SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8MLT4 Cluster: CG5820-PD, isoform D; n=9; Diptera|Rep:...    83   5e-15
UniRef50_Q17EN3 Cluster: Leucine-rich transmembrane protein; n=1...    74   2e-12
UniRef50_Q9TXJ6 Cluster: Putative uncharacterized protein; n=3; ...    33   5.4  
UniRef50_Q4QEZ6 Cluster: Histone acethyltransferase-like protein...    33   7.1  
UniRef50_Q9I011 Cluster: Thiopurine S-methyltransferase; n=51; B...    33   7.1  
UniRef50_Q112R7 Cluster: Putative uncharacterized protein; n=1; ...    32   9.4  
UniRef50_Q067H0 Cluster: Putative uncharacterized protein; n=1; ...    32   9.4  

>UniRef50_Q8MLT4 Cluster: CG5820-PD, isoform D; n=9; Diptera|Rep:
           CG5820-PD, isoform D - Drosophila melanogaster (Fruit
           fly)
          Length = 1076

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 268 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 327

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 328 TLEYLHAEAFHGLNELY 344


>UniRef50_Q17EN3 Cluster: Leucine-rich transmembrane protein; n=1;
           Aedes aegypti|Rep: Leucine-rich transmembrane protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 945

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 36/77 (46%), Positives = 48/77 (62%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++ TQKF   I DL V +  P+YPI L    F ++GL  V ++KI N 
Sbjct: 222 MHAYLVATCSRLDLDTQKFSTSITDLQVLDVGPKYPIVLSAEFFKQIGLSHVVSIKISNC 281

Query: 562 TIGYIAPNAFHGVHDLY 612
           TI YI+P+AF G+ DLY
Sbjct: 282 TIEYISPSAFAGLDDLY 298


>UniRef50_Q9TXJ6 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 1003

 Score = 33.1 bits (72), Expect = 5.4
 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = -3

Query: 396 SVSPEIQSICSLWDR-ACPRCTKPLGIPRVRNPHIDPISCRR 274
           S+SP  +S  +L DR  C  CT P+ IP VRN H D   C R
Sbjct: 33  SLSPVTRSGINLDDRYTCCVCTSPM-IPAVRNNHCDHYICLR 73


>UniRef50_Q4QEZ6 Cluster: Histone acethyltransferase-like protein;
           n=5; Trypanosomatidae|Rep: Histone
           acethyltransferase-like protein - Leishmania major
          Length = 763

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 23/95 (24%), Positives = 37/95 (38%)
 Frame = +1

Query: 178 TWGQGPGSYYCSWQHARWYSANLSIKPSRKTKTPTTYWINMRITNPRNTKRFCTTRTGPV 357
           TW   P  Y   +    +Y+AN    P R  + P    +  ++ N     +         
Sbjct: 264 TWESYPHPYRERFIRDLFYAANTMFDPPRAPRRPPLDLLQEQLLNESAQCKIIGVTLETR 323

Query: 358 PETAYALYLRGYRQAKCSFLEIGTQKFGDDILDLV 462
           P+T     L   R+  C+ +++G Q   D IL LV
Sbjct: 324 PDTINPEMLVELRRFGCTRVQLGVQHTDDGILTLV 358


>UniRef50_Q9I011 Cluster: Thiopurine S-methyltransferase; n=51;
           Bacteria|Rep: Thiopurine S-methyltransferase -
           Pseudomonas aeruginosa
          Length = 218

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 2/75 (2%)
 Frame = -3

Query: 594 MESIGGDITNRAVHDFYSSNXVKSEFXEHEVV*INRVAGIRVFDHEIKDIIAELL--CTD 421
           +E +G +++ +AV DF+  + +  E  + +     RVAGI +   +   + AE L  C  
Sbjct: 60  LEVLGVELSEKAVSDFFEEHDLHPEIDQLDGFRRYRVAGITLLQGDFFALQAEHLAQCRA 119

Query: 420 FEEAALGLSVSPEIQ 376
           F + A  +++ PE++
Sbjct: 120 FYDRAALIALPPEMR 134


>UniRef50_Q112R7 Cluster: Putative uncharacterized protein; n=1;
           Trichodesmium erythraeum IMS101|Rep: Putative
           uncharacterized protein - Trichodesmium erythraeum
           (strain IMS101)
          Length = 723

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = +1

Query: 157 EVKEFATTWGQGPGSYYCSWQHAR---WYSANLSIKPSRKTKTPTTYW 291
           +++E+  TW Q  G+Y  + ++ R   W+ A  SI+ SR    P  +W
Sbjct: 226 QIQEWQKTWNQAEGNYQQTQEYLREEEWHQA--SIEASRLLSVPNVHW 271


>UniRef50_Q067H0 Cluster: Putative uncharacterized protein; n=1;
           Synechococcus sp. BL107|Rep: Putative uncharacterized
           protein - Synechococcus sp. BL107
          Length = 114

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 3/53 (5%)
 Frame = -3

Query: 426 TDFEEAALGLSVSPEIQSICSLWDRACPRCTKPL---GIPRVRNPHIDPISCR 277
           T+F E A   ++ PE Q + SL   A      PL   GIPRV  P  DP+  R
Sbjct: 62  TNFIEKAFSRNLLPEFQRVPSLKKTALIGSPDPLQLLGIPRVYRPSQDPLPLR 114


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 581,113,867
Number of Sequences: 1657284
Number of extensions: 11252644
Number of successful extensions: 32934
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 31814
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32922
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44392209541
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -