSVAFSPD-SRTLASGSGDDTIKLWDVQTQREIATLTRR----- 553

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLW 310
           S+ ++ V  S DG    SGS+D T++LW
Sbjct: 554 SNTVNSVAFSPDGRTLASGSYDNTIKLW 581



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/86 (32%), Positives = 41/86 (47%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL GH+  V  +A + +    + S S D T+ +W +             L GHS+ +
Sbjct: 294 LIATLTGHSNSVRSVAFS-RDSRTLASGSWDNTIKLWDVQTQREI-----ATLTGHSNGV 347

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
             V  S D     SGSWD T++LWD+
Sbjct: 348 LSVAFSRDSRTLASGSWDNTIKLWDV 373



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 27/90 (30%), Positives = 43/90 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +   TL GH+  V  +A + +    + S S D T+ +W +             L G 
Sbjct: 332 QTQREIATLTGHSNGVLSVAFS-RDSRTLASGSWDNTIKLWDVQTQRQI-----ATLTGR 385

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+ +  V  S DG    SG+ DKT++LWD+
Sbjct: 386 SNSVRSVAFSPDGRTLASGNGDKTIKLWDV 415



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L GHS+ +  V  S D     SGSWD T++LWD+   +       H+
Sbjct: 298 LTGHSNSVRSVAFSRDSRTLASGSWDNTIKLWDVQTQREIATLTGHS 344


>UniRef50_Q010G1 Cluster: C86239 protein T10O24.21; n=1;
           Ostreococcus tauri|Rep: C86239 protein T10O24.21 -
           Ostreococcus tauri
          Length = 619

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/87 (33%), Positives = 40/87 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V +I   P    ++LS+  D  + +W    D  N     +   GH   + DV
Sbjct: 325 TFNGHTKGVAKIEFFPHTGHLLLSAGMDNVVKIW----DVYNTRKCMRTYMGHDKAVKDV 380

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK 328
             + DG   +S SWDK +RLWD   GK
Sbjct: 381 CFNQDGTRFVSTSWDKKVRLWDTETGK 407



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +2

Query: 44  SETLKLRGTLR-GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           +ET K+  T+  G  G+  +I  +PK  +++L    DK ++ W    D NN  + Q+   
Sbjct: 403 TETGKVIQTVSSGKIGYCAKI--HPKQENLVLIGQSDKKIVQW----DMNNGDLVQE-YD 455

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            H   ++ +  +  G   +S S DK+LR+W+     TT+   D
Sbjct: 456 QHLGPVNSITFADGGERFMSSSDDKSLRVWEFGIPVTTKYIAD 498


>UniRef50_Q4N1R3 Cluster: Putative uncharacterized protein; n=3;
           Eukaryota|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 521

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 34/104 (32%), Positives = 54/104 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  +  GH   V +++ +P+  D++ S  RD  + VW + R +    +    L GH
Sbjct: 281 EQNKVVRSYHGHLSGVYKLSLHPEL-DILFSGGRDAVVRVWDI-RTKQAVHV----LTGH 334

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           S  +  +V  S     +SGS DKT+RLWDL+ GK+     +H K
Sbjct: 335 SGTVMSLVSQSSEPQVISGSQDKTVRLWDLSMGKSIVTLTNHKK 378



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 29/102 (28%), Positives = 48/102 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  KL   ++GH+GWV  +  +    +  +S S D+ + +W L   E         L GH
Sbjct: 197 EPWKLYRVIKGHHGWVHCVDVDISN-EWFVSGSADRLIKIWDLASCELKLS-----LTGH 250

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + + D+ +S+   Y  S S D T++ WD+   K  R +  H
Sbjct: 251 INTVRDIKISTRSPYIFSCSEDNTVKCWDIEQNKVVRSYHGH 292


>UniRef50_Q232S8 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 2421

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ-KRLYGHSHFISD 244
            TL+GH   +  +A +P   + + + S DKT  +W +     NYG    K +  H   IS 
Sbjct: 2297 TLQGHTFEINSVAFSPD-SNFLATGSYDKTCKIWCV-----NYGFQLIKNIEAHIWIISS 2350

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAG 325
            +  S+DG Y ++GS DKT ++W+L  G
Sbjct: 2351 LAFSTDGKYLVTGSRDKTCKIWNLEKG 2377



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/74 (32%), Positives = 37/74 (50%)
 Frame = +2

Query: 104  ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSG 283
            A +P    +  +  +D  L +W +   +  + +    + GHS FI  V  SSDG Y  +G
Sbjct: 1663 AFSPDGKYLATAGLKDNFLYIWNV---QQGFQLVNT-IQGHSDFIFSVAFSSDGKYIATG 1718

Query: 284  SWDKTLRLWDLAAG 325
            S DKT ++WD   G
Sbjct: 1719 SKDKTCKIWDAEKG 1732



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T++GH   +  +A +P     + + S D T  +W + + +  Y +    L GH + I+ V
Sbjct: 1781 TIQGHAQTINSVAFSPD-GKYLATGSGDNTCRIWSVEK-KKFYLL--NILQGHKNQINSV 1836

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAG-KTTRRFEDH 352
              S+D  Y  +GS D T ++W++  G +     +DH
Sbjct: 1837 AFSADSKYLATGSQDNTCKIWNIERGFQLINTIQDH 1872



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +2

Query: 71   LRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
            ++GH+  +T +  + + KY   + ++S DKT  +W L    NN  I  K + GH+  I+ 
Sbjct: 1955 IQGHSQPITSVTFSVDGKY---LATASEDKTCKIWNLL---NNCQI-LKTIQGHTSKINS 2007

Query: 245  VVLSSDGNYALSGSWDKTLRLWD 313
            V  S+DG Y  + S DKT ++W+
Sbjct: 2008 VSFSADGKYLATCSEDKTCKIWN 2030



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/92 (28%), Positives = 45/92 (48%)
 Frame = +2

Query: 53   LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
            L+L  T++GH+  +  +A +      + +SS D+T  ++ + +        Q    GH+ 
Sbjct: 1733 LQLINTIQGHHQTILSVAFSDD-GKYLATSSHDQTCKIFNILQGFEFINTIQ----GHAQ 1787

Query: 233  FISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
             I+ V  S DG Y  +GS D T R+W +   K
Sbjct: 1788 TINSVAFSPDGKYLATGSGDNTCRIWSVEKKK 1819



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +2

Query: 137  SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            + S DKT    K+   EN + +    + GH+ F+  V  S+DG +  +GS DKT ++W++
Sbjct: 2233 TGSNDKTC---KIYTAENYFQLVST-ISGHTSFVYSVAFSADGRFLATGSQDKTCKIWNM 2288

Query: 317  AAG 325
              G
Sbjct: 2289 RQG 2291



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
            L   L+GH   +  +A   + KY   + + S+D T  +W + R        Q     H  
Sbjct: 1822 LLNILQGHKNQINSVAFSADSKY---LATGSQDNTCKIWNIERGFQLINTIQD----HFS 1874

Query: 233  FISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             I+ V  S DG Y ++GS DK+ ++W +  G
Sbjct: 1875 SINSVTFSPDGKYFVTGSSDKSCKIWSVEKG 1905



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ-KRLYGHSH 232
            +L   ++GH+  +  +A +     ++ + S D T  +W      + YG      + GHS 
Sbjct: 1907 QLFNIIQGHSQEIKSVAFSGD-GQLLATVSSDNTCKIWN-----SLYGFCFINNIQGHSQ 1960

Query: 233  FISDVVLSSDGNYALSGSWDKTLRLWDL 316
             I+ V  S DG Y  + S DKT ++W+L
Sbjct: 1961 PITSVTFSVDGKYLATASEDKTCKIWNL 1988



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 24/90 (26%), Positives = 40/90 (44%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L  T++ H   +  +  +P     +  SS DK+  +W + +    + I Q    GHS  
Sbjct: 1864 QLINTIQDHFSSINSVTFSPDGKYFVTGSS-DKSCKIWSVEKGFQLFNIIQ----GHSQE 1918

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            I  V  S DG    + S D T ++W+   G
Sbjct: 1919 IKSVAFSGDGQLLATVSSDNTCKIWNSLYG 1948



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            + GHS  I+ V  S+DG Y  +GS D T ++W+
Sbjct: 2127 IQGHSKAINSVAFSADGKYLATGSSDSTCKIWN 2159



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            T++GH   +  ++   + KY   + + S DKT  +W     +N + +  K + GH   ++
Sbjct: 1997 TIQGHTSKINSVSFSADGKY---LATCSEDKTCKIWNT---QNEFQMI-KSIEGHVLEVN 2049

Query: 242  DVVLSSDGNYALSGSWDKTLRLW 310
                S +  Y  +GS DKT ++W
Sbjct: 2050 SASFSPNSKYLATGSSDKTCKIW 2072


>UniRef50_Q1EQ29 Cluster: Beta prime-COP; n=2; Entamoeba
           histolytica|Rep: Beta prime-COP - Entamoeba histolytica
          Length = 800

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 2/98 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV-- 247
           +GH   V  ++ NPK P++  S S D T+ +W L     N   P   L GH   +  V  
Sbjct: 138 KGHTNAVMSLSLNPKDPNIFASGSLDGTVKIWGL-----NSNSPHFTLEGHEAGVCCVCY 192

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           +++    Y LSG  D  +R+WD        +FE HT V
Sbjct: 193 LINDTRPYLLSGGEDTVIRVWDYQTKACVNKFEGHTDV 230


>UniRef50_A0E7C7 Cluster: Chromosome undetermined scaffold_81, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_81,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1096

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/97 (29%), Positives = 49/97 (50%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           +  L GHN  +  I  +P    +  S S D ++ +W +  ++      + +L GHS+++ 
Sbjct: 597 KAKLDGHNSGIYSICFSPDGATLA-SGSLDNSIRLWDIKIEQQ-----KAKLDGHSNYVM 650

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            V  SSDG    SGS D ++RLWD   G+   + + H
Sbjct: 651 SVCFSSDGTKLASGSLDNSIRLWDANVGQQRAQVDGH 687



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/98 (30%), Positives = 47/98 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R  + GH   V  +  +P     + S S D ++ +W +       G  Q +L GHS+ + 
Sbjct: 681 RAQVDGHASSVYSVCFSPD-GTTLASGSNDNSICLWDVKT-----GQQQAKLDGHSNHVL 734

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V  S DG    SGS DK++R WD+  G+   + + HT
Sbjct: 735 SVCFSPDGTTLASGSSDKSIRFWDVKTGQQKTKLDGHT 772



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 29/95 (30%), Positives = 48/95 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH+G V  +  +     ++ S S D ++ +W  T      G  + +L GH  ++  V 
Sbjct: 432 LKGHDGIVYSVCFSSD-GTILASGSDDNSIRLWDTTT-----GYQKAKLDGHDDWVISVC 485

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG    S S D ++RLWD+  G+   +F+ HT
Sbjct: 486 FSPDGTTLASASDDNSIRLWDVRTGQQKLKFDGHT 520



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/93 (31%), Positives = 48/93 (51%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G V  +  +P    +I S S DK++ +W +     N G  + +L GH+  I  +  S
Sbjct: 560 GHDGIVYSVCFSPD-GKIIASGSDDKSIRLWDV-----NLGQQKAKLDGHNSGIYSICFS 613

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    SGS D ++RLWD+   +   + + H+
Sbjct: 614 PDGATLASGSLDNSIRLWDIKIEQQKAKLDGHS 646



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P     + S S D ++ +W++   +  +        GH   +  V  S
Sbjct: 518 GHTSTVYSVCFSPD-GTTLASGSHDNSIRLWEVKTGQQKF-----EFEGHDGIVYSVCFS 571

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            DG    SGS DK++RLWD+  G+   + + H
Sbjct: 572 PDGKIIASGSDDKSIRLWDVNLGQQKAKLDGH 603



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/98 (25%), Positives = 47/98 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           +  L GH+ +V  +  +      + S S D ++ +W     + N G  + ++ GH+  + 
Sbjct: 639 KAKLDGHSNYVMSVCFSSD-GTKLASGSLDNSIRLW-----DANVGQQRAQVDGHASSVY 692

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            V  S DG    SGS D ++ LWD+  G+   + + H+
Sbjct: 693 SVCFSPDGTTLASGSNDNSICLWDVKTGQQQAKLDGHS 730



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 27/89 (30%), Positives = 44/89 (49%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +  L GH+  V  +  +P     + S S DK++  W +       G  + +L GH
Sbjct: 718 KTGQQQAKLDGHSNHVLSVCFSPD-GTTLASGSSDKSIRFWDVKT-----GQQKTKLDGH 771

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           + +I  V  S DG    SGS D ++RLW+
Sbjct: 772 TGYIMSVCFSCDGATLASGSIDTSIRLWN 800



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L GHS  +  V  S DG    SGS+D ++RLWD+  G+     + H
Sbjct: 389 KLDGHSSAVRSVCFSPDGTTLASGSYDNSIRLWDVMTGQQKFELKGH 435


>UniRef50_A0D1X6 Cluster: Chromosome undetermined scaffold_34, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_34,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 799

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/95 (32%), Positives = 49/95 (51%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           +  L GH   V  +  +P     + S+S+DK++ +W +   E      + +L GHS ++ 
Sbjct: 572 KAILNGHQDDVMSVCFSPD-GTTLASASKDKSVRLWDVKTGEQ-----KAKLDGHSSYVM 625

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            V  SSDG    SGS D ++RLWD+  G+ T   E
Sbjct: 626 SVNFSSDGATLASGSRDHSIRLWDVKTGQQTVNLE 660



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/102 (29%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +  L GH   V Q+  +P    ++ S S D+T+ +W + + +        +L GH
Sbjct: 483 KTGQQKAKLNGHCNCVYQVCFSPNRR-ILASCSDDRTIRLWDIEKQKQI-----AKLEGH 536

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + +  V  S DG+   SGS+DK++RLWD   G+       H
Sbjct: 537 YNGVQSVSFSPDGSNLASGSYDKSVRLWDPRTGQQKAILNGH 578



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 30/103 (29%), Positives = 48/103 (46%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K    L GH   V  ++ +P   ++  S S DK++ +W     +   G  +  L GH
Sbjct: 525 EKQKQIAKLEGHYNGVQSVSFSPDGSNLA-SGSYDKSVRLW-----DPRTGQQKAILNGH 578

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              +  V  S DG    S S DK++RLWD+  G+   + + H+
Sbjct: 579 QDDVMSVCFSPDGTTLASASKDKSVRLWDVKTGEQKAKLDGHS 621



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 22/67 (32%), Positives = 35/67 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S S D ++ +W +   + N      ++ GH +    V  SSDGN   S S DKT+R 
Sbjct: 675 ILASGSYDNSISLWDVRVAQEN-----AKVDGHRNIFQQVCFSSDGNKLYSCSDDKTIRF 729

Query: 308 WDLAAGK 328
           WD+  G+
Sbjct: 730 WDVKKGQ 736



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 11/116 (9%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K++E +KL+G    H   +  +  +P     + S+S DK++I+W +   +        +L
Sbjct: 389 KINELIKLQG----HKNSIQSVCFSPD-GKTLASASDDKSIILWDVKTVQQI-----AKL 438

Query: 218 YGHSHFISDVVLSSDGNYALSGSW-----------DKTLRLWDLAAGKTTRRFEDH 352
            GHS+ +  V  S DG    SGS            D ++RLWD+  G+   +   H
Sbjct: 439 NGHSNPVRSVCFSHDGATLASGSGYPIYNFENDSDDYSIRLWDVKTGQQKAKLNGH 494



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 24/107 (22%), Positives = 47/107 (43%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T + +  L GH+ +V  +  +     +  S SRD ++ +W +   +    +        
Sbjct: 609 KTGEQKAKLDGHSSYVMSVNFSSDGATLA-SGSRDHSIRLWDVKTGQQTVNL-------E 660

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*Q 367
           +  I  V  S DG    SGS+D ++ LWD+   +   + + H  + Q
Sbjct: 661 ASSIRSVCFSPDGLILASGSYDNSISLWDVRVAQENAKVDGHRNIFQ 707



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L GH + I  V  S DG    S S DK++ LWD+   +   +   H+
Sbjct: 395 KLQGHKNSIQSVCFSPDGKTLASASDDKSIILWDVKTVQQIAKLNGHS 442


>UniRef50_Q6CEN7 Cluster: Yarrowia lipolytica chromosome B of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome B of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 741

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/94 (30%), Positives = 49/94 (52%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  V  +A +P +     ++S D+T  +W       ++  P +   GH   +  V+ 
Sbjct: 509 KGHNEPVWDVAFSP-HGHYFATASHDQTARLWSC-----DHIYPLRIFAGHMSDVDCVIF 562

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +G Y  +GS D+T+R+WD+A G + R F  HT
Sbjct: 563 HPNGTYVFTGSSDRTVRMWDVAKGSSVRVFIGHT 596



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 30/94 (31%), Positives = 47/94 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V  ++ +P     +LS+S DKT+++W +   +   G+   +  GH+  + DV 
Sbjct: 466 LVGHAGPVYGVSFSPDQR-YLLSASADKTVMLWSM---DTYTGLVCYK--GHNEPVWDVA 519

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  G+Y  + S D+T RLW        R F  H
Sbjct: 520 FSPHGHYFATASHDQTARLWSCDHIYPLRIFAGH 553



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/94 (23%), Positives = 43/94 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P     + + S D+T+ +W + +     G   +   GH+  I+ + +S
Sbjct: 552 GHMSDVDCVIFHPN-GTYVFTGSSDRTVRMWDVAK-----GSSVRVFIGHTAAINCLAVS 605

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            DG +  S   D  + LW++ +G+  +    H K
Sbjct: 606 PDGRWLASAGEDHVIILWEIGSGRRLKIMRGHGK 639



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           KRL GH+  +  V  S D  Y LS S DKT+ LW +
Sbjct: 464 KRLVGHAGPVYGVSFSPDQRYLLSASADKTVMLWSM 499


>UniRef50_Q6C7K4 Cluster: Similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c; n=1; Yarrowia lipolytica|Rep:
           Similar to sp|P40968 Saccharomyces cerevisiae YDR364c -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 491

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 1/93 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISD 244
           T  GH G V  +   PK   ++LS   D  + +W +            R Y GHS  + D
Sbjct: 197 TYTGHTGGVNALRLFPKAGHLLLSCGNDSKIKLWDVYHKRELI-----RTYSGHSRAVKD 251

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           +  ++DG   LS S+DK+++LWD  +G+   +F
Sbjct: 252 ISFNNDGTRFLSASYDKSVKLWDTESGECLAQF 284


>UniRef50_Q0C8M7 Cluster: Predicted protein; n=1; Aspergillus terreus
            NIH2624|Rep: Predicted protein - Aspergillus terreus
            (strain NIH 2624)
          Length = 1641

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +2

Query: 26   KPFSKMSETLKL-RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI 202
            K  S + E+  L R  L GHNG V+ +A +P    ++ S S D  + +W +     + G 
Sbjct: 989  KNISGIKESWDLYRQVLSGHNGVVSAVAFSPN-GKILASGSSDTKVCLWAIDAATAS-GT 1046

Query: 203  PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTT 334
            P + L GH+  +  V  S +G    S S D+TLRLW + +   T
Sbjct: 1047 PTQTLSGHTDMVKAVAFSPNGQILASASDDQTLRLWTVDSATAT 1090



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 35/97 (36%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI-PQKRLYGHSHFISD 244
            TL GH   V  +A +P    ++ S+S D+TL +W  T D     I P++ + GH+  ++ 
Sbjct: 1050 TLSGHTDMVKAVAFSPN-GQILASASDDQTLRLW--TVDSATATIEPKQTIGGHTDLVNA 1106

Query: 245  VVLSSDGNYALSGSWDKTLRLWDLAAGK-TTRRFEDH 352
            V  S DG    S S DKT+RLW L + + T+  F  H
Sbjct: 1107 VAFSPDGLLLASASSDKTIRLWYLGSPELTSHMFTGH 1143



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 29/89 (32%), Positives = 45/89 (50%)
 Frame = +2

Query: 50   TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            T++ + T+ GH   V  +A +P    ++ S+S DKT+ +W L   E    +      GH 
Sbjct: 1090 TIEPKQTIGGHTDLVNAVAFSPDGL-LLASASSDKTIRLWYLGSPE----LTSHMFTGHG 1144

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              ++ V +S DG    S S DKT+ LW L
Sbjct: 1145 GRVNAVTISPDGKQLASASSDKTIALWSL 1173



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/66 (37%), Positives = 36/66 (54%)
 Frame = +2

Query: 137  SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            S+S D T+ +W +    ++  I   RL GH + +  V  SSDGN   S S D T+RLWD+
Sbjct: 1250 SASSDATVCLWDVNTSISDTCIA--RLTGHENCVRSVAFSSDGNIFASASNDATVRLWDI 1307

Query: 317  AAGKTT 334
             +   T
Sbjct: 1308 DSATNT 1313



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 3/74 (4%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNY---GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKT 298
            M+ S+S D+ + +W ++   +     G   ++L GH   +S    S+DG    SGS D T
Sbjct: 1427 MLASASSDQIIYLWNISSSAHGLRILGNESQKLIGHKGSVSTAAFSTDGTILASGSTDTT 1486

Query: 299  LRLWDLAAGKTTRR 340
            +RLW + A     R
Sbjct: 1487 VRLWSIDASTGAAR 1500



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 23/88 (26%), Positives = 39/88 (44%)
 Frame = +2

Query: 77   GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
            GH G V  +  +P     + S+S DKT+ +W L    ++ G          + ++ +  S
Sbjct: 1142 GHGGRVNAVTISPD-GKQLASASSDKTIALWSL----DHPGTANSEFKSLPNEVNAIAFS 1196

Query: 257  SDGNYALSGSWDKTLRLWDLAAGKTTRR 340
             +G   +SGS +  L LW +     T R
Sbjct: 1197 PNGEMLVSGSSNGELILWSIGPELATTR 1224



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 26/75 (34%), Positives = 35/75 (46%)
 Frame = +2

Query: 92   VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
            V  IA +P   +M++S S +  LI+W +   E       K LY     I  V  S DG  
Sbjct: 1190 VNAIAFSPN-GEMLVSGSSNGELILWSIG-PELATTRAVKLLYHSVDSIHAVAFSPDGTK 1247

Query: 272  ALSGSWDKTLRLWDL 316
              S S D T+ LWD+
Sbjct: 1248 FASASSDATVCLWDV 1262



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH G V+  A +     ++ S S D T+ +W +          ++ L GH   ++ + 
Sbjct: 1459 LIGHKGSVSTAAFSTD-GTILASGSTDTTVRLWSIDAS-TGAARSRQTLAGHRKSVNALT 1516

Query: 251  LSSDGNYALSGSWDKTLRLWDL----AAGKTTR 337
             S D     S S D ++R+W++    A G+ TR
Sbjct: 1517 FSLDNRMLASCSDDGSVRIWNIDPITATGECTR 1549



 Score = 32.7 bits (71), Expect = 7.4
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +2

Query: 95   TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYA 274
            T IA  P   ++      +K   V  ++  + ++ + ++ L GH+  +S V  S +G   
Sbjct: 965  TAIAFCPTQSEIRKGFWGEKLPYVKNISGIKESWDLYRQVLSGHNGVVSAVAFSPNGKIL 1024

Query: 275  LSGSWDKTLRLWDL----AAGKTTRRFEDHT 355
             SGS D  + LW +    A+G  T+    HT
Sbjct: 1025 ASGSSDTKVCLWAIDAATASGTPTQTLSGHT 1055


>UniRef50_A7TGM1 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 850

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 28/93 (30%), Positives = 47/93 (50%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +  +P   ++  ++S D+T  +W   R       P + + GH + +  V  
Sbjct: 613 KGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRV-----YPLRVMAGHLNDVDCVSF 667

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+G Y  +GS DKT+R+WD+  G + R F  H
Sbjct: 668 HSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGH 700



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/76 (27%), Positives = 39/76 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I + S DKT+ +W +     N G   +   GH+  ++ + +S DG +  +GS D  + +W
Sbjct: 674 IFTGSSDKTVRMWDI-----NTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIW 728

Query: 311 DLAAGKTTRRFEDHTK 358
           D+ +G+  +    H K
Sbjct: 729 DIGSGRKLKNMRGHGK 744



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWV--TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI 202
           P + +S T K   T  GH+G V  T  +   +Y   +LS+S DKT+ +W +  D+     
Sbjct: 559 PNNPISSTCK---TFIGHSGTVYSTSFSAGDEY---LLSASEDKTVRLWSVQDDK----- 607

Query: 203 PQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRLW 310
           P     GH   + DV  S S  N   + S D+T RLW
Sbjct: 608 PLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLW 644



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           K   GHS  +     S+   Y LS S DKT+RLW +   K    ++ H K
Sbjct: 568 KTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEK 617


>UniRef50_A1CUE3 Cluster: Cell division control protein Cdc4,
            putative; n=5; Eurotiomycetidae|Rep: Cell division
            control protein Cdc4, putative - Aspergillus clavatus
          Length = 1006

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 33/97 (34%), Positives = 48/97 (49%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH   V  IA    + D ++S S D T+ VWK++  E  +     RL GH+  +  VV
Sbjct: 773  LTGHQHSVRAIAA---HGDTLVSGSYDCTVRVWKISTGETLH-----RLQGHTLKVYSVV 824

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            L    N  +SGS D T+++W L  G      E H+ +
Sbjct: 825  LDHKRNRCISGSMDNTVKVWSLETGSIIHNLEGHSSL 861



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 29/97 (29%), Positives = 47/97 (48%)
 Frame = +2

Query: 47   ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
            ET  +   L GH+  V  +       D ++S++ D TL +W     +   G  + +L  H
Sbjct: 847  ETGSIIHNLEGHSSLVGLLDLKC---DRLVSAAADCTLRIW-----DPETGQCKSKLSAH 898

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
            +  I+      DG   +SGS D+TL++WD+  GK  R
Sbjct: 899  TGAIT--CFQHDGQKVISGS-DRTLKMWDVQTGKCVR 932



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 23/77 (29%), Positives = 38/77 (49%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D +L+ S D  + V+     +   G  +  L GH   +    L   GN  +SGS D+++R
Sbjct: 632 DKVLTGSDDTNINVY-----DTKTGALKATLEGHEGGVW--ALEYYGNTLVSGSTDRSVR 684

Query: 305 LWDLAAGKTTRRFEDHT 355
           +WD+   + T+ F  HT
Sbjct: 685 VWDIERARCTQIFHGHT 701



 Score = 36.3 bits (80), Expect = 0.60
 Identities = 29/95 (30%), Positives = 42/95 (44%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH   V  +  + K  +  +S S D T+ VW L       G     L GHS  +  + 
Sbjct: 813  LQGHTLKVYSVVLDHKR-NRCISGSMDNTVKVWSLET-----GSIIHNLEGHSSLVGLLD 866

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            L  D    +S + D TLR+WD   G+   +   HT
Sbjct: 867  LKCDR--LVSAAADCTLRIWDPETGQCKSKLSAHT 899


>UniRef50_UPI0000DB7FEE Cluster: PREDICTED: similar to HIRA protein
           homolog (dHIRA); n=1; Apis mellifera|Rep: PREDICTED:
           similar to HIRA protein homolog (dHIRA) - Apis mellifera
          Length = 838

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 37/102 (36%), Positives = 51/102 (50%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           SG SS+F   S + ET +   TLR H   V  +A  P  P  + S+S D ++IVW    D
Sbjct: 102 SGGSSIFGGKSSI-ETWRCIATLRSHEADVLDLAWAPHSP-WLASASVDNSVIVW----D 155

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            + +      L GH+ F+  +     G Y  S S DKTLR+W
Sbjct: 156 ASKFPAIVAVLKGHTGFVKGITWDPVGKYLASQSDDKTLRVW 197


>UniRef50_Q8YZ23 Cluster: WD-40 repeat protein; n=4;
           Cyanobacteria|Rep: WD-40 repeat protein - Anabaena sp.
           (strain PCC 7120)
          Length = 934

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 2/97 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  +A +P     I ++  DKT  +WKL    +        + GH   + D+
Sbjct: 568 TLYGHTDAVNSVAFSPDGTS-IATAGNDKTAKIWKLNSPNSII------VRGHEDEVFDL 620

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGK--TTRRFEDH 352
           V S +G Y  + SWDKT +LW +   K    R F  H
Sbjct: 621 VFSPNGKYIATASWDKTAKLWSIVGDKLQELRTFNGH 657



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 29/81 (35%), Positives = 41/81 (50%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +I ++  DKT+ +W +       G  QK L GH+  I+ V  S DG    S SWD T+++
Sbjct: 754 LIATAGWDKTVKIWSID------GRLQKTLTGHTSGINSVTFSPDGKLIASASWDNTVKI 807

Query: 308 WDLAAGKTTRRFEDHTKV*QN 370
           W+L  GK  R    H  V  N
Sbjct: 808 WNL-DGKELRTLRGHKNVVHN 827



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 27/83 (32%), Positives = 43/83 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH   V  +  +P    +I ++S D+T+ +W      N+ G   + LYGH+  ++ V
Sbjct: 527 TLRGHQNGVNSVTFSPD-GKLIATASGDRTVKLW------NSKGQELETLYGHTDAVNSV 579

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S DG    +   DKT ++W L
Sbjct: 580 AFSPDGTSIATAGNDKTAKIWKL 602



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 29/95 (30%), Positives = 46/95 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V ++A +P    ++ ++S D T+ +W      +  G     L GH   ++ +
Sbjct: 404 TLDGHKEAVLEVAFSPD-SQLLATASWDNTVKLW------SREGKLLHTLEGHKDKVNSI 456

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S DG    +  WD T++LW+L  GK  R F  H
Sbjct: 457 TFSPDGQLIATVGWDNTMKLWNL-DGKELRTFRGH 490



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           +RGH   V  +  +P     I ++S DKT  +W +  D+    + + R + GH   ++ +
Sbjct: 610 VRGHEDEVFDLVFSPN-GKYIATASWDKTAKLWSIVGDK----LQELRTFNGHQGRVNKL 664

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S DG Y  + SWDKT +LW+L
Sbjct: 665 SFSPDGKYIATTSWDKTAKLWNL 687



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 32/96 (33%), Positives = 48/96 (50%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           K +S + + L+   T  GH G V +++ +P     I ++S DKT  +W L       G  
Sbjct: 639 KLWSIVGDKLQELRTFNGHQGRVNKLSFSPD-GKYIATTSWDKTAKLWNLD------GTL 691

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           QK L GH   +  V  S DG    + S DKT++LW+
Sbjct: 692 QKTLTGHKDTVWSVNFSPDGQLIATASEDKTVKLWN 727



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 30/99 (30%), Positives = 47/99 (47%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   V  +  +P    +I ++S DKT+ +W      N  G   K L   S  +
Sbjct: 691 LQKTLTGHKDTVWSVNFSPD-GQLIATASEDKTVKLW------NRDGELLKTLPRQSSVV 743

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  V S DG    +  WDKT+++W +  G+  +    HT
Sbjct: 744 NSAVFSPDGKLIATAGWDKTVKIWSI-DGRLQKTLTGHT 781



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +L+ TL GH   +  +  +P    +I S+S D T+ +W L   E       + L GH + 
Sbjct: 772  RLQKTLTGHTSGINSVTFSPD-GKLIASASWDNTVKIWNLDGKE------LRTLRGHKNV 824

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAG--KTTRRFED 349
            + +V  S DG    + S D T+++W++     +T R ++D
Sbjct: 825  VHNVTFSPDGKLIATASGDNTVKIWNINGQELRTLRGYKD 864



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 26/97 (26%), Positives = 46/97 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           +  L  H+G +  ++ +P     I ++SRDKT+ +W L   +    + +++  G     +
Sbjct: 318 KNRLAEHDGMLESVSFSPD-SKFIATASRDKTVKIWSLDGKKQLVVLREEKGEG----FN 372

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            V  S DG    +GSWD T ++W    GK     + H
Sbjct: 373 SVAFSPDGTLMATGSWDNTAKIWS-REGKRLHTLDGH 408



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 31/99 (31%), Positives = 42/99 (42%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL  TL GH   V  I  +P    +I +   D T+ +W L   E       +   GH   
Sbjct: 441 KLLHTLEGHKDKVNSITFSPD-GQLIATVGWDNTMKLWNLDGKE------LRTFRGHQDM 493

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  V  S DG    + S D+T++LW L  GK  +    H
Sbjct: 494 IWSVSFSPDGKQIATASGDRTVKLWSL-DGKELQTLRGH 531


>UniRef50_Q8YNK6 Cluster: WD-40 repeat-protein; n=4;
           Nostocaceae|Rep: WD-40 repeat-protein - Anabaena sp.
           (strain PCC 7120)
          Length = 786

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/83 (32%), Positives = 46/83 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+G +  + T+P     + S S D T+ +W+++  E  +      L GHS  ++ V
Sbjct: 707 TLTGHSGDIKSLTTSPN-GQFLFSGSADTTIKIWRISTGELLH-----TLTGHSASVNSV 760

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
            +S  GN   SGS D+T+++W +
Sbjct: 761 AISPGGNLLASGSADQTIKIWQI 783



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/96 (28%), Positives = 45/96 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H+  V  IA + +    + S S D T+ +W L   +  +      L GHS  I  +
Sbjct: 665 TLNSHDNEVKAIAIS-RDGQFLFSGSADTTIKIWHLITGQILH-----TLTGHSGDIKSL 718

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             S +G +  SGS D T+++W ++ G+       H+
Sbjct: 719 TTSPNGQFLFSGSADTTIKIWRISTGELLHTLTGHS 754



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/92 (27%), Positives = 42/92 (45%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  V  IA +P    ++ S S D  + +W         G P + L  H + +  + +S 
Sbjct: 627 HSSAVHAIAISPD-STILASGSSDNKIRLWN-----PRTGDPLRTLNSHDNEVKAIAISR 680

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           DG +  SGS D T+++W L  G+       H+
Sbjct: 681 DGQFLFSGSADTTIKIWHLITGQILHTLTGHS 712



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           K + GHS  +  V +S DG   +SG  D+T+ +W+L  GK  R
Sbjct: 488 KTITGHSGKVKSVAISPDGEVIVSGCTDQTVNIWNLQTGKLIR 530



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRD--KTLIVWKLTRDENNYGIPQKRLY 220
           +T KL  TL G+ G V+ +A +P    + + S       + VW L       G     L 
Sbjct: 524 QTGKLIRTLTGNLGEVSSVAISPDGNFLAVGSGVHPRSNVKVWHLKT-----GKLLHTLL 578

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           GH   ++ VV+S DG    SGS    +++W+L  G
Sbjct: 579 GHQKPVNVVVISPDGQILASGS--NKIKIWNLQKG 611


>UniRef50_A7BW04 Cluster: WD-40 repeat protein; n=1; Beggiatoa sp.
           PS|Rep: WD-40 repeat protein - Beggiatoa sp. PS
          Length = 1036

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/83 (36%), Positives = 46/83 (55%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V  +A +P    ++ S S DKT+ +W +   +  +    + L GHS+ +  V 
Sbjct: 428 LVGHSNLVKSVAFHPN-GKILASGSNDKTVRLWDVATRQPLH----EPLIGHSYLVVSVA 482

Query: 251 LSSDGNYALSGSWDKTLRLWDLA 319
            S +G    SGS DKT+RLWD+A
Sbjct: 483 FSPNGKTLASGSGDKTVRLWDVA 505



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 36/107 (33%), Positives = 53/107 (49%)
 Frame = +2

Query: 2    ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
            ASG S        ++    L   L GH+  V  +  +P     + S S DKT+I+W +  
Sbjct: 809  ASGSSDDTVRLWDVATRQSLGDPLVGHSDSVKSVTFSPD-GKTLASGSNDKTVILWDVAT 867

Query: 182  DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
             +   G P   L GHS F++ V  S DG    SG  DK+++LWD+A+
Sbjct: 868  RQP-LGKP---LVGHSWFVNSVTFSPDGKTLASGIEDKSVKLWDVAS 910



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 32/83 (38%), Positives = 43/83 (51%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+ WV  +A +P     + S S D T+ +W +     + G P   L GHS  +  V 
Sbjct: 789  LVGHSHWVYSVAFSPN-GKTLASGSSDDTVRLWDVA-TRQSLGDP---LVGHSDSVKSVT 843

Query: 251  LSSDGNYALSGSWDKTLRLWDLA 319
             S DG    SGS DKT+ LWD+A
Sbjct: 844  FSPDGKTLASGSNDKTVILWDVA 866



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 5/88 (5%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSS-----SRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           L GH+ WV  +A +P   ++   S     + D T+I+W +   +   G P   L GHS  
Sbjct: 514 LVGHSNWVQSVAFSPDGKNLASGSGGVFGNEDNTVILWDVATRQP-LGDP---LGGHSSH 569

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLA 319
           +  V  S DG    SGS D T+RLW++A
Sbjct: 570 VLSVAFSPDGKTLASGSHDGTMRLWNVA 597



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 29/82 (35%), Positives = 43/82 (52%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+ +V  +  +P     + S   DK++ +W +   +   G P   L GHS  +  V 
Sbjct: 875  LVGHSWFVNSVTFSPD-GKTLASGIEDKSVKLWDVA-SKQPLGEP---LNGHSGSVQSVA 929

Query: 251  LSSDGNYALSGSWDKTLRLWDL 316
             S DG    SGS+DKT+RLWD+
Sbjct: 930  FSPDGKTLASGSYDKTIRLWDV 951



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 31/82 (37%), Positives = 43/82 (52%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V  +A +P     + S SRDKT+ +W +   +   G P   L GHS  +  V 
Sbjct: 648 LVGHSMSVESVAFSPD-GKTLASGSRDKTVRLWDVATRQP-LGKP---LIGHSKKVQSVA 702

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S DG    SG+ D T+RLWD+
Sbjct: 703 FSPDGKILASGNLDDTVRLWDV 724



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/63 (41%), Positives = 34/63 (53%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S + D T+ +W + R     G P   L GHS  +  V  S DG    SGS DKT+RLW
Sbjct: 625 LASGNLDDTVRLWDVIRQP--LGEP---LVGHSMSVESVAFSPDGKTLASGSRDKTVRLW 679

Query: 311 DLA 319
           D+A
Sbjct: 680 DVA 682



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 18/34 (52%), Positives = 22/34 (64%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           LYGHS  +  V  S DG    SGS+D T+RLWD+
Sbjct: 385 LYGHSGSVYSVAFSLDGKTLASGSYDNTVRLWDV 418



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 27/82 (32%), Positives = 40/82 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V  +A +P     + S S D T+ +W +   +   G P   L G  + +  V 
Sbjct: 563 LGGHSSHVLSVAFSPD-GKTLASGSHDGTMRLWNVATRQP-LGEP---LVGSFNSVYSVA 617

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S DG    SG+ D T+RLWD+
Sbjct: 618 FSPDGKTLASGNLDDTVRLWDV 639


>UniRef50_A3IT74 Cluster: Serine/Threonine protein kinase with WD40
           repeats; n=1; Cyanothece sp. CCY 0110|Rep:
           Serine/Threonine protein kinase with WD40 repeats -
           Cyanothece sp. CCY 0110
          Length = 275

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/90 (34%), Positives = 50/90 (55%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T  L  TL+ H+  +  +A        ++S SRD+TL +W L  D  N    +  L  H
Sbjct: 148 DTENLENTLKNHSYSINILAVTTD-SKKVISGSRDQTLKIWDL--DTENL---ENTLKNH 201

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+ I+ + +++D    +SGS DKTL++WDL
Sbjct: 202 SYSINILAVTTDSKKVISGSDDKTLKIWDL 231



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 31/102 (30%), Positives = 53/102 (51%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T  L  TL+ H+  +  +A        ++S SRD+TL +W L  D  N    +  L  HS
Sbjct: 107 TGNLENTLKNHSYSINILAVTTD-SKKVISGSRDQTLKIWDL--DTENL---ENTLKNHS 160

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + I+ + +++D    +SGS D+TL++WDL         ++H+
Sbjct: 161 YSINILAVTTDSKKVISGSRDQTLKIWDLDTENLENTLKNHS 202



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 31/96 (32%), Positives = 49/96 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+  V  +A  P    +I S S D T+ VW L       G  +  L  HS+ I+ +
Sbjct: 71  TLTGHSLAVGAVAVTPDGKKLI-SGSCDGTIKVWDLAT-----GNLENTLKNHSYSINIL 124

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +++D    +SGS D+TL++WDL         ++H+
Sbjct: 125 AVTTDSKKVISGSRDQTLKIWDLDTENLENTLKNHS 160



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + L GHS  +  V ++ DG   +SGS D T+++WDLA G      ++H+
Sbjct: 70  RTLTGHSLAVGAVAVTPDGKKLISGSCDGTIKVWDLATGNLENTLKNHS 118


>UniRef50_A0YUH5 Cluster: WD-repeat protein; n=1; Lyngbya sp. PCC
           8106|Rep: WD-repeat protein - Lyngbya sp. PCC 8106
          Length = 815

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/87 (35%), Positives = 47/87 (54%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  TL GH G +  +A +P    +I S+S+D+T+ +W L   E         L GH+
Sbjct: 733 TGQLLNTLTGHTGDILAVAISPDN-QVIASASKDRTIKIWNLETGEL-----LNTLSGHT 786

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +  V  S DG    SGS D+T++LW
Sbjct: 787 NEVYTVTFSPDGKTIASGSKDRTIKLW 813



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 28/92 (30%), Positives = 45/92 (48%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   V  +A N +   ++ S S+D T+ +  L       GI Q  L GH+  +  V ++ 
Sbjct: 659 HTDIVYSVAFNTEGTKLV-SGSKDTTIKIMDLET-----GIVQNTLEGHTDEVRSVAITY 712

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           DG   +SG +D T+R+WD+  G+       HT
Sbjct: 713 DGTKVVSGGYDDTVRIWDVNTGQLLNTLTGHT 744



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/103 (29%), Positives = 46/103 (44%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET  ++ TL GH   V  +A        ++S   D T+ +W +     N G     L GH
Sbjct: 690 ETGIVQNTLEGHTDEVRSVAITYD-GTKVVSGGYDDTVRIWDV-----NTGQLLNTLTGH 743

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  I  V +S D     S S D+T+++W+L  G+       HT
Sbjct: 744 TGDILAVAISPDNQVIASASKDRTIKIWNLETGELLNTLSGHT 786



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 16/46 (34%), Positives = 22/46 (47%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           H   +  V  S D     SGS D+++R+WD   G     F DHT +
Sbjct: 617 HQGTVWSVAFSPDERTIASGSGDRSVRVWDRQTGYILFNFIDHTDI 662



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           H   +S V  S DG    SGS D+T+++WD   G   + F
Sbjct: 534 HLGSVSAVAFSPDGRTIASGSRDQTVKVWDARTGALLQNF 573


>UniRef50_Q013I4 Cluster: PRL1; n=3; Viridiplantae|Rep: PRL1 -
           Ostreococcus tauri
          Length = 506

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/99 (31%), Positives = 47/99 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  +A +P+     ++ S D+T+ VW L       G  +  L GH   
Sbjct: 185 KLYRVISGHQGWVRSVAVDPENK-WFVTGSADRTIKVWDLAS-----GGLKLTLTGHIEQ 238

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ +V+S    Y  S   DK ++ WDL   K  R +  H
Sbjct: 239 VTGLVVSPRHPYMFSCGLDKKVKCWDLEYNKVIRNYHGH 277



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 28/94 (29%), Positives = 45/94 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  IA +P   D++ +  RD    VW +   +  Y      L GH + +  ++  
Sbjct: 276 GHLSGVYSIAMHPTL-DLLFTGGRDSACRVWDIRTKQQVYC-----LTGHDNTVGSILAQ 329

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            +    ++GS+D T+R+WDLA GK+      H K
Sbjct: 330 DENPQLVTGSYDGTIRMWDLAMGKSINTLTHHKK 363



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 23/86 (26%), Positives = 38/86 (44%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   VT +  +P++P M  S   DK +  W L      Y    +  +GH   +
Sbjct: 228 LKLTLTGHIEQVTGLVVSPRHPYMF-SCGLDKKVKCWDL-----EYNKVIRNYHGHLSGV 281

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
             + +    +   +G  D   R+WD+
Sbjct: 282 YSIAMHPTLDLLFTGGRDSACRVWDI 307


>UniRef50_Q5CG32 Cluster: Notchless; n=2; Cryptosporidium|Rep:
           Notchless - Cryptosporidium hominis
          Length = 535

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/68 (39%), Positives = 37/68 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + +LS S D T+ +W    +      P  RL GH   ++ V  S DG Y  S S+DKT+R
Sbjct: 390 ERLLSGSDDNTMFLWDPLGENGRK--PIHRLTGHLKVVNHVAFSPDGRYIASASFDKTIR 447

Query: 305 LWDLAAGK 328
           LWD  +GK
Sbjct: 448 LWDGHSGK 455



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 1/111 (0%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           PF  +  T +   +L+GH   V   + +P   +++ + S D T+ +W L  +      P+
Sbjct: 122 PFKILPAT-RCTSSLQGHKDAVLCCSFSPD-SNLLATGSGDTTVRLWDLLTET-----PE 174

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG-KTTRRFEDHTK 358
             L GH +++  +  S D     S   D  + +W+ + G K  R+ + H+K
Sbjct: 175 MCLKGHLNWVLTLAWSPDSTLLASAGMDNAICIWNPSKGDKVFRKLKGHSK 225



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 95  TQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNY 271
           T+  +N  Y   ++S+S+D TL +W +T      G     L  H+  I+ V  +  +  Y
Sbjct: 254 TESGSNNLYFPKLISASKDFTLKIWNITT-----GTIINTLSSHTEMITHVKWTGINQEY 308

Query: 272 ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S S D  +++W+   G+  R  + H
Sbjct: 309 VVSSSRDTLIKVWNPETGQLLRDLKGH 335



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 25/85 (29%), Positives = 42/85 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K    LRGH G V  ++ +     +I S+S D T+ VW ++  +    +P     GH+  
Sbjct: 455 KFIAVLRGHVGPVYMVSWSVD-SRLIASASSDSTVKVWHVSSKKLKEDLP-----GHADE 508

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLW 310
           +  +  S DG+   SGS D  +++W
Sbjct: 509 VYTIDWSIDGSRLSSGSKDCIVKIW 533



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 18/65 (27%), Positives = 32/65 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H   +T +       + ++SSSRD  + VW         G   + L GH+H+++ +
Sbjct: 288 TLSSHTEMITHVKWTGINQEYVVSSSRDTLIKVW-----NPETGQLLRDLKGHAHWVNTL 342

Query: 248 VLSSD 262
            L++D
Sbjct: 343 ALNTD 347


>UniRef50_Q4DSS0 Cluster: Putative uncharacterized protein; n=4;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 1349

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDV 247
           L GH    + ++ NP  P+ +LS S D TL +W L +   +   +  + L GH++ ++ +
Sbjct: 574 LTGHMDAASSVSYNPTVPNFLLSCSHDTTLRLWDLYSGASHTASVSCRVLRGHTNSVNAI 633

Query: 248 VLSSDGNY-ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              S   Y ALS S D T+RLWD+  G        H
Sbjct: 634 AWCSIAPYIALSASSDCTVRLWDVRGGSNLATVRAH 669



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           T+R HN  V  ++T+P+ P +  S S D ++I W L
Sbjct: 665 TVRAHNAEVIALSTHPERPLVFASVSHDNSIIFWHL 700


>UniRef50_A0DSM3 Cluster: Chromosome undetermined scaffold_618,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_618,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 513

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/93 (29%), Positives = 49/93 (52%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P+  D++ S SRD ++ +W     +  +     +L GH++ +  V  S
Sbjct: 191 GHTRGVLSVCFSPE-GDILASGSRDMSIRLWDFKAKKQQF-----KLDGHTNSVWSVCFS 244

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG +  SGS D ++RLW++  G   ++ + HT
Sbjct: 245 PDGTFLASGSVDNSIRLWNVKTGFEKQKLDGHT 277



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 21/54 (38%), Positives = 34/54 (62%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           G  Q +LYGH+  I+ +  S +G   +SGS DK++R+WD   G+   +F+ HT+
Sbjct: 141 GQQQDKLYGHTSIINSICFSPNGTILVSGSDDKSIRIWDFNTGQQILQFDGHTR 194



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 27/93 (29%), Positives = 45/93 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +L+  L GH   V  +  +P    ++ S S DK++ +W +       G  + +L  H
Sbjct: 299 KTGQLKTKLSGHTNCVNSVCYSPDGTSLV-SGSVDKSIRLWNVKT-----GQLKSKLNVH 352

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           S  ++ V  S DG    SGS D ++ LW+   G
Sbjct: 353 SDSVNSVCFSPDGTSLASGSADNSILLWNFKTG 385



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L GH++ ++ V  S DG   +SGS DK++RLW++  G+   +   H+
Sbjct: 306 KLSGHTNCVNSVCYSPDGTSLVSGSVDKSIRLWNVKTGQLKSKLNVHS 353



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 22/90 (24%), Positives = 41/90 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T +L+  L  H+  V  +  +P    +  S S D ++++W         G  + +LYG 
Sbjct: 341 KTGQLKSKLNVHSDSVNSVCFSPDGTSLA-SGSADNSILLWNFKT-----GHLKSKLYGS 394

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S+ I+ V  S  G      + D ++  WD+
Sbjct: 395 SNCINSVCFSPMGTTIAFCNDDTSINFWDI 424


>UniRef50_A0D9H6 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 479

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 24/63 (38%), Positives = 41/63 (65%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S+S D+TL++W+ T  +     P+ R+ GH   ++ V  S DG Y +S S+DK+LR
Sbjct: 336 ERLVSASDDQTLMLWEYTSSK-----PKVRMTGHQQQVNHVQFSPDGRYIVSASFDKSLR 390

Query: 305 LWD 313
           +WD
Sbjct: 391 IWD 393



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 32/86 (37%), Positives = 41/86 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V  +  +P     I+S+S DK+L +W    D  N G     L GH   +  V 
Sbjct: 361 MTGHQQQVNHVQFSPD-GRYIVSASFDKSLRIW----DGYN-GNWIATLRGHVGSVYQVS 414

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            SSD  Y LS S D TL+LW L   K
Sbjct: 415 WSSDSRYMLSASKDSTLKLWSLQKKK 440



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 5/107 (4%)
 Frame = +2

Query: 47  ETLKLRGT-LRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQK 211
           ET +L+G  L GH  WVT IA  P + D    ++ SSS+D ++ +W  +R   +  I   
Sbjct: 192 ETNQLKGQPLIGHTKWVTSIAWQPMHLDEECTLVASSSKDGSVRIW--SRISLSCLI--- 246

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  H   I+ ++    G Y  + S D T+ +W+  +GK  +  + H
Sbjct: 247 SINAHQKAITKMLWGGQG-YIYTASEDTTIGVWN-KSGKRVQELKGH 291



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH G V Q++ +     M LS+S+D TL +W L + +  + +P     GH+  +  V
Sbjct: 402 TLRGHVGSVYQVSWSSDSRYM-LSASKDSTLKLWSLQKKKLAFDLP-----GHADEVYAV 455

Query: 248 VLSS-DGNYALSGSWDKTLRLW 310
             +   G  A SG  D+ +++W
Sbjct: 456 DWAPIGGEKAGSGGKDRRVKIW 477



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 5/86 (5%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH  WV  +A +P     I S S D  + +W +  ++    +  + L GH+ +++ +
Sbjct: 157 TLKGHKNWVLCLAWSPDC-KYIASGSHDGQVCIWDVETNQ----LKGQPLIGHTKWVTSI 211

Query: 248 V-----LSSDGNYALSGSWDKTLRLW 310
                 L  +     S S D ++R+W
Sbjct: 212 AWQPMHLDEECTLVASSSKDGSVRIW 237



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D++ + S D T+ +W +  +      P   L GH +++  +  S D  Y  SGS D  + 
Sbjct: 133 DVLATGSGDTTIRLWDMLTET-----PIATLKGHKNWVLCLAWSPDCKYIASGSHDGQVC 187

Query: 305 LWDL 316
           +WD+
Sbjct: 188 IWDV 191


>UniRef50_A0CQ30 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_24,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 501

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 33/99 (33%), Positives = 47/99 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH+GWV  IA +P     +  SS D+T+  W L       G  +    GH   
Sbjct: 182 KLMRVISGHHGWVRCIAVDPGNQFFVTGSS-DRTIKFWDLAT-----GNLKLTFTGHIST 235

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           I  V++S+   Y  S + DKT++ WDL   K  R +  H
Sbjct: 236 IRSVIVSARHPYLFSCAEDKTVKCWDLEQNKMIRDYHGH 274



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/104 (25%), Positives = 47/104 (45%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+     GH   V  +A +P   D+++S  RD    VW +   +  +      L GH
Sbjct: 263 EQNKMIRDYHGHLSGVYSLALHPTL-DVLVSGGRDSVCRVWDIRARQQIHV-----LEGH 316

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ I  ++        +SGS D  +++WD+ +GK      +H K
Sbjct: 317 TNTIDSIICQEFEPQIVSGSQDSMIKMWDMTSGKCISTLTNHKK 360



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 5/89 (5%)
 Frame = +2

Query: 101 IATNPKYPDM-ILSSSRDKTLIVWKLTRD-ENNYGIPQKRLY---GHSHFISDVVLSSDG 265
           +A NP    + ++  +R  T++V K+ +  +  +  P K +    GH  ++  + +    
Sbjct: 144 VAVNPNEHQLSVIEPARLGTVMVQKIKKIIKPEWHAPWKLMRVISGHHGWVRCIAVDPGN 203

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + ++GS D+T++ WDLA G     F  H
Sbjct: 204 QFFVTGSSDRTIKFWDLATGNLKLTFTGH 232


>UniRef50_A0BC62 Cluster: Chromosome undetermined scaffold_1, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_1,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 481

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/95 (30%), Positives = 48/95 (50%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+GWV  +  +P     + S S D ++ +W +       G+ + +L GH   +  V 
Sbjct: 123 LYGHSGWVYSVNFSPD-STTLASGSDDNSINLWDVKT-----GLQKDKLVGHLERVWSVN 176

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG    SGS DK++RLWD+   +   + + H+
Sbjct: 177 FSPDGTTLASGSADKSIRLWDVKTRQQKAKLDGHS 211



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 28/95 (29%), Positives = 47/95 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  V  +  +P   +++ S S DK++  W +       G  + +L GH   +  + 
Sbjct: 39  LDGHSETVMSVNFSPT-GNILASGSADKSIRFWDIKT-----GQQKCKLDGHLGIVYSIN 92

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DGN   SGS DK++ LWD+  G+   +   H+
Sbjct: 93  FSPDGNILASGSDDKSIHLWDVKTGQQIAKLYGHS 127



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           + S S DK++ +W + TR +      + +L GHSH +  V  S DG    SGS D T+RL
Sbjct: 184 LASGSADKSIRLWDVKTRQQ------KAKLDGHSHCVISVNFSPDGATLASGSVDNTIRL 237

Query: 308 WDLAAGKTTRRFEDHT 355
           WD+   +   + + H+
Sbjct: 238 WDIKTRQKIAKLDGHS 253



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 30/94 (31%), Positives = 45/94 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V  I  +P   +++ S S DK++ +W +       G    +LYGHS ++  V 
Sbjct: 81  LDGHLGIVYSINFSPD-GNILASGSDDKSIHLWDVKT-----GQQIAKLYGHSGWVYSVN 134

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S D     SGS D ++ LWD+  G    +   H
Sbjct: 135 FSPDSTTLASGSDDNSINLWDVKTGLQKDKLVGH 168



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L GHS  +  V  S  GN   SGS DK++R WD+  G+   + + H
Sbjct: 38  KLDGHSETVMSVNFSPTGNILASGSADKSIRFWDIKTGQQKCKLDGH 84


>UniRef50_A7F6N8 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 420

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 35/104 (33%), Positives = 52/104 (50%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           ++T K   T+ GH   V+ IA +P   + I S S DK + +W     +  Y  P   L G
Sbjct: 150 AQTGKHLRTMEGHLAGVSTIAWSPD-SNTIASGSDDKVIRLWDRATGKP-YLTP---LLG 204

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H +++  V  S  GN   SGS+D+ + LWDL A +  R    H+
Sbjct: 205 HHNYVYSVAFSPKGNVIASGSYDEAVFLWDLRARRQMRSLPAHS 248



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH   ++ V  S +G +  S S D T+++WD   GK  R  E H
Sbjct: 117 LRGHRKGVAQVRYSPNGRWIASCSADGTIKIWDAQTGKHLRTMEGH 162


>UniRef50_Q9NDC9 Cluster: Lissencephaly-1 homolog; n=4;
           Eukaryota|Rep: Lissencephaly-1 homolog - Caenorhabditis
           elegans
          Length = 404

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 32/102 (31%), Positives = 49/102 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  TL+GH   V  IA +     ++ S S D ++ +W   +  +      K L GH
Sbjct: 136 ETGQLERTLKGHTDAVNDIAIDAAGKQLV-SCSSDLSIKLWDFGQTYDCL----KSLKGH 190

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G++ LS S D T++ WD++ G     F  H
Sbjct: 191 EHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGH 232



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  WV  +A +PK    ++S + DKTL VW+L+          K +  H HF+S V
Sbjct: 327 TLLAHENWVRGLAFHPK-GKYLISVADDKTLRVWELSAQRC-----MKAIEAHEHFVSTV 380

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  + ++GS D + ++W+
Sbjct: 381 AFHQTSPFVITGSVDMSCKVWE 402



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/95 (29%), Positives = 47/95 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L+GH   V+ +   P   D +LS+SRD T+  W ++     Y +   R  GH+ ++  +
Sbjct: 186 SLKGHEHTVSSVTFLPT-GDFVLSASRDHTIKQWDIS---TGYCVYTFR--GHNDWVRMI 239

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +S+DG    S S D+T+ +W  A         DH
Sbjct: 240 RISNDGTLFASASLDQTVTVWSFATKSAKLVLRDH 274



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ S SRD+++  W +     N G     L  H +++  +     G Y +S + DKTLR+
Sbjct: 304 ILFSGSRDRSIKAWNI-----NTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRV 358

Query: 308 WDLAAGKTTRRFEDH 352
           W+L+A +  +  E H
Sbjct: 359 WELSAQRCMKAIEAH 373


>UniRef50_UPI0000D5607F Cluster: PREDICTED: similar to Katanin p80
           WD40-containing subunit B1 (Katanin p80 subunit B1) (p80
           katanin), partial; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to Katanin p80 WD40-containing
           subunit B1 (Katanin p80 subunit B1) (p80 katanin),
           partial - Tribolium castaneum
          Length = 777

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/102 (31%), Positives = 49/102 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  KL  TL GH   +  +  +P Y D + S S D ++ +W   +    Y        GH
Sbjct: 79  EAAKLVRTLNGHKSALKCVDFHP-YGDFLASGSSDCSIKMWDSRKKGCIY-----TYNGH 132

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              I+ +  S DG++  SG  D T+++WDL  GK  + F +H
Sbjct: 133 KATINSLKFSPDGHWIASGGDDATVKIWDLRVGKVLKDFGEH 174


>UniRef50_Q8YN14 Cluster: WD-repeat protein; n=2; Nostocaceae|Rep:
           WD-repeat protein - Anabaena sp. (strain PCC 7120)
          Length = 589

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/102 (28%), Positives = 48/102 (47%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T +L  T++GH G +  +A +P   +   +   DK + +W L   E  + I +     H 
Sbjct: 418 TGQLLRTIKGHQGRIFSVAMSPD-GETFATGGIDKKIKIWNLYTGECLHTITE-----HQ 471

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +  +V S DG    S SWDK++++W +  GK       HT
Sbjct: 472 DTVRALVFSRDGKMLASSSWDKSIKIWQMPTGKLLHTLLGHT 513



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/102 (29%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K+  TL+GH   V  IA  P     ++S S DKT+ +W L R        ++ L  H
Sbjct: 333 ETAKVTTTLQGHTDTVRAIALTPD-DQTLISGSADKTIKIWNLQRLRI-----KRTLSSH 386

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  I  + +SSDG   ++   + ++++W+   G+  R  + H
Sbjct: 387 AGGIWSLAISSDGQTLVTAHENGSIQIWNFPTGQLLRTIKGH 428



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 30/98 (30%), Positives = 47/98 (47%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL GH   V  +A   K    ++S+S D+T+ VW L   +         L GH+  +
Sbjct: 295 LTNTLFGHTDSVWSVALT-KDGQTLVSASEDQTIKVWNLETAKVT-----TTLQGHTDTV 348

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + L+ D    +SGS DKT+++W+L   +  R    H
Sbjct: 349 RAIALTPDDQTLISGSADKTIKIWNLQRLRIKRTLSSH 386



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           L+GH+  +  V L+ DG   +S S D+T+++W+L   K T   + HT
Sbjct: 299 LFGHTDSVWSVALTKDGQTLVSASEDQTIKVWNLETAKVTTTLQGHT 345



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           M+ SSS DK++ +W++       G     L GH+  +  + L  D    +SGS D  L++
Sbjct: 485 MLASSSWDKSIKIWQMPT-----GKLLHTLLGHTSRVVTLNLGIDEQTLVSGSLDNKLKI 539

Query: 308 WDLAAGKTTRRFEDHT 355
           WD+  GK       HT
Sbjct: 540 WDMQTGKLLDTISGHT 555



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWK 172
           +T KL  T+ GH  W+  IA NP    +++SS++DKT+ VW+
Sbjct: 543 QTGKLLDTISGHTDWILAIAANPA-KQILVSSAKDKTIRVWQ 583


>UniRef50_Q7NMP0 Cluster: WD-40 repeat protein; n=1; Gloeobacter
            violaceus|Rep: WD-40 repeat protein - Gloeobacter
            violaceus
          Length = 1671

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/87 (33%), Positives = 45/87 (51%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            +LR  +RGHN  +  +  +P    ++ S+S+DKT+ +W      N  G   + L GH   
Sbjct: 1134 ELRTVIRGHNATIWSLRFSPD-SKLLASASQDKTVRLW------NRNGKILRTLMGHQDE 1186

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDL 316
            +  V  S DG    S SWD T+R+W +
Sbjct: 1187 VMSVDFSPDGQTLASASWDGTVRMWGI 1213



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 30/89 (33%), Positives = 46/89 (51%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
            S+T  L  TLRGH   +T +  +P    +++S+SRD TL  W +       G   K +  
Sbjct: 1499 SQTGTLLRTLRGHPDLITDLTFSPDN-QVLVSASRDGTLRYWTIA------GQLLKTINA 1551

Query: 224  HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            HS+ ++ +  S+DG    S   D T+RLW
Sbjct: 1552 HSNRVTSIDFSADGKTVASAGADGTVRLW 1580



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 29/85 (34%), Positives = 41/85 (48%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  +L GH G V  +  +     ++ S+S DKTL++W+L      YG P     GH  ++
Sbjct: 1299 LLSSLHGHTGRVNSLDFSAD-GRILASASDDKTLLLWRL------YGPPLTAFRGHGQWV 1351

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWD 313
            S V  S D     +   D TL LWD
Sbjct: 1352 SCVGFSPDSQAFATAGGDGTLDLWD 1376



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/35 (57%), Positives = 22/35 (62%)
 Frame = +2

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            RL GHS FIS V  SS      S SWD+T+RLW L
Sbjct: 1056 RLEGHSDFISQVSFSSSRKLMASASWDRTIRLWQL 1090



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 23/80 (28%), Positives = 45/80 (56%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L GH+ +++Q++ +     ++ S+S D+T+ +W+L       G+P K L GH++ I+ + 
Sbjct: 1057 LEGHSDFISQVSFSSSRK-LMASASWDRTIRLWQLD------GMPIKILKGHANNITSIC 1109

Query: 251  LSSDGNYALSGSWDKTLRLW 310
             S DG +  S     ++ LW
Sbjct: 1110 FSPDGEFMASADDRGSIYLW 1129



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 25/75 (33%), Positives = 37/75 (49%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            ++ S S DKT+ +W      +  G+    L+GH+  ++ +  S+DG    S S DKTL L
Sbjct: 1280 ILASGSVDKTVRLW------SREGVLLSSLHGHTGRVNSLDFSADGRILASASDDKTLLL 1333

Query: 308  WDLAAGKTTRRFEDH 352
            W L  G     F  H
Sbjct: 1334 WRL-YGPPLTAFRGH 1347



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 32/100 (32%), Positives = 44/100 (44%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            K+  TL GH   V  +  +P     + S+S D T+ +W +    N   I    L  H   
Sbjct: 1175 KILRTLMGHQDEVMSVDFSPD-GQTLASASWDGTVRMWGI--QGNLISI----LKEHKDG 1227

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            I  V  S DG    S   DKTLRLW++  G+      D+T
Sbjct: 1228 IWSVAFSPDGQRLASAGQDKTLRLWNV-HGQLLHTLSDNT 1266



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/69 (31%), Positives = 33/69 (47%)
 Frame = +2

Query: 149  DKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            D+T+ +W  T      G   + L GH   I+D+  S D    +S S D TLR W + AG+
Sbjct: 1492 DRTIRIWSQT------GTLLRTLRGHPDLITDLTFSPDNQVLVSASRDGTLRYWTI-AGQ 1544

Query: 329  TTRRFEDHT 355
              +    H+
Sbjct: 1545 LLKTINAHS 1553



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 26/80 (32%), Positives = 39/80 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+ H   +  +A +P     + S+ +DKTL +W      N +G     L  ++     V 
Sbjct: 1221 LKEHKDGIWSVAFSPD-GQRLASAGQDKTLRLW------NVHGQLLHTLSDNTTPFLSVR 1273

Query: 251  LSSDGNYALSGSWDKTLRLW 310
             S DG+   SGS DKT+RLW
Sbjct: 1274 FSPDGSILASGSVDKTVRLW 1293



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 22/79 (27%), Positives = 34/79 (43%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
            RGH  WV+ +  +P       ++  D TL +W       N  IP   ++  ++       
Sbjct: 1345 RGHGQWVSCVGFSPD-SQAFATAGGDGTLDLWDRQGRLENRVIPPATIFALAY------- 1396

Query: 254  SSDGNYALSGSWDKTLRLW 310
            S DG    SG  D+ +RLW
Sbjct: 1397 SPDGTIIASGGNDRAVRLW 1415


>UniRef50_A4TDV7 Cluster: WD-40 repeat protein; n=1; Mycobacterium
            gilvum PYR-GCK|Rep: WD-40 repeat protein - Mycobacterium
            gilvum PYR-GCK
          Length = 1399

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/87 (36%), Positives = 47/87 (54%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL GH   V ++  NP    +++S+S D T+  W     E+  G P   L GH+  + D+
Sbjct: 1237 TLEGHTNRVGRLVFNPD-GSLLVSASDDTTVRRWNPATGES-VGGP---LAGHTDEVLDL 1291

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGK 328
              S DG   ++GS D T RLWD+A G+
Sbjct: 1292 AFSPDGTRLVTGSADTTARLWDVATGR 1318



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +2

Query: 221  GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            GH  ++S++  S DG   LSGS D TL++WD  AG
Sbjct: 907  GHQGYVSELAFSPDGALLLSGSEDGTLQMWDAEAG 941



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 27/85 (31%), Positives = 40/85 (47%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L   + GH G +  +  +P     I S+S D T+ +W      N  G   + L GH+  +
Sbjct: 1027 LWNVMYGHEGRIWGLVYSPDGRH-IASASSDGTVRIW------NPLG--SQPLLGHTAAV 1077

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWD 313
             D+  S DG +  S   D T+RLWD
Sbjct: 1078 RDLSYSPDGEFMASAGEDGTVRLWD 1102



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 24/80 (30%), Positives = 37/80 (46%)
 Frame = +2

Query: 86   GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
            G V  +A  P     + S +   ++I+W  T+     G P   L GH + ++ V  S D 
Sbjct: 952  GMVADVAFRPDGRRFVSSGN---SVILWD-TQTRKPIGDP---LQGHVNAVTTVSFSPDS 1004

Query: 266  NYALSGSWDKTLRLWDLAAG 325
                +GS D T+R+WD   G
Sbjct: 1005 QVLATGSADATVRVWDADTG 1024



 Score = 33.1 bits (72), Expect = 5.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
            L GH++ +  +V + DG+  +S S D T+R W+ A G++
Sbjct: 1238 LEGHTNRVGRLVFNPDGSLLVSASDDTTVRRWNPATGES 1276


>UniRef50_A2X2A5 Cluster: Putative uncharacterized protein; n=5;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 841

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH+ +V Q+  NPK  +   S+S D+T+ VW L   + N+      L GHS  ++  D  
Sbjct: 156 GHSHYVMQVTFNPKDTNTFASASLDRTVKVWSLGSPDPNF-----TLDGHSKGVNCVDYF 210

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              D  Y ++GS D+T ++WD       +  E H
Sbjct: 211 TGGDRPYLITGSDDQTAKVWDYQTKSCVQTLEGH 244



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS- 256
           H  ++  +A +P  P  +LSSS D  + +W    D +   +  +   GHSH++  V  + 
Sbjct: 114 HTDYIRCVAVHPTQP-FVLSSSDDMLIKLW----DWDKGWMCTQIFEGHSHYVMQVTFNP 168

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            D N   S S D+T+++W L +       + H+K
Sbjct: 169 KDTNTFASASLDRTVKVWSLGSPDPNFTLDGHSK 202



 Score = 33.5 bits (73), Expect = 4.2
 Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 2/96 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+  V  +   T    P +I  S  D+T  VW    D       Q  L GH+H +S
Sbjct: 196 TLDGHSKGVNCVDYFTGGDRPYLITGSD-DQTAKVW----DYQTKSCVQT-LEGHAHNVS 249

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
            V    +    L+GS D T+RLW      TT R E+
Sbjct: 250 AVCFHPELPITLTGSEDGTVRLWH----STTYRLEN 281


>UniRef50_Q54YD8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1005

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+ +V  IA NPK  +   ++S DKT+ VW +     N   P   L GH   I+ V   
Sbjct: 141 GHSHYVMSIAWNPKDTNQFATASLDKTVKVWSI-----NSPHPHFTLEGHEKGINSVEYF 195

Query: 257 SDGN--YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S G   Y +SG+ DK +++WD  +    +  E H+
Sbjct: 196 SGGEKPYLISGADDKLVKIWDYQSKTCVQTLEGHS 230



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 1/104 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T++   +   H  ++  I  +P  P  ILSSS D  + +W   +  +N  + +    GHS
Sbjct: 89  TMEKIKSFEAHADYIRCIIVHPTLP-YILSSSDDMFIKLWDYEKGWSNTQVFE----GHS 143

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++  +  +  D N   + S DKT+++W + +       E H K
Sbjct: 144 HYVMSIAWNPKDTNQFATASLDKTVKVWSINSPHPHFTLEGHEK 187


>UniRef50_Q22D06 Cluster: Putative uncharacterized protein; n=4;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 2897

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/104 (29%), Positives = 57/104 (54%), Gaps = 3/104 (2%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            +L+ T++ H G ++ +A   + KY   + + S DKT  +W +   E  + +  K + G +
Sbjct: 1744 QLQNTIKEHKGSISSVAFSVDNKY---LATGSEDKTCSIWNV---EKGFDLLNK-IEGET 1796

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG-KTTRRFEDHTK 358
             +I+ V  S+DG Y  +GS DKT ++W +  G +   + E HT+
Sbjct: 1797 SWITSVAFSADGKYVATGSQDKTCKVWKVDKGFELFTKIEGHTE 1840



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            +L  T+ GH   +  +A   + KY   ++S S DKT  +W +   E  + +      GH+
Sbjct: 2044 ELFNTILGHTSLINSVAFSADSKY---LVSGSDDKTCKIWNI---EKGFEVIYSN-EGHT 2096

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDLAAG-KTTRRFEDHT 355
              I  +  S+DG Y  +GSWD T ++W++  G +     E HT
Sbjct: 2097 ECIYSIDFSADGKYVATGSWDSTCKIWNIEKGYELINTIEGHT 2139



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = +2

Query: 38   KMSETLKLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
            K+ +  +L   + GH   +T +A  ++ KY   + +SSRD T  +W   +D       ++
Sbjct: 1824 KVDKGFELFTKIEGHTEKITSVAFSSDRKY---LATSSRDNTCKIWNAQKDFELISTIKE 1880

Query: 212  RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
                H   I+ V  SSD  Y  + S D T ++WD+  G
Sbjct: 1881 ----HQKAINQVAFSSDSKYLATASSDFTCKIWDIQKG 1914



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 3/90 (3%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRD-ENNYGIPQKRLYGH 226
            +L  T+ GH   + Q+A  TN KY   + + S D T  +W + +  E    I Q     H
Sbjct: 2130 ELINTIEGHTSNIRQVAFSTNGKY---LATGSDDNTCKIWNVHKGFELIITIEQ-----H 2181

Query: 227  SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
            S  ++ V  S DG Y   GS DKT  +W++
Sbjct: 2182 SESVNSVAFSPDGQYLAIGSQDKTCSIWEV 2211



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +2

Query: 41   MSETLKLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR 214
            + +  +L   + GH+  +  +A   + KY   + + S D T  +W +   +N + +  K 
Sbjct: 2428 LEKGFELTNKIVGHDKTIQSVAFSADDKY---LATGSDDTTCKIWNV---KNGFELVNK- 2480

Query: 215  LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            + GH+  I  V  S+D  Y  + S DKT ++W+L  G
Sbjct: 2481 IEGHNSSILSVAFSADSKYLATASLDKTCKIWNLQNG 2517



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 2/89 (2%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIA--TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
            +L  T++ H   + Q+A  ++ KY   + ++S D T  +W + +      +    + GH 
Sbjct: 1873 ELISTIKEHQKAINQVAFSSDSKY---LATASSDFTCKIWDIQKGF----LLINSIEGHD 1925

Query: 230  HFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              I  V  S +G Y  +GS+D T ++WD+
Sbjct: 1926 RAIQSVAFSPNGKYLATGSFDSTCKIWDV 1954



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            + + S DK   +W L   EN + +      GH+  +S V  SSDG +  +GS D T ++W
Sbjct: 1681 LATCSDDKKCQIWNL---ENGFELINTIETGHTKALSSVSFSSDGKFLATGSLDTTCKIW 1737

Query: 311  DLAAG 325
             +  G
Sbjct: 1738 VVENG 1742



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = +2

Query: 59   LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
            L  ++ GH+  +  +A +P     + + S D T  +W + ++       ++R   +S   
Sbjct: 1917 LINSIEGHDRAIQSVAFSPN-GKYLATGSFDSTCKIWDVEKEFQIVITIEERKTVYS--- 1972

Query: 239  SDVVLSSDGNYALSGSWDKTLRLWDLAAG-KTTRRFEDH 352
              V  SSDG Y  +GS D T ++W++  G + T + E H
Sbjct: 1973 --VAFSSDGKYIATGSDDNTCKIWNIEKGFEFTNKIEGH 2009



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 20/65 (30%), Positives = 32/65 (49%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            I + S D T  +W +   E  +    K + GH   I+ V  S+DG Y  + S DK  ++W
Sbjct: 1982 IATGSDDNTCKIWNI---EKGFEFTNK-IEGHRDQITSVTFSTDGKYLATSSNDKICKIW 2037

Query: 311  DLAAG 325
            ++  G
Sbjct: 2038 NVEKG 2042



 Score = 36.7 bits (81), Expect = 0.45
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            + + S D T  +W +   E  Y +    + GH+  I  V  S++G Y  +GS D T ++W
Sbjct: 2111 VATGSWDSTCKIWNI---EKGYELINT-IEGHTSNIRQVAFSTNGKYLATGSDDNTCKIW 2166

Query: 311  DLAAG 325
            ++  G
Sbjct: 2167 NVHKG 2171



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 16/61 (26%), Positives = 30/61 (49%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            L++   K   +W +   +N + +  K   GH+  +     +SD  Y  +GS DKT ++W 
Sbjct: 2285 LATFSQKNGCIWDM---QNGFELINKIETGHTDNVYSAAFTSDSKYLTTGSRDKTCKIWS 2341

Query: 314  L 316
            +
Sbjct: 2342 V 2342


>UniRef50_A2G3K8 Cluster: WD repeat protein, putative; n=2;
           Trichomonas vaginalis G3|Rep: WD repeat protein,
           putative - Trichomonas vaginalis G3
          Length = 429

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDVVL 253
           GH   V     N  Y  ++ + S DKT  +W +  ++  Y +  Q    GH+  +  V  
Sbjct: 134 GHTLPVYSCCFNNPYGTLVATGSFDKTAAIWSVAENKLVYRLGGQSSTDGHTKEVVTVAF 193

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             D  Y  +GS D   ++WD+  G+  +  E+HT
Sbjct: 194 DPDSQYVATGSMDSKAKIWDVQTGQLLQSLEEHT 227



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 29/94 (30%), Positives = 41/94 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   V  +A +      + SSS DKT  VW  T  E    I +    GH+  +  V 
Sbjct: 307 LKGHTSEVVAVAYSLD-GSKVASSSIDKTARVWSTTTGEC-IAICE----GHTDEVGKVT 360

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  G   L+ S D T R+WD+  G+       H
Sbjct: 361 FNPQGTKVLTASDDFTCRIWDVNTGRELECLSGH 394



 Score = 39.1 bits (87), Expect = 0.085
 Identities = 29/95 (30%), Positives = 41/95 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH         N    + I++ S D T+ VW + +      +    L GH+  +  V 
Sbjct: 265 LRGHKRETCAAYFNSAGTN-IVTGSLDSTVRVWDVRQ-----ALAIHVLKGHTSEVVAVA 318

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            S DG+   S S DKT R+W    G+     E HT
Sbjct: 319 YSLDGSKVASSSIDKTARVWSTTTGECIAICEGHT 353



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 21/78 (26%), Positives = 38/78 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V ++  NP+    +L++S D T  +W +     N G   + L GH  +++    +
Sbjct: 351 GHTDEVGKVTFNPQ-GTKVLTASDDFTCRIWDV-----NTGRELECLSGHQDYVTTCAFN 404

Query: 257 SDGNYALSGSWDKTLRLW 310
             G+  ++ S D T+R W
Sbjct: 405 YSGDRIITASKDNTVREW 422



 Score = 32.3 bits (70), Expect = 9.8
 Identities = 24/94 (25%), Positives = 36/94 (38%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P     + + S D    +W +       G   + L  H+  I  V   
Sbjct: 183 GHTKEVVTVAFDPD-SQYVATGSMDSKAKIWDVQT-----GQLLQSLEEHTGEIVSVQFH 236

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                 L+ S+DKT RLWD+  G        H +
Sbjct: 237 PSEPLLLTSSFDKTARLWDIRTGDCISALRGHKR 270


>UniRef50_Q6PE01 Cluster: WD repeat-containing protein 57; n=16;
           Bilateria|Rep: WD repeat-containing protein 57 - Mus
           musculus (Mouse)
          Length = 358

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 63  LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 117

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 118 YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 152



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 207 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 261

Query: 305 LWDL 316
           +WD+
Sbjct: 262 VWDV 265



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 22/103 (21%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       + P ++ + S D T+ +W + +          + + 
Sbjct: 139 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA------AVQTFQ 192

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 193 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 235



 Score = 35.9 bits (79), Expect = 0.79
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 227 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 285

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +     S DG+   +GS D+ + +WD  + +   +   H
Sbjct: 286 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRVLYKLPGH 327


>UniRef50_Q96DI7 Cluster: WD repeat-containing protein 57; n=47;
           Eukaryota|Rep: WD repeat-containing protein 57 - Homo
           sapiens (Human)
          Length = 357

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 62  LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 117 YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 151



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 206 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 260

Query: 305 LWDL 316
           +WD+
Sbjct: 261 VWDV 264



 Score = 37.1 bits (82), Expect = 0.34
 Identities = 22/103 (21%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       + P ++ + S D T+ +W + +          + + 
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA------AIQTFQ 191

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 192 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 234



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 226 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 284

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +     S DG+   +GS D+ + +WD  + +   +   H
Sbjct: 285 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGH 326


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 584,839,595
Number of Sequences: 1657284
Number of extensions: 11265660
Number of successful extensions: 41616
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 31417
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39477
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46051731393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -