SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P48809 Cluster: Heterogeneous nuclear ribonucleoprotein...   221   1e-56
UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39; Euteleo...   142   4e-33
UniRef50_UPI0000F1F0C3 Cluster: PREDICTED: similar to LOC561459 ...   135   8e-31
UniRef50_Q4SEZ3 Cluster: Chromosome 1 SCAF14609, whole genome sh...   134   2e-30
UniRef50_Q21911 Cluster: Putative uncharacterized protein msi-1;...   126   3e-28
UniRef50_Q9UAF2 Cluster: Musashi; n=1; Halocynthia roretzi|Rep: ...   123   3e-27
UniRef50_Q9U5E3 Cluster: CiMsi; n=1; Ciona intestinalis|Rep: CiM...   123   4e-27
UniRef50_Q9VVE5 Cluster: CG32169-PA; n=9; Endopterygota|Rep: CG3...   122   8e-27
UniRef50_Q8CD63 Cluster: 13 days embryo male testis cDNA, RIKEN ...   120   2e-26
UniRef50_O94432 Cluster: mRNA cleavage factor complex subunit; n...   119   4e-26
UniRef50_O43347 Cluster: RNA-binding protein Musashi homolog 1; ...   116   3e-25
UniRef50_Q4WHA5 Cluster: Heterogeneous nuclear ribonucleoprotein...   115   7e-25
UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11; Magnoliophyt...   114   2e-24
UniRef50_O14979 Cluster: Heterogeneous nuclear ribonucleoprotein...   113   2e-24
UniRef50_A7SSE1 Cluster: Predicted protein; n=3; Nematostella ve...   113   3e-24
UniRef50_Q6CC04 Cluster: Yarrowia lipolytica chromosome C of str...   112   5e-24
UniRef50_Q66IT0 Cluster: MGC84815 protein; n=1; Xenopus laevis|R...   111   2e-23
UniRef50_A7RG33 Cluster: Predicted protein; n=1; Nematostella ve...   110   2e-23
UniRef50_Q9HEH4 Cluster: Related to heterogeneous nuclear ribonu...   110   2e-23
UniRef50_Q9SU99 Cluster: HnRNP-like protein; n=10; core eudicoty...   110   3e-23
UniRef50_Q6PNM9 Cluster: AUF1 similar protein; n=3; Paracentrotu...   109   4e-23
UniRef50_Q7XDI5 Cluster: RNA recognition motif family protein, e...    96   4e-23
UniRef50_Q8MS04 Cluster: RH49436p; n=9; Endopterygota|Rep: RH494...   109   5e-23
UniRef50_Q32LZ4 Cluster: Msi2h protein; n=4; Eutheria|Rep: Msi2h...   109   6e-23
UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1; ...   107   1e-22
UniRef50_A3LZT4 Cluster: Predicted protein; n=1; Pichia stipitis...   106   4e-22
UniRef50_Q1ENZ5 Cluster: RNA-binding protein, putative; n=2; Mag...   105   6e-22
UniRef50_Q86ER1 Cluster: Clone ZZD1516 mRNA sequence; n=2; Schis...   105   6e-22
UniRef50_Q6BL35 Cluster: Debaryomyces hansenii chromosome F of s...   105   8e-22
UniRef50_UPI000023D975 Cluster: hypothetical protein FG10273.1; ...   105   1e-21
UniRef50_Q5TTQ2 Cluster: ENSANGP00000026814; n=3; Endopterygota|...   104   1e-21
UniRef50_Q5DH48 Cluster: SJCHGC06087 protein; n=1; Schistosoma j...   104   1e-21
UniRef50_A4V6K1 Cluster: DAZ-associated protein; n=2; Platyhelmi...   104   1e-21
UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogene...   104   2e-21
UniRef50_A7SCX6 Cluster: Predicted protein; n=1; Nematostella ve...   104   2e-21
UniRef50_A4V6K2 Cluster: PRM10 protein; n=1; Dugesia japonica|Re...   103   4e-21
UniRef50_Q14103 Cluster: Heterogeneous nuclear ribonucleoprotein...   102   5e-21
UniRef50_A7SIF0 Cluster: Predicted protein; n=1; Nematostella ve...   102   7e-21
UniRef50_P48810 Cluster: Heterogeneous nuclear ribonucleoprotein...   101   1e-20
UniRef50_Q8W034 Cluster: Ribonucleoprotein 1; n=5; core eudicoty...   101   2e-20
UniRef50_Q99383 Cluster: Nuclear polyadenylated RNA-binding prot...   100   2e-20
UniRef50_UPI00015560CE Cluster: PREDICTED: similar to heterogene...    99   7e-20
UniRef50_P09651 Cluster: Heterogeneous nuclear ribonucleoprotein...    99   7e-20
UniRef50_Q9LHL2 Cluster: Similarity to RNA binding protein; n=13...    97   4e-19
UniRef50_Q8W4A6 Cluster: Putative uncharacterized protein MJH23....    97   4e-19
UniRef50_Q5K6W6 Cluster: Putative uncharacterized protein; n=1; ...    97   4e-19
UniRef50_P51991 Cluster: Heterogeneous nuclear ribonucleoprotein...    95   8e-19
UniRef50_Q9LNP1 Cluster: F1L3.34; n=2; Arabidopsis thaliana|Rep:...    95   1e-18
UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;...    95   1e-18
UniRef50_Q02926 Cluster: Ribonucleoprotein RB97D; n=7; Sophophor...    95   1e-18
UniRef50_UPI0000E4934F Cluster: PREDICTED: similar to musashi nr...    94   2e-18
UniRef50_UPI0000F2CBBE Cluster: PREDICTED: similar to musashi ho...    93   6e-18
UniRef50_A4R1M8 Cluster: Putative uncharacterized protein; n=1; ...    93   6e-18
UniRef50_Q26658 Cluster: Stage specific activator protein; n=3; ...    92   8e-18
UniRef50_Q4S8N9 Cluster: Chromosome 7 SCAF14703, whole genome sh...    91   1e-17
UniRef50_Q9D3U4 Cluster: Adult male testis cDNA, RIKEN full-leng...    91   1e-17
UniRef50_Q7XI13 Cluster: Glycine-rich RNA-binding protein-like; ...    91   2e-17
UniRef50_A4V6N1 Cluster: HnRNP A2/B1 protein; n=1; Dugesia japon...    90   3e-17
UniRef50_UPI0001560FCC Cluster: PREDICTED: hypothetical protein;...    89   9e-17
UniRef50_UPI0000DB6DF2 Cluster: PREDICTED: similar to squid CG16...    88   1e-16
UniRef50_Q54D98 Cluster: Putative uncharacterized protein; n=1; ...    88   1e-16
UniRef50_A3FQK0 Cluster: RNA recognition motif (RRM)-containing ...    88   1e-16
UniRef50_UPI0000E45D7B Cluster: PREDICTED: similar to heterogene...    88   2e-16
UniRef50_Q9VFT3 Cluster: CG9654-PA; n=4; Drosophila melanogaster...    87   2e-16
UniRef50_Q4UI71 Cluster: RNA-binding (SR) protein, putative; n=2...    87   4e-16
UniRef50_Q22037 Cluster: Heterogeneous nuclear ribonucleoprotein...    86   5e-16
UniRef50_Q13151 Cluster: Heterogeneous nuclear ribonucleoprotein...    85   9e-16
UniRef50_Q4SQV2 Cluster: Chromosome 1 SCAF14529, whole genome sh...    84   3e-15
UniRef50_Q94AC3 Cluster: AT4g36960/C7A10_400; n=11; Magnoliophyt...    83   4e-15
UniRef50_Q08473 Cluster: RNA-binding protein squid; n=22; Endopt...    83   4e-15
UniRef50_Q8WSM6 Cluster: Putative uncharacterized protein; n=4; ...    82   8e-15
UniRef50_UPI00005A4DCF Cluster: PREDICTED: similar to Heterogene...    81   1e-14
UniRef50_A7QJF1 Cluster: Chromosome chr8 scaffold_106, whole gen...    81   2e-14
UniRef50_Q501B0 Cluster: At2g46780; n=3; core eudicotyledons|Rep...    80   3e-14
UniRef50_Q9SYP9 Cluster: F9H16.14 protein; n=6; core eudicotyled...    79   8e-14
UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=7...    79   8e-14
UniRef50_P41891 Cluster: Protein gar2; n=12; Ascomycota|Rep: Pro...    79   1e-13
UniRef50_Q4W5P0 Cluster: Homologous to drosophila sqd (Squid) pr...    78   1e-13
UniRef50_Q94BU4 Cluster: At1g33470/F10C21_14; n=2; Arabidopsis t...    78   2e-13
UniRef50_A3BDN9 Cluster: Putative uncharacterized protein; n=3; ...    77   2e-13
UniRef50_Q5CS11 Cluster: Musashi. RRM domain containing protein,...    77   2e-13
UniRef50_A7ART3 Cluster: Ribonucleoprotein, putative; n=1; Babes...    77   3e-13
UniRef50_A7NUC5 Cluster: Chromosome chr18 scaffold_1, whole geno...    77   4e-13
UniRef50_A2X9R7 Cluster: Putative uncharacterized protein; n=1; ...    77   4e-13
UniRef50_Q4PBV1 Cluster: Putative uncharacterized protein; n=1; ...    77   4e-13
UniRef50_Q6IRQ4 Cluster: MGC82187 protein; n=6; Tetrapoda|Rep: M...    75   9e-13
UniRef50_Q67W00 Cluster: Putative RRM-containing protein; n=2; O...    75   1e-12
UniRef50_Q0DXG2 Cluster: Os02g0755400 protein; n=2; Oryza sativa...    75   1e-12
UniRef50_Q14011 Cluster: Cold-inducible RNA-binding protein; n=6...    75   1e-12
UniRef50_A2YWJ2 Cluster: Putative uncharacterized protein; n=3; ...    75   2e-12
UniRef50_Q9M9E6 Cluster: F3F9.20; n=8; Arabidopsis thaliana|Rep:...    74   2e-12
UniRef50_Q1PES4 Cluster: RNA recognition motif-containing protei...    74   2e-12
UniRef50_A5BSV4 Cluster: Putative uncharacterized protein; n=1; ...    74   2e-12
UniRef50_Q13148 Cluster: TAR DNA-binding protein 43; n=36; Coelo...    74   2e-12
UniRef50_Q9SVM8 Cluster: Glycine-rich RNA-binding protein 2, mit...    74   2e-12
UniRef50_Q3ED69 Cluster: Uncharacterized protein At1g22910.3; n=...    73   4e-12
UniRef50_UPI000156016B Cluster: PREDICTED: hypothetical protein;...    73   5e-12
UniRef50_Q9SM01 Cluster: RNA binding protein; n=2; Arabidopsis t...    73   5e-12
UniRef50_Q8LPB0 Cluster: Glycine-rich RNA-binding protein; n=1; ...    73   5e-12
UniRef50_A7PIB0 Cluster: Chromosome chr13 scaffold_17, whole gen...    73   5e-12
UniRef50_Q5CT90 Cluster: RRM domain containing protein; n=1; Cry...    73   7e-12
UniRef50_UPI0000EB42F3 Cluster: UPI0000EB42F3 related cluster; n...    72   9e-12
UniRef50_Q1LVU9 Cluster: Cold inducible RNA binding protein; n=8...    72   9e-12
UniRef50_Q8VXC4 Cluster: Glycine rich RNA binding protein; n=20;...    72   9e-12
UniRef50_Q8RWN5 Cluster: RNA-binding protein-like; n=3; Arabidop...    72   9e-12
UniRef50_Q2UQ21 Cluster: Predicted protein; n=3; Pezizomycotina|...    72   9e-12
UniRef50_Q40437 Cluster: RGP-3; n=2; Nicotiana|Rep: RGP-3 - Nico...    72   1e-11
UniRef50_Q6ZR81 Cluster: CDNA FLJ46566 fis, clone THYMU3040829, ...    72   1e-11
UniRef50_O75526 Cluster: RNA-binding motif protein, X-linked-lik...    72   1e-11
UniRef50_A7APD8 Cluster: RNA recognition motif domain containing...    71   2e-11
UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=1...    71   2e-11
UniRef50_Q5JK61 Cluster: RNA recognition motif (RRM)-containing ...    71   2e-11
UniRef50_UPI0000DB6D53 Cluster: PREDICTED: similar to CG32169-PA...    70   4e-11
UniRef50_Q6VYI5 Cluster: TARDBP S8; n=8; Coelomata|Rep: TARDBP S...    70   4e-11
UniRef50_Q05C33 Cluster: Tardbp protein; n=14; Coelomata|Rep: Ta...    70   4e-11
UniRef50_Q9FI04 Cluster: Arabidopsis thaliana genomic DNA, chrom...    70   4e-11
UniRef50_A7QX84 Cluster: Chromosome undetermined scaffold_215, w...    70   4e-11
UniRef50_Q1DPW0 Cluster: Putative uncharacterized protein; n=1; ...    70   5e-11
UniRef50_Q10N14 Cluster: RNA recognition motif family protein, e...    69   6e-11
UniRef50_A2YHR7 Cluster: Putative uncharacterized protein; n=2; ...    69   6e-11
UniRef50_A1CJX8 Cluster: Glycine-rich RNA-binding protein, putat...    69   6e-11
UniRef50_UPI0000211FC5 Cluster: PREDICTED: RNA binding motif pro...    69   8e-11
UniRef50_Q9SIX3 Cluster: Putative glycine-rich RNA-binding prote...    69   8e-11
UniRef50_Q5PPI5 Cluster: Putative uncharacterized protein; n=1; ...    68   1e-10
UniRef50_A6GJJ1 Cluster: Probable nucleic acid-binding protein; ...    68   1e-10
UniRef50_Q8GU29 Cluster: Glycin-rich RNA binding protein; n=6; c...    68   1e-10
UniRef50_A5KRV2 Cluster: RNP-1 like RNA-binding protein; n=1; ca...    68   2e-10
UniRef50_Q75KB4 Cluster: Putative RNA binding protein; n=4; Oryz...    68   2e-10
UniRef50_A3AAN7 Cluster: Putative uncharacterized protein; n=2; ...    67   2e-10
UniRef50_Q4MZK1 Cluster: Nucleic acid binding factor, putative; ...    67   2e-10
UniRef50_Q4SJ02 Cluster: Chromosome 21 SCAF14577, whole genome s...    67   3e-10
UniRef50_Q9FFZ6 Cluster: Similarity to RNA-binding protein; n=2;...    67   3e-10
UniRef50_A4RXB1 Cluster: Predicted protein; n=2; Ostreococcus|Re...    67   3e-10
UniRef50_Q4H2Q6 Cluster: Ci-Tardbp protein; n=1; Ciona intestina...    67   3e-10
UniRef50_A7RU25 Cluster: Predicted protein; n=1; Nematostella ve...    66   4e-10
UniRef50_A0H648 Cluster: RNA-binding region RNP-1; n=3; Chlorofl...    66   8e-10
UniRef50_Q9FZ84 Cluster: F26I16.3 protein; n=2; Arabidopsis thal...    66   8e-10
UniRef50_Q6X9Z2 Cluster: HnRNP core protein A1; n=2; Laurasiathe...    66   8e-10
UniRef50_Q9BX46 Cluster: RNA-binding protein 24; n=52; Eumetazoa...    65   1e-09
UniRef50_UPI0000D9F579 Cluster: PREDICTED: similar to testes-spe...    64   2e-09
UniRef50_O24306 Cluster: Ribonucleoprotein; n=3; Pisum sativum|R...    64   2e-09
UniRef50_Q20414 Cluster: Putative uncharacterized protein tag-16...    64   2e-09
UniRef50_Q8LFQ5 Cluster: RNA binding protein-like; n=4; Arabidop...    64   2e-09
UniRef50_A7NXI6 Cluster: Chromosome chr5 scaffold_2, whole genom...    64   2e-09
UniRef50_UPI0000D5737C Cluster: PREDICTED: similar to RNA bindin...    64   3e-09
UniRef50_Q9H0Z9 Cluster: RNA-binding protein 38; n=16; Eutheria|...    64   3e-09
UniRef50_Q5K255 Cluster: Putative 29 kDa ribonucleoprotein A; n=...    63   4e-09
UniRef50_O23189 Cluster: RNA-binding like protein; n=1; Arabidop...    63   4e-09
UniRef50_UPI00015B48C0 Cluster: PREDICTED: similar to LOC443584 ...    63   5e-09
UniRef50_UPI00005A129E Cluster: PREDICTED: similar to Heterogene...    63   5e-09
UniRef50_A5K494 Cluster: Nucleic acid binding factor, putative; ...    63   5e-09
UniRef50_Q7XTU5 Cluster: OSJNBb0034I13.9 protein; n=4; Oryza sat...    62   7e-09
UniRef50_Q4U8S8 Cluster: RNA-binding protein, putative; n=2; The...    62   7e-09
UniRef50_P49314 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    62   7e-09
UniRef50_Q109W0 Cluster: RNA recognition motif family protein, e...    62   9e-09
UniRef50_Q6CHZ9 Cluster: Similar to tr|Q9C232 Neurospora crassa ...    62   9e-09
UniRef50_Q9FI08 Cluster: Similarity to RNA-binding protein; n=1;...    62   1e-08
UniRef50_Q5CRM8 Cluster: T8M16_190-plant like protein with RRM d...    62   1e-08
UniRef50_A7SIE8 Cluster: Predicted protein; n=2; Nematostella ve...    62   1e-08
UniRef50_A7SFY3 Cluster: Predicted protein; n=3; Nematostella ve...    62   1e-08
UniRef50_A7AN88 Cluster: RNA recognition motif domain containing...    62   1e-08
UniRef50_Q5K249 Cluster: Putative glycine-rich RNA-binding prote...    61   2e-08
UniRef50_Q2V9B8 Cluster: RNA-binding protein AKIP1-like; n=1; So...    61   2e-08
UniRef50_A7PVU6 Cluster: Chromosome chr8 scaffold_34, whole geno...    61   2e-08
UniRef50_A7PG82 Cluster: Chromosome chr6 scaffold_15, whole geno...    61   2e-08
UniRef50_A7SHQ6 Cluster: Predicted protein; n=1; Nematostella ve...    61   2e-08
UniRef50_Q9LKA4 Cluster: Similarity to RNA-binding protein; n=5;...    61   2e-08
UniRef50_Q7SGB3 Cluster: Predicted protein; n=5; Eukaryota|Rep: ...    61   2e-08
UniRef50_P19683 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    61   2e-08
UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce...    60   3e-08
UniRef50_A2XEH7 Cluster: Putative uncharacterized protein; n=1; ...    60   3e-08
UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA...    60   4e-08
UniRef50_UPI00004996C0 Cluster: RNA-binding protein; n=1; Entamo...    60   4e-08
UniRef50_A7PG81 Cluster: Chromosome chr6 scaffold_15, whole geno...    60   4e-08
UniRef50_Q9VHP3 Cluster: CG8021-PA; n=3; Diptera|Rep: CG8021-PA ...    60   4e-08
UniRef50_Q8IIT2 Cluster: Nucleic acid binding factor, putative; ...    60   4e-08
UniRef50_Q04836 Cluster: 31 kDa ribonucleoprotein, chloroplast p...    60   4e-08
UniRef50_O35698 Cluster: RNA-binding protein; n=7; Mus musculus|...    60   5e-08
UniRef50_O64571 Cluster: Putative RNA-binding protein; n=3; Arab...    60   5e-08
UniRef50_Q8I2Y5 Cluster: RNA-binding protein, putative; n=4; Pla...    60   5e-08
UniRef50_Q5BW90 Cluster: SJCHGC05136 protein; n=1; Schistosoma j...    60   5e-08
UniRef50_Q54NB8 Cluster: RNA-binding region-containing protein; ...    60   5e-08
UniRef50_A7RRA7 Cluster: Predicted protein; n=1; Nematostella ve...    60   5e-08
UniRef50_Q10KP0 Cluster: RNA recognition motif family protein, e...    59   7e-08
UniRef50_A7PL41 Cluster: Chromosome chr7 scaffold_20, whole geno...    59   7e-08
UniRef50_A3QQP3 Cluster: Chloroplast single strand DNA binding p...    59   7e-08
UniRef50_A2AX49 Cluster: RNA recognition motif 1; n=1; Guillardi...    59   7e-08
UniRef50_Q7RIJ3 Cluster: RNA recognition motif, putative; n=3; P...    59   7e-08
UniRef50_Q552K5 Cluster: Putative uncharacterized protein; n=1; ...    59   7e-08
UniRef50_A7SCR4 Cluster: Predicted protein; n=1; Nematostella ve...    59   7e-08
UniRef50_Q6BY19 Cluster: Debaryomyces hansenii chromosome A of s...    59   7e-08
UniRef50_UPI000049A1CF Cluster: TIA-1 protein; n=1; Entamoeba hi...    59   9e-08
UniRef50_UPI000065FE7B Cluster: RNA-binding protein 38 (RNA-bind...    59   9e-08
UniRef50_A7RFA9 Cluster: Predicted protein; n=1; Nematostella ve...    59   9e-08
UniRef50_Q15414 Cluster: RNA-binding motif protein, Y chromosome...    59   9e-08
UniRef50_Q5Z4E8 Cluster: Putative uncharacterized protein B1386G...    58   1e-07
UniRef50_Q012A5 Cluster: Ps16 protein; n=2; Ostreococcus|Rep: Ps...    58   1e-07
UniRef50_Q5CIP3 Cluster: Single-stranded G-strand telomeric DNA-...    58   1e-07
UniRef50_Q5ZAN1 Cluster: Putative uncharacterized protein OSJNBb...    58   2e-07
UniRef50_O45189 Cluster: Suppressor protein 12; n=2; Caenorhabdi...    58   2e-07
UniRef50_A7AWX7 Cluster: RNA recognition motif. (A.k.a. RRM, RBD...    58   2e-07
UniRef50_P27476 Cluster: Nuclear localization sequence-binding p...    58   2e-07
UniRef50_UPI0000DA279E Cluster: PREDICTED: similar to Heterogene...    58   2e-07
UniRef50_Q8LLE6 Cluster: RNA-binding protein AKIP1; n=7; core eu...    58   2e-07
UniRef50_Q5A4G6 Cluster: Putative uncharacterized protein PUB1; ...    58   2e-07
UniRef50_UPI0000E4A54D Cluster: PREDICTED: hypothetical protein;...    57   3e-07
UniRef50_UPI0000E4615D Cluster: PREDICTED: similar to heterogene...    57   3e-07
UniRef50_Q4SG98 Cluster: Chromosome 17 SCAF14597, whole genome s...    57   3e-07
UniRef50_Q6ID29 Cluster: At4g13860; n=9; cellular organisms|Rep:...    57   3e-07
UniRef50_Q4XN28 Cluster: RNA binding protein, putative; n=6; Pla...    57   3e-07
UniRef50_Q23RL2 Cluster: Nucleolar phosphoprotein, putative; n=2...    57   3e-07
UniRef50_Q6MCT2 Cluster: Probable nucleic acid-binding protein; ...    57   4e-07
UniRef50_Q8RYD4 Cluster: UBP1 interacting protein 1a; n=5; Arabi...    57   4e-07
UniRef50_A7PJ01 Cluster: Chromosome chr13 scaffold_17, whole gen...    57   4e-07
UniRef50_A7NYH5 Cluster: Chromosome chr6 scaffold_3, whole genom...    57   4e-07
UniRef50_Q5CXY1 Cluster: T8M16_190 RRM protein of possible plant...    57   4e-07
UniRef50_A6N9V7 Cluster: RNA binding protein; n=1; Ornithodoros ...    57   4e-07
UniRef50_UPI00005A196B Cluster: PREDICTED: similar to Heterogene...    56   5e-07
UniRef50_Q569S7 Cluster: LOC443584 protein; n=5; Xenopus|Rep: LO...    56   5e-07
UniRef50_O04240 Cluster: RNA- or ssDNA-binding protein; n=2; Pap...    56   5e-07
UniRef50_A4S763 Cluster: Predicted protein; n=1; Ostreococcus lu...    56   5e-07
UniRef50_Q57XH6 Cluster: RNA-binding protein, putative; n=1; Try...    56   5e-07
UniRef50_A2DHF2 Cluster: Putative uncharacterized protein; n=2; ...    56   5e-07
UniRef50_Q5KBA9 Cluster: Putative uncharacterized protein; n=1; ...    56   5e-07
UniRef50_UPI0000498349 Cluster: RNA-binding protein; n=1; Entamo...    56   6e-07
UniRef50_Q83CD7 Cluster: Nucleic acid binding domain protein; n=...    56   6e-07
UniRef50_Q9ZUJ3 Cluster: T2K10.5 protein; n=3; Magnoliophyta|Rep...    56   6e-07
UniRef50_Q10N84 Cluster: RNA-binding protein, putative, expresse...    56   6e-07
UniRef50_A2XBX0 Cluster: Putative uncharacterized protein; n=2; ...    56   6e-07
UniRef50_Q5KP11 Cluster: Single-stranded DNA binding protein, pu...    56   6e-07
UniRef50_A6SJV1 Cluster: Putative uncharacterized protein; n=2; ...    56   6e-07
UniRef50_Q6ZZX5 Cluster: Heterogeneous nuclear ribonucleoprotein...    56   8e-07
UniRef50_Q83D11 Cluster: RNA-binding protein; n=3; Coxiella burn...    56   8e-07
UniRef50_Q9LES2 Cluster: Putative uncharacterized protein T8M16_...    56   8e-07
UniRef50_Q9C5A7 Cluster: Putative uncharacterized protein At5g08...    56   8e-07
UniRef50_A5BLC5 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_Q23RL1 Cluster: Nucleolar phosphoprotein; n=1; Tetrahym...    56   8e-07
UniRef50_Q17385 Cluster: Elav-type ribonucleoprotein; n=8; Caeno...    56   8e-07
UniRef50_UPI0000E476D6 Cluster: PREDICTED: hypothetical protein;...    55   1e-06
UniRef50_UPI00005A96C6 Cluster: PREDICTED: similar to Heterogene...    55   1e-06
UniRef50_UPI000065DEA8 Cluster: RNA-binding protein 24 (RNA-bind...    55   1e-06
UniRef50_Q3B6Q3 Cluster: RNA-binding region RNP-1; n=6; Chlorobi...    55   1e-06
UniRef50_Q01L95 Cluster: OSIGBa0137L20.5 protein; n=7; Oryza sat...    55   1e-06
UniRef50_Q43349 Cluster: 29 kDa ribonucleoprotein, chloroplast p...    55   1e-06
UniRef50_Q5EUH9 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_A7P2N7 Cluster: Chromosome chr1 scaffold_5, whole genom...    55   1e-06
UniRef50_Q553V5 Cluster: Putative uncharacterized protein; n=4; ...    55   1e-06
UniRef50_Q4D4H5 Cluster: Putative uncharacterized protein; n=2; ...    55   1e-06
UniRef50_Q18724 Cluster: Putative uncharacterized protein; n=2; ...    55   1e-06
UniRef50_A7SMA3 Cluster: Predicted protein; n=3; Nematostella ve...    55   1e-06
UniRef50_A7CQC8 Cluster: RNP-1 like RNA-binding protein; n=1; Op...    54   2e-06
UniRef50_A2WN71 Cluster: Putative uncharacterized protein; n=2; ...    54   2e-06
UniRef50_Q54WM9 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q1ZXF8 Cluster: RNA-binding region-containing protein; ...    54   2e-06
UniRef50_A2EWD1 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q00880 Cluster: Cutinase negative acting protein; n=2; ...    54   2e-06
UniRef50_Q7U7Q8 Cluster: PutativeRNA-binding protein RbpD; n=9; ...    54   3e-06
UniRef50_Q5ZYW0 Cluster: RNA binding protein, cold-inducible rrm...    54   3e-06
UniRef50_Q10N87 Cluster: Polyadenylate binding protein, types 1,...    54   3e-06
UniRef50_A7PX80 Cluster: Chromosome chr12 scaffold_36, whole gen...    54   3e-06
UniRef50_A5BGN9 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q5BXS3 Cluster: SJCHGC01369 protein; n=2; Schistosoma j...    54   3e-06
UniRef50_Q0F212 Cluster: RNA-binding region RNP-1; n=1; Mariprof...    53   4e-06
UniRef50_Q09584 Cluster: Rnp (Rrm rna binding domain) containing...    53   4e-06
UniRef50_O45577 Cluster: Putative uncharacterized protein cpf-2;...    53   4e-06
UniRef50_A0BHN3 Cluster: Chromosome undetermined scaffold_108, w...    53   4e-06
UniRef50_Q0TVC9 Cluster: Putative uncharacterized protein; n=1; ...    53   4e-06
UniRef50_UPI0000499611 Cluster: enhancer binding protein 2-relat...    53   6e-06
UniRef50_Q4S5L6 Cluster: Chromosome 9 SCAF14729, whole genome sh...    53   6e-06
UniRef50_Q9FIU6 Cluster: Similarity to RNA-binding protein; n=4;...    53   6e-06
UniRef50_Q4DHI4 Cluster: Putative uncharacterized protein; n=1; ...    53   6e-06
UniRef50_Q7SFZ5 Cluster: Putative uncharacterized protein NCU030...    53   6e-06
UniRef50_Q8N9W6 Cluster: Protein boule-like; n=35; Eumetazoa|Rep...    53   6e-06
UniRef50_UPI0000498AD7 Cluster: enhancer binding protein 2; n=1;...    52   8e-06
UniRef50_A2YS16 Cluster: Putative uncharacterized protein; n=3; ...    52   8e-06
UniRef50_Q0ZAL4 Cluster: Nucleolar phosphoprotein; n=1; Bombyx m...    52   8e-06
UniRef50_Q5KP81 Cluster: Transformer-2-beta isoform 3, putative;...    52   8e-06
UniRef50_Q2H622 Cluster: Putative uncharacterized protein; n=1; ...    52   8e-06
UniRef50_Q32P59 Cluster: SRA stem-loop-interacting RNA-binding p...    52   8e-06
UniRef50_Q05196 Cluster: Polyadenylate-binding protein 5 (Poly(A...    52   8e-06
UniRef50_Q99069 Cluster: Glycine-rich RNA-binding protein 1; n=4...    52   8e-06
UniRef50_UPI0000E4A88D Cluster: PREDICTED: similar to MGC88935 p...    52   1e-05
UniRef50_UPI000049A266 Cluster: RNA-binding protein; n=1; Entamo...    52   1e-05
UniRef50_Q10RM6 Cluster: Transposon protein, putative, CACTA, En...    52   1e-05
UniRef50_Q5CRV5 Cluster: SPAC25G10.01-like RRM domain containing...    52   1e-05
UniRef50_Q5JUB2 Cluster: ELAV (Embryonic lethal, abnormal vision...    52   1e-05
UniRef50_Q6CHX5 Cluster: Similar to sp|P53883 Saccharomyces cere...    52   1e-05
UniRef50_P31483 Cluster: Nucleolysin TIA-1 isoform p40 (RNA-bind...    52   1e-05
UniRef50_P26378 Cluster: ELAV-like protein 4; n=100; Euteleostom...    52   1e-05
UniRef50_O83375 Cluster: RNA-binding protein, putative; n=1; Tre...    52   1e-05
UniRef50_Q01JU3 Cluster: H0714H04.9 protein; n=7; Magnoliophyta|...    52   1e-05
UniRef50_A7PXT7 Cluster: Chromosome chr15 scaffold_37, whole gen...    52   1e-05
UniRef50_A7PC82 Cluster: Chromosome chr2 scaffold_11, whole geno...    52   1e-05
UniRef50_Q6TMI9 Cluster: RNA-binding protein; n=3; Dictyostelium...    52   1e-05
UniRef50_Q4N6Y8 Cluster: RNA-binding protein, putative; n=2; The...    52   1e-05
UniRef50_Q6MVP3 Cluster: Related to heterogeneous nuclear ribonu...    52   1e-05
UniRef50_Q6FIQ5 Cluster: Candida glabrata strain CBS138 chromoso...    52   1e-05
UniRef50_Q2HG12 Cluster: Putative uncharacterized protein; n=2; ...    52   1e-05
UniRef50_O74400 Cluster: RNA-binding protein; n=1; Schizosacchar...    52   1e-05
UniRef50_P39697 Cluster: 40S ribosomal protein S19, mitochondria...    52   1e-05
UniRef50_Q6DHU2 Cluster: Zgc:92062; n=4; Clupeocephala|Rep: Zgc:...    51   2e-05
UniRef50_Q9LU44 Cluster: Similarity to transcription or splicing...    51   2e-05
UniRef50_Q014L5 Cluster: Cyclophilin-type peptidyl-prolyl cis-tr...    51   2e-05
UniRef50_Q0KHQ1 Cluster: CG33714-PA, isoform A; n=2; Diptera|Rep...    51   2e-05
UniRef50_Q14498 Cluster: RNA-binding protein 39; n=55; Euteleost...    51   2e-05
UniRef50_UPI0000E468DC Cluster: PREDICTED: hypothetical protein;...    51   2e-05
UniRef50_Q67JJ7 Cluster: Glycine-rich RNA-binding protein; n=4; ...    51   2e-05
UniRef50_Q1IV44 Cluster: RNA-binding protein, RNP-1; n=2; Bacter...    51   2e-05
UniRef50_Q11SF1 Cluster: RNA binding protein; n=6; Bacteria|Rep:...    51   2e-05
UniRef50_Q9SVM7 Cluster: RNA-binding protein like; n=1; Arabidop...    51   2e-05
UniRef50_Q5JJM4 Cluster: Peptidylprolyl cis-trans isomerase-like...    51   2e-05
UniRef50_A4RW58 Cluster: Predicted protein; n=1; Ostreococcus lu...    51   2e-05
UniRef50_Q5DA36 Cluster: SJCHGC06322 protein; n=3; Bilateria|Rep...    51   2e-05
UniRef50_Q54QQ7 Cluster: Putative RNA splicing factor; n=1; Dict...    51   2e-05
UniRef50_Q4FW55 Cluster: Poly(A) binding protein, putative; n=6;...    51   2e-05
UniRef50_A2FYE4 Cluster: Polyadenylate-binding protein, putative...    51   2e-05
UniRef50_A2DZS7 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q59G98 Cluster: TIA1 protein variant; n=5; Euteleostomi...    51   2e-05
UniRef50_A6S9X8 Cluster: Putative uncharacterized protein; n=2; ...    51   2e-05
UniRef50_P19684 Cluster: 33 kDa ribonucleoprotein, chloroplast p...    51   2e-05
UniRef50_UPI0000DA3940 Cluster: PREDICTED: similar to RNA bindin...    50   3e-05
UniRef50_Q6NV05 Cluster: Zgc:85696; n=7; Clupeocephala|Rep: Zgc:...    50   3e-05
UniRef50_Q01AU2 Cluster: RNA-binding protein SART3; n=1; Ostreoc...    50   3e-05
UniRef50_A4S0L2 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    50   3e-05
UniRef50_Q86NL1 Cluster: RE27227p; n=5; Endopterygota|Rep: RE272...    50   3e-05
UniRef50_Q5CWK5 Cluster: 5x RRM. Mrd1p like, splicing related; n...    50   3e-05
UniRef50_Q5CF61 Cluster: Dentin phosphoryn; n=2; Cryptosporidium...    50   3e-05
UniRef50_Q556F3 Cluster: Putative uncharacterized protein; n=2; ...    50   3e-05
UniRef50_Q245K5 Cluster: Putative uncharacterized protein; n=1; ...    50   3e-05
UniRef50_A0CBK1 Cluster: Chromosome undetermined scaffold_164, w...    50   3e-05
UniRef50_A1DEX9 Cluster: RNA binding domain protein; n=15; Peziz...    50   3e-05
UniRef50_Q01085 Cluster: Nucleolysin TIAR; n=67; Euteleostomi|Re...    50   3e-05
UniRef50_O13741 Cluster: Nucleolar protein 12; n=1; Schizosaccha...    50   3e-05
UniRef50_UPI0000E806AC Cluster: PREDICTED: hypothetical protein;...    50   4e-05
UniRef50_UPI0000E4857E Cluster: PREDICTED: similar to cold induc...    50   4e-05
UniRef50_UPI000065D37A Cluster: ELAV-like protein 3 (Hu-antigen ...    50   4e-05
UniRef50_Q7NHK5 Cluster: RNA-binding protein; n=10; cellular org...    50   4e-05
UniRef50_Q1PEP5 Cluster: Nucleolin; n=2; Arabidopsis thaliana|Re...    50   4e-05
UniRef50_A7QJZ9 Cluster: Chromosome undetermined scaffold_109, w...    50   4e-05
UniRef50_A2YQN8 Cluster: Putative uncharacterized protein; n=4; ...    50   4e-05
UniRef50_Q5CSW5 Cluster: RRM domain protein; n=2; Cryptosporidiu...    50   4e-05
UniRef50_O96606 Cluster: Polyadenylate-binding protein 1; n=6; T...    50   4e-05
UniRef50_A2EW18 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_A0CCB3 Cluster: Chromosome undetermined scaffold_167, w...    50   4e-05
UniRef50_Q6C747 Cluster: Yarrowia lipolytica chromosome E of str...    50   4e-05
UniRef50_A4RNA8 Cluster: Putative uncharacterized protein; n=1; ...    50   4e-05
UniRef50_Q13595 Cluster: Transformer-2 protein homolog; n=57; Eu...    50   4e-05
UniRef50_Q8SR30 Cluster: Polyadenylate-binding protein, cytoplas...    50   4e-05
UniRef50_Q8IMX4 Cluster: CG5422-PD, isoform D; n=14; Endopterygo...    48   4e-05
UniRef50_Q4RX96 Cluster: Chromosome 11 SCAF14979, whole genome s...    39   4e-05
UniRef50_UPI0000D5678A Cluster: PREDICTED: similar to CG10466-PA...    50   5e-05
UniRef50_UPI000049A3A1 Cluster: RNA-binding protein; n=1; Entamo...    50   5e-05
UniRef50_UPI000049910F Cluster: RNA-binding protein; n=3; Entamo...    50   5e-05
UniRef50_Q9SJ28 Cluster: Putative glycine-rich RNA binding prote...    50   5e-05
UniRef50_Q015S2 Cluster: Single-stranded DNA binding protein, pu...    50   5e-05
UniRef50_Q6C9W1 Cluster: Yarrowia lipolytica chromosome D of str...    50   5e-05
UniRef50_Q6BYF3 Cluster: Debaryomyces hansenii chromosome A of s...    50   5e-05
UniRef50_Q9Y388 Cluster: RNA-binding motif protein, X-linked 2; ...    50   5e-05
UniRef50_UPI000051A0F5 Cluster: PREDICTED: similar to Cleavage s...    49   7e-05
UniRef50_Q7XGR3 Cluster: RNA recognition motif family protein, e...    49   7e-05
UniRef50_A7PZY6 Cluster: Chromosome chr8 scaffold_41, whole geno...    49   7e-05
UniRef50_A7NUT4 Cluster: Chromosome chr18 scaffold_1, whole geno...    49   7e-05
UniRef50_A2Y1R0 Cluster: Putative uncharacterized protein; n=7; ...    49   7e-05
UniRef50_Q54CU2 Cluster: RNA-binding region-containing protein; ...    49   7e-05
UniRef50_Q18318 Cluster: Putative uncharacterized protein C30B5....    49   7e-05
UniRef50_A7S6X1 Cluster: Predicted protein; n=1; Nematostella ve...    49   7e-05
UniRef50_A5K747 Cluster: RNA binding protein, putative; n=4; Pla...    49   7e-05
UniRef50_A5K2K1 Cluster: RNA-binding protein, putative; n=8; Pla...    49   7e-05
UniRef50_A4V6M1 Cluster: Bruno-like protein; n=1; Dugesia japoni...    49   7e-05
UniRef50_Q4PF48 Cluster: Putative uncharacterized protein; n=1; ...    49   7e-05
UniRef50_A5DZJ4 Cluster: Putative uncharacterized protein; n=1; ...    49   7e-05
UniRef50_UPI00015B552E Cluster: PREDICTED: similar to bruno; n=1...    49   9e-05
UniRef50_Q7MWI3 Cluster: RNA-binding protein; n=5; Bacteroidetes...    49   9e-05
UniRef50_Q3J7I0 Cluster: RNA-binding protein, RNP-1; n=1; Nitros...    49   9e-05
UniRef50_A7QE05 Cluster: Chromosome chr4 scaffold_83, whole geno...    49   9e-05
UniRef50_Q8ILZ7 Cluster: Putative uncharacterized protein; n=1; ...    49   9e-05
UniRef50_A7SN30 Cluster: Predicted protein; n=1; Nematostella ve...    49   9e-05
UniRef50_A7RM72 Cluster: Predicted protein; n=1; Nematostella ve...    49   9e-05
UniRef50_Q0CIN3 Cluster: Putative uncharacterized protein; n=1; ...    49   9e-05
UniRef50_A3LZJ7 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...    49   9e-05
UniRef50_A2QQZ9 Cluster: Similarity to oligouridylate binding pr...    49   9e-05
UniRef50_Q00916 Cluster: U1 small nuclear ribonucleoprotein 70 k...    49   9e-05
UniRef50_Q8IUH3 Cluster: RNA-binding protein 45; n=27; Euteleost...    49   9e-05
UniRef50_Q14576 Cluster: ELAV-like protein 3; n=34; Euteleostomi...    49   9e-05
UniRef50_UPI0000DB7056 Cluster: PREDICTED: similar to RNA bindin...    48   1e-04
UniRef50_UPI0000502E70 Cluster: UPI0000502E70 related cluster; n...    48   1e-04
UniRef50_Q7ZUX2 Cluster: Cstf2 protein; n=2; Danio rerio|Rep: Cs...    48   1e-04
UniRef50_Q8DIY8 Cluster: RNA binding protein; n=3; Cyanobacteria...    48   1e-04
UniRef50_Q48A10 Cluster: RNA-binding protein; n=2; Alteromonadal...    48   1e-04
UniRef50_Q9ZVW9 Cluster: Putative splicing factor; n=3; Arabidop...    48   1e-04
UniRef50_Q9LIH1 Cluster: Genomic DNA, chromosome 3, P1 clone:MFD...    48   1e-04
UniRef50_Q0ITI7 Cluster: Os11g0250000 protein; n=5; Oryza sativa...    48   1e-04
UniRef50_Q01JG9 Cluster: H0818E04.14 protein; n=7; Oryza sativa|...    48   1e-04
UniRef50_A2YR27 Cluster: Putative uncharacterized protein; n=3; ...    48   1e-04
UniRef50_Q4UFE0 Cluster: Nucleolar, RNA-binding protein, putativ...    48   1e-04
UniRef50_A2EV87 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q5KHU8 Cluster: MRNA catabolism, nonsense-mediated-rela...    48   1e-04
UniRef50_A2QMQ9 Cluster: Function: AUF1 of H. sapiens is a compo...    48   1e-04
UniRef50_UPI0000D578A0 Cluster: PREDICTED: similar to CG12870-PA...    48   2e-04
UniRef50_UPI0000D56808 Cluster: PREDICTED: similar to squamous c...    48   2e-04
UniRef50_UPI0000D567E5 Cluster: PREDICTED: similar to CG5422-PB,...    48   2e-04
UniRef50_A1SSM5 Cluster: RNP-1 like RNA-binding protein precurso...    48   2e-04
UniRef50_Q9SX80 Cluster: F16N3.23 protein; n=12; Magnoliophyta|R...    48   2e-04
UniRef50_Q5VNP2 Cluster: DNA repair helicase ERCC6-like; n=8; Or...    48   2e-04
UniRef50_A3BWU4 Cluster: Putative uncharacterized protein; n=3; ...    48   2e-04
UniRef50_Q54PB2 Cluster: RNA-binding region-containing protein; ...    48   2e-04
UniRef50_Q4QAH4 Cluster: Putative uncharacterized protein; n=3; ...    48   2e-04
UniRef50_Q1ECA2 Cluster: IP09238p; n=10; Coelomata|Rep: IP09238p...    48   2e-04
UniRef50_A2EKZ8 Cluster: Putative uncharacterized protein; n=2; ...    48   2e-04
UniRef50_A0BZZ4 Cluster: Chromosome undetermined scaffold_14, wh...    48   2e-04
UniRef50_Q9BU66 Cluster: MGC10433 protein; n=39; Eukaryota|Rep: ...    48   2e-04
UniRef50_Q9Y7A8 Cluster: Pad-1; n=18; Pezizomycotina|Rep: Pad-1 ...    48   2e-04
UniRef50_Q6CG61 Cluster: Similar to sp|P31209 Schizosaccharomyce...    48   2e-04
UniRef50_Q4PFD1 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_A5DFE5 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_P62995 Cluster: Splicing factor, arginine/serine-rich 1...    48   2e-04
UniRef50_UPI00015B5799 Cluster: PREDICTED: similar to scaffold a...    48   2e-04
UniRef50_UPI0000D577C9 Cluster: PREDICTED: similar to poly(A) bi...    48   2e-04
UniRef50_Q4S9B3 Cluster: Chromosome undetermined SCAF14699, whol...    48   2e-04
UniRef50_Q2JQB3 Cluster: Putative RNA-binding protein; n=2; Syne...    48   2e-04
UniRef50_Q7XLQ4 Cluster: OSJNBa0044M19.2 protein; n=2; Oryza sat...    48   2e-04
UniRef50_Q01HI6 Cluster: OSIGBa0142I02-OSIGBa0101B20.3 protein; ...    48   2e-04
UniRef50_A7PEX2 Cluster: Chromosome chr11 scaffold_13, whole gen...    48   2e-04
UniRef50_A7PA84 Cluster: Chromosome chr14 scaffold_9, whole geno...    48   2e-04
UniRef50_A4RUB8 Cluster: Predicted protein; n=2; Ostreococcus|Re...    48   2e-04
UniRef50_Q57TU8 Cluster: RNA-binding protein, putative; n=1; Try...    48   2e-04
UniRef50_A7SMA7 Cluster: Predicted protein; n=2; Nematostella ve...    48   2e-04
UniRef50_A2FQN0 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_A2FJ55 Cluster: Putative uncharacterized protein; n=2; ...    48   2e-04
UniRef50_A1EAA0 Cluster: Polyadenylate-binding protein; n=3; Pla...    48   2e-04
UniRef50_Q9Y7Y3 Cluster: RNA-binding protein; n=1; Schizosacchar...    48   2e-04
UniRef50_Q8SRE5 Cluster: CLEAVAGE STIMULATION FACTOR; n=2; Micro...    48   2e-04
UniRef50_Q4P2L3 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q8TBF4 Cluster: Zinc finger CCHC-type and RNA-binding m...    48   2e-04
UniRef50_UPI0001555426 Cluster: PREDICTED: similar to hematopoie...    47   3e-04
UniRef50_UPI0000E4617E Cluster: PREDICTED: similar to MGC10433-l...    47   3e-04
UniRef50_Q66KL9 Cluster: MGC79565 protein; n=3; Xenopus|Rep: MGC...    47   3e-04
UniRef50_Q4T824 Cluster: Chromosome undetermined SCAF7912, whole...    47   3e-04
UniRef50_Q9FMG4 Cluster: Similarity to splicing factor; n=6; Mag...    47   3e-04
UniRef50_Q2HTD6 Cluster: RNA-binding region RNP-1 (RNA recogniti...    47   3e-04
UniRef50_A7PNK3 Cluster: Chromosome chr8 scaffold_23, whole geno...    47   3e-04
UniRef50_Q8I2R8 Cluster: RNA-binding protein, putative; n=5; Pla...    47   3e-04
UniRef50_A7AQD9 Cluster: RNA recognition motif containing protei...    47   3e-04
UniRef50_Q75E07 Cluster: ABL134Cp; n=1; Eremothecium gossypii|Re...    47   3e-04
UniRef50_Q74Z16 Cluster: AGR390Cp; n=1; Eremothecium gossypii|Re...    47   3e-04
UniRef50_Q4P7H4 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_O94290 Cluster: RNA-binding protein Cwf29; n=1; Schizos...    47   3e-04
UniRef50_Q6IQ97 Cluster: RNA-binding protein 4; n=5; Clupeocepha...    47   3e-04
UniRef50_Q1DXH0 Cluster: Polyadenylate-binding protein, cytoplas...    47   3e-04
UniRef50_UPI0001555B84 Cluster: PREDICTED: similar to PP239 prot...    47   4e-04
UniRef50_UPI0000DB6B73 Cluster: PREDICTED: similar to squamous c...    47   4e-04
UniRef50_Q4QRG7 Cluster: Zgc:113884; n=5; Danio rerio|Rep: Zgc:1...    47   4e-04
UniRef50_Q4KMD7 Cluster: Zgc:112254; n=2; Danio rerio|Rep: Zgc:1...    47   4e-04
UniRef50_O25501 Cluster: Ss-DNA binding protein 12RNP2; n=4; Hel...    47   4e-04
UniRef50_A3J4E6 Cluster: RNA binding protein; n=4; cellular orga...    47   4e-04
UniRef50_Q9FX45 Cluster: RNA-binding glycine-rich protein, putat...    47   4e-04
UniRef50_Q01CD9 Cluster: CwfJ / zinc finger; n=2; Ostreococcus|R...    47   4e-04
UniRef50_A7QII5 Cluster: Chromosome chr12 scaffold_103, whole ge...    47   4e-04
UniRef50_Q93194 Cluster: Putative uncharacterized protein; n=3; ...    47   4e-04
UniRef50_Q54RW5 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q54G90 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A7T0E1 Cluster: Predicted protein; n=4; Nematostella ve...    47   4e-04
UniRef50_A0C337 Cluster: Chromosome undetermined scaffold_146, w...    47   4e-04
UniRef50_Q6FLF5 Cluster: Similar to sp|P53927 Saccharomyces cere...    47   4e-04
UniRef50_Q6C1T7 Cluster: Similar to DEHA0A13563g Debaryomyces ha...    47   4e-04
UniRef50_Q0TX64 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A6S537 Cluster: Putative uncharacterized protein; n=2; ...    47   4e-04
UniRef50_A5DJP2 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A2R8K5 Cluster: Contig An16c0230, complete genome; n=2;...    47   4e-04
UniRef50_Q9WX39 Cluster: Putative RNA-binding protein rbpF; n=10...    47   4e-04
UniRef50_Q44560 Cluster: Putative RNA-binding protein rbpA; n=4;...    47   4e-04
UniRef50_O04425 Cluster: Flowering time control protein FCA; n=1...    47   4e-04
UniRef50_UPI00015B621E Cluster: PREDICTED: hypothetical protein;...    46   5e-04
UniRef50_UPI0000D55CCD Cluster: PREDICTED: similar to CG2931-PA;...    46   5e-04
UniRef50_UPI000069E108 Cluster: UPI000069E108 related cluster; n...    46   5e-04
UniRef50_Q7NCQ3 Cluster: RNA-binding protein; n=1; Gloeobacter v...    46   5e-04
UniRef50_A7MXD2 Cluster: Putative uncharacterized protein; n=1; ...    46   5e-04
UniRef50_Q9VJG2 Cluster: CG12288-PA; n=2; Drosophila melanogaste...    46   5e-04
UniRef50_Q20084 Cluster: Putative uncharacterized protein exc-7;...    46   5e-04
UniRef50_Q1HPI4 Cluster: BOULE protein; n=1; Bombyx mori|Rep: BO...    46   5e-04
UniRef50_A7RTC5 Cluster: Predicted protein; n=1; Nematostella ve...    46   5e-04
UniRef50_A7AV01 Cluster: RNA binding protein, putative; n=1; Bab...    46   5e-04
UniRef50_Q6CU32 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    46   5e-04
UniRef50_A6RQM3 Cluster: Putative uncharacterized protein; n=2; ...    46   5e-04
UniRef50_Q10355 Cluster: Uncharacterized RNA-binding protein C22...    46   5e-04
UniRef50_Q9GZT3 Cluster: SRA stem-loop-interacting RNA-binding p...    46   5e-04
UniRef50_O14327 Cluster: Polyadenylate-binding protein 2 (Poly(A...    46   5e-04
UniRef50_UPI000023E598 Cluster: hypothetical protein FG10156.1; ...    46   7e-04
UniRef50_Q9KVI6 Cluster: RNA-binding protein; n=17; Vibrionaceae...    46   7e-04
UniRef50_A0HBM8 Cluster: RNA-binding region RNP-1; n=1; Comamona...    46   7e-04
UniRef50_Q8LEE2 Cluster: Glycine-rich RNA-binding protein-like; ...    46   7e-04
UniRef50_Q1ECN0 Cluster: At2g27330; n=2; Arabidopsis thaliana|Re...    46   7e-04
UniRef50_Q9W158 Cluster: CG4612-PA; n=2; Sophophora|Rep: CG4612-...    46   7e-04
UniRef50_Q16N17 Cluster: Putative uncharacterized protein; n=1; ...    46   7e-04
UniRef50_A0E382 Cluster: Chromosome undetermined scaffold_76, wh...    46   7e-04
UniRef50_A6NDY0 Cluster: Uncharacterized protein ENSP00000367609...    46   7e-04
UniRef50_Q6CQW2 Cluster: Similarities with sp|Q8J1F4 Ashbya goss...    46   7e-04
UniRef50_A3LXC4 Cluster: RNA recognition motif-containing protei...    46   7e-04
UniRef50_A2QVN5 Cluster: Function: RBD; n=2; Pezizomycotina|Rep:...    46   7e-04
UniRef50_Q9ZQA8 Cluster: Probable polyadenylate-binding protein ...    46   7e-04

>UniRef50_P48809 Cluster: Heterogeneous nuclear ribonucleoprotein
           27C; n=11; Endopterygota|Rep: Heterogeneous nuclear
           ribonucleoprotein 27C - Drosophila melanogaster (Fruit
           fly)
          Length = 421

 Score =  221 bits (539), Expect = 1e-56
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171


>UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39;
           Euteleostomi|Rep: DAZ-associated protein 1 - Homo
           sapiens (Human)
          Length = 407

 Score =  142 bits (345), Expect = 4e-33
 Identities = 69/128 (53%), Positives = 86/128 (67%), Gaps = 13/128 (10%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE GKLFVGGL W T+QE L+ YFS+YGEV+DCV+MK+  + +SRGFGFV F DP+ V  
Sbjct: 7   DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGT 66

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQ----KPKRG---------GGYPKVFLGGLPSNVTE 397
           VL + PH LDGR IDPKPC PR +Q    +PK G             K+F+GG+P N  E
Sbjct: 67  VLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGE 126

Query: 398 TDLRXIFR 421
           T+LR  F+
Sbjct: 127 TELREYFK 134



 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 30/92 (32%), Positives = 51/92 (55%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +  P  D+ +  K+FVGG+     +  L+ YF ++G V + V++ ++E  R RGFGF+
Sbjct: 100 GWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFI 159

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
           TF D   V+  +    H + G+ ++ K   PR
Sbjct: 160 TFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/39 (46%), Positives = 28/39 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS 530
           +F ++G V EVV++YD  K++  G GF++FEDE S  Q+
Sbjct: 132 YFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170



 Score = 37.1 bits (82), Expect = 0.30
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V++ VIM D+   +S G GF+ F+D
Sbjct: 29  YFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD 60


>UniRef50_UPI0000F1F0C3 Cluster: PREDICTED: similar to LOC561459
           protein; n=1; Danio rerio|Rep: PREDICTED: similar to
           LOC561459 protein - Danio rerio
          Length = 329

 Score =  135 bits (326), Expect = 8e-31
 Identities = 58/95 (61%), Positives = 70/95 (73%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           MN ++  DE GKLFVGGL W T+QE L+ YFS+YGEV+DCV+MK+  + +SRGFGFV F 
Sbjct: 13  MNSNLAGDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFK 72

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
           DP+ V  VL   PH LDGR IDPKPC PR +Q  K
Sbjct: 73  DPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEK 107



 Score = 41.5 bits (93), Expect = 0.014
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +3

Query: 297 STLSRAILALFKNRNVAVDTL-RCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKK 473
           S L    LA   N N+A D + +  + G   +  +     +F +YG+V++ VIM D+   
Sbjct: 2   SALPSTTLATEMNSNLAGDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTN 61

Query: 474 KSXGXGFLSFED 509
           +S G GF+ F+D
Sbjct: 62  QSRGFGFVKFKD 73


>UniRef50_Q4SEZ3 Cluster: Chromosome 1 SCAF14609, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1
           SCAF14609, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 476

 Score =  134 bits (323), Expect = 2e-30
 Identities = 64/122 (52%), Positives = 81/122 (66%), Gaps = 12/122 (9%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL W T+QE L+ YFS+YGEV+DCV+MK+  + +SRGFGFV F DP+ V  VL+ 
Sbjct: 1   KLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLET 60

Query: 269 GPHQLDGRTIDPKPCNPRTLQ--KPKRGGGY----------PKVFLGGLPSNVTETDLRX 412
            PH LDGR IDPKPC PR +Q  K +   G+           K+F+GG+P N  E +LR 
Sbjct: 61  KPHNLDGRNIDPKPCTPRGMQPEKSRTKEGWKGSKADSNKSKKIFVGGIPHNCGEPELRD 120

Query: 413 IF 418
            F
Sbjct: 121 YF 122



 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 25/74 (33%), Positives = 43/74 (58%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D ++  K+FVGG+     +  L+ YF+R+G V + V++ ++E  R RGFGF+TF     V
Sbjct: 97  DSNKSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSV 156

Query: 251 NLVLQNGPHQLDGR 292
           +  +    H + G+
Sbjct: 157 DQAVNMHFHDIMGK 170



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 20/54 (37%), Positives = 31/54 (57%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS 530
           + G      +P    +F R+G V EVV++YD  K++  G GF++FE E S  Q+
Sbjct: 106 VGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQA 159



 Score = 37.1 bits (82), Expect = 0.30
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V++ VIM D+   +S G GF+ F+D
Sbjct: 19  YFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD 50


>UniRef50_Q21911 Cluster: Putative uncharacterized protein msi-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein msi-1 - Caenorhabditis elegans
          Length = 320

 Score =  126 bits (305), Expect = 3e-28
 Identities = 62/129 (48%), Positives = 85/129 (65%), Gaps = 5/129 (3%)
 Frame = +2

Query: 53  RMNPDMDD-----DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGF 217
           R+N D DD      + GK+F+GGLSW+T+ ENL+ YF R+GEV +C+VM++  + R+RGF
Sbjct: 29  RLNADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGF 88

Query: 218 GFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
           GF+TF DPS V+ VL N  H+LDG+ IDPK   P+  Q  K      KVF+GGL +  T 
Sbjct: 89  GFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQ-AKLVTKTKKVFIGGLSATSTL 147

Query: 398 TDLRXIFRT 424
            D++  F T
Sbjct: 148 EDMKQYFET 156



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 29/83 (34%), Positives = 53/83 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS  ++ E++++YF  YG+V D ++M +  + R RGFGFVTF    + + V + 
Sbjct: 135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEI 194

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             H+++G+ ++ K   P+ +  P
Sbjct: 195 HFHEINGKMVECKKAQPKEVMLP 217



 Score = 39.1 bits (87), Expect = 0.075
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FGR+G+V E ++M D   K++ G GF++F D  S
Sbjct: 64  YFGRFGEVNECMVMRDPATKRARGFGFITFVDPSS 98



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 11/33 (33%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F  YGKV + ++M+D+  ++  G GF++F+ +
Sbjct: 153 YFETYGKVEDAMLMFDKATQRHRGFGFVTFDSD 185


>UniRef50_Q9UAF2 Cluster: Musashi; n=1; Halocynthia roretzi|Rep:
           Musashi - Halocynthia roretzi (Sea squirt)
          Length = 335

 Score =  123 bits (297), Expect = 3e-27
 Identities = 57/128 (44%), Positives = 83/128 (64%), Gaps = 5/128 (3%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DDE GK+F+GGL+ +T  + L+ YF  +GEV++ +VMK+  +G SRGFGFV F+D   V+
Sbjct: 5   DDEVGKIFIGGLARQTEDDGLRAYFESFGEVVESIVMKDKVTGFSRGFGFVKFSDQQSVS 64

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
            VL+NGPH LD + IDPKPC P+ +Q+ K+          K+F+GG+  + T  D++  F
Sbjct: 65  KVLKNGPHSLDNKKIDPKPCTPKGIQQEKKSAAMEHTQSHKIFIGGIAQSSTTEDVKKYF 124

Query: 419 RTLWEGHG 442
               EG G
Sbjct: 125 E---EGFG 129



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 30/92 (32%), Positives = 53/92 (57%), Gaps = 1/92 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           M+  +  K+F+GG++  ++ E++++YF   +G V + V + N E  R +GFGFVTFA+  
Sbjct: 98  MEHTQSHKIFIGGIAQSSTTEDVKKYFEEGFGTVNEVVFVINKEDNRHKGFGFVTFANEQ 157

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
            VN  +    H++  + I+ K   PR    P+
Sbjct: 158 AVNKAVDMHFHEIGDKQIEAKRATPREKMPPR 189



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F  +G+V+E ++M D+    S G GF+ F D+ S
Sbjct: 28  YFESFGEVVESIVMKDKVTGFSRGFGFVKFSDQQS 62


>UniRef50_Q9U5E3 Cluster: CiMsi; n=1; Ciona intestinalis|Rep: CiMsi
           - Ciona intestinalis (Transparent sea squirt)
          Length = 393

 Score =  123 bits (296), Expect = 4e-27
 Identities = 58/121 (47%), Positives = 80/121 (66%), Gaps = 5/121 (4%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D +E GK+FVGGL+ +T+ E L+ YF  YGEV DCV+MK+ E+G SRGFGFVTF +PS V
Sbjct: 5   DGEEAGKIFVGGLARQTTLEGLRSYFENYGEVSDCVLMKDKETGFSRGFGFVTFTNPSSV 64

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKR--GGGYP---KVFLGGLPSNVTETDLRXI 415
             V++  PH LD + IDPKPC  +  Q+ K+     Y    K+F+GG+    +E D++  
Sbjct: 65  AAVVKARPHNLDNKMIDPKPCTTKAAQQQKKVSSTNYSKAHKIFIGGISMEASEADVQSY 124

Query: 416 F 418
           F
Sbjct: 125 F 125



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 35/90 (38%), Positives = 51/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSE--SGRSRGFGFVTFADPSLVNLVL 262
           K+F+GG+S E S+ ++Q YF RYG V++ V + N E  S   +GFGFVTF D S V+  +
Sbjct: 106 KIFIGGISMEASEADVQSYFERYGTVVEVVFVVNKEDTSKPHKGFGFVTFEDESSVDQAI 165

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               H +  + ++ K    R     K GGG
Sbjct: 166 AKHYHIIKDKRVEAKKAESR----DKMGGG 191



 Score = 37.1 bits (82), Expect = 0.30
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQ--XKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F RYG V+EVV + ++    K   G GF++FEDE S  Q+  +  H
Sbjct: 124 YFERYGTVVEVVFVVNKEDTSKPHKGFGFVTFEDESSVDQAIAKHYH 170


>UniRef50_Q9VVE5 Cluster: CG32169-PA; n=9; Endopterygota|Rep:
           CG32169-PA - Drosophila melanogaster (Fruit fly)
          Length = 369

 Score =  122 bits (293), Expect = 8e-27
 Identities = 56/120 (46%), Positives = 81/120 (67%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P    ++ GK+F+GGLSW+TS E+L+ YF RYG++ + +VMK+  + RSRGFGFVTF+D
Sbjct: 20  SPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSD 79

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           P+ V+ VL  G H+LDG+ +DPK   PR    PK      K+F+GGL +  T  D++  F
Sbjct: 80  PNSVDKVLTQGTHELDGKKVDPKVAFPRRAH-PKMVTRTKKIFVGGLSAPTTLEDVKSYF 138



 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 33/95 (34%), Positives = 58/95 (61%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R +P M    K K+FVGGLS  T+ E+++ YF ++G + D ++M + ++ R RGFGFVTF
Sbjct: 108 RAHPKMVTRTK-KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTF 166

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V+ V +   H+++ + ++ K   P+ +  P
Sbjct: 167 QSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLP 201



 Score = 40.3 bits (90), Expect = 0.033
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FGRYG + E ++M D   ++S G GF++F D  S
Sbjct: 48  YFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNS 82


>UniRef50_Q8CD63 Cluster: 13 days embryo male testis cDNA, RIKEN
           full-length enriched library, clone:6030413L18
           product:Musashi homolog 2 (Drosophila), full insert
           sequence; n=3; Deuterostomia|Rep: 13 days embryo male
           testis cDNA, RIKEN full-length enriched library,
           clone:6030413L18 product:Musashi homolog 2 (Drosophila),
           full insert sequence - Mus musculus (Mouse)
          Length = 192

 Score =  120 bits (290), Expect = 2e-26
 Identities = 55/113 (48%), Positives = 79/113 (69%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+F+GGLSW+TS ++L+ YFS++GE+ +C+VM++  + RSRGFGFVTF DP+ V+ V
Sbjct: 19  DPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDPASVDKV 78

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L    H+LD +TIDPK   PR  Q PK      K+F+GGL +N    D++  F
Sbjct: 79  LGQPHHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSANTVVEDVKQYF 130



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/54 (40%), Positives = 34/54 (62%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           R  P M    K K+FVGGLS  T  E++++YF ++G+V D ++M +  + R RG
Sbjct: 100 RAQPKMVTRTK-KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRG 152


>UniRef50_O94432 Cluster: mRNA cleavage factor complex subunit; n=1;
           Schizosaccharomyces pombe|Rep: mRNA cleavage factor
           complex subunit - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 474

 Score =  119 bits (287), Expect = 4e-26
 Identities = 55/113 (48%), Positives = 78/113 (69%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+F+GGL+WET+ ++L+ YF ++GEV+DC VM++S +GRSRGFGF+TF +P  VN V
Sbjct: 161 EDGKMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEV 220

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +    H LDG+ IDPK   PR  Q+        K+F+GG+P + TE + R  F
Sbjct: 221 MSK-EHHLDGKIIDPKRAIPREEQEKT-----AKMFVGGVPGDCTEEEFRNFF 267



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 27/90 (30%), Positives = 53/90 (58%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P  + ++  K+FVGG+  + ++E  + +F+++G V+D  +M + ++GR RGFGFVT+
Sbjct: 236 RAIPREEQEKTAKMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTY 295

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
            + S V   +      + G+ ++ K   P+
Sbjct: 296 ENESAVEATMSQPYITIHGKPVEVKRATPK 325



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 11/35 (31%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF ++G+V++  +M D+   +  G GF+++E+E +
Sbjct: 266 FFNQFGRVLDATLMMDKDTGRPRGFGFVTYENESA 300


>UniRef50_O43347 Cluster: RNA-binding protein Musashi homolog 1;
           n=65; Euteleostomi|Rep: RNA-binding protein Musashi
           homolog 1 - Homo sapiens (Human)
          Length = 362

 Score =  116 bits (280), Expect = 3e-25
 Identities = 58/120 (48%), Positives = 79/120 (65%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +PD   D   K+F+GGLSW+T+QE L+ YF ++GEV +C+VM++  + RSRGFGFVTF D
Sbjct: 12  SPDSPHDPC-KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD 70

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T  D++  F
Sbjct: 71  QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTVEDVKQYF 129



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 99  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 157

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 158 ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 192



 Score = 37.9 bits (84), Expect = 0.17
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +FG++G+V E ++M D   K+S G GF++F D+
Sbjct: 39  YFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQ 71



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 128 YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 160


>UniRef50_Q4WHA5 Cluster: Heterogeneous nuclear ribonucleoprotein
           HRP1; n=1; Aspergillus fumigatus|Rep: Heterogeneous
           nuclear ribonucleoprotein HRP1 - Aspergillus fumigatus
           (Sartorya fumigata)
          Length = 608

 Score =  115 bits (277), Expect = 7e-25
 Identities = 54/113 (47%), Positives = 76/113 (67%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+F+GGL+WET+ ++L+ YFS++GEV +C VM++S +GRSRGFGF+TF DP  VN V
Sbjct: 103 EDGKMFIGGLNWETTDQSLRDYFSQFGEVQECTVMRDSATGRSRGFGFLTFKDPKTVNTV 162

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +    H LDG+ IDPK   PR  Q+        K+F+GG+    TE + +  F
Sbjct: 163 MVK-EHYLDGKIIDPKRAIPRDEQEKT-----SKIFVGGVSQEATEQEFKEFF 209



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 71  DDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           D+ EK  K+FVGG+S E +++  + +F+++G VID  +M + ++GR RGFGFVTF   + 
Sbjct: 183 DEQEKTSKIFVGGVSQEATEQEFKEFFTQFGRVIDATLMIDKDTGRPRGFGFVTFDSEAA 242

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR 322
           V   L   P  + G+ I+ K   PR
Sbjct: 243 VEAALSR-PLAICGKPIEVKKAQPR 266



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+V E  +M D    +S G GFL+F+D
Sbjct: 124 YFSQFGEVQECTVMRDSATGRSRGFGFLTFKD 155



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 11/35 (31%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF ++G+V++  +M D+   +  G GF++F+ E +
Sbjct: 208 FFTQFGRVIDATLMIDKDTGRPRGFGFVTFDSEAA 242


>UniRef50_Q8W555 Cluster: AT3g07810/F17A17_15; n=11;
           Magnoliophyta|Rep: AT3g07810/F17A17_15 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 494

 Score =  114 bits (274), Expect = 2e-24
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 13/126 (10%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GKLF+GG+SW+T++E L+ YFS +GEVI+ V++K+  +GR+RGFGFV FADP++  +V
Sbjct: 4   DNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQ-------------KPKRGGGYPKVFLGGLPSNVTET 400
           +    H +DGR ++ K   PR  Q              P   G   K+F+GGLPS+VTE+
Sbjct: 64  ITE-KHNIDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTES 122

Query: 401 DLRXIF 418
           D +  F
Sbjct: 123 DFKTYF 128



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 4/93 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++ + + YF ++G   D VVM +  + R RGFGF+T+     V  VL  
Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLK 168

Query: 269 GPHQLDGRTIDPKPCNPRTLQK-PKR---GGGY 355
             H+L+G+ ++ K   P+ L   P R   G GY
Sbjct: 169 TFHELNGKMVEVKRAVPKELSPGPSRSPLGAGY 201



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 13/45 (28%), Positives = 27/45 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G   +VV+MYD   ++  G GF++++ E +  +   +T H
Sbjct: 127 YFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFH 171


>UniRef50_O14979 Cluster: Heterogeneous nuclear ribonucleoprotein
           D-like; n=24; Mammalia|Rep: Heterogeneous nuclear
           ribonucleoprotein D-like - Homo sapiens (Human)
          Length = 420

 Score =  113 bits (273), Expect = 2e-24
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324


>UniRef50_A7SSE1 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 164

 Score =  113 bits (272), Expect = 3e-24
 Identities = 61/141 (43%), Positives = 82/141 (58%), Gaps = 3/141 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+  T    LQ YF +YGEV DCV+M +  + RSR FGF+TF DPS+V  V+ +
Sbjct: 2   KIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDD 61

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRG--GGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
            PHQLDG+ IDPKP  PR   Q P +G      K+F+GGL  + ++ DL   F    +  
Sbjct: 62  KPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVV 121

Query: 440 GGGHYV*SXEEKVXGFXILVF 502
                V    +K+ GF  + F
Sbjct: 122 SVNLMVDPQTQKMRGFGFVTF 142



 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 29/79 (36%), Positives = 50/79 (63%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  + + + K+FVGGL+  TS+++L+ YF+ YG+V+   +M + ++ + RGFGFVTF   
Sbjct: 86  PQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESK 145

Query: 242 SLVNLVLQNGPHQLDGRTI 298
             V        HQ++G+T+
Sbjct: 146 DSVTKAADEHYHQINGKTV 164



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F  YGKV+ V +M D   +K  G GF++FE + S
Sbjct: 113 YFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDS 147



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V + V+M D   K+S   GF++F D
Sbjct: 20  YFEKYGEVTDCVLMTDPVTKRSRCFGFITFRD 51


>UniRef50_Q6CC04 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 367

 Score =  112 bits (270), Expect = 5e-24
 Identities = 53/109 (48%), Positives = 74/109 (67%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +F+GGL+WET+ E+L  YF+++GEV++C VM++  SG+SRGFGF+TF DP  VN V+   
Sbjct: 1   MFIGGLNWETTDESLTNYFAQFGEVLECTVMRDHFSGKSRGFGFLTFRDPKCVNAVMAK- 59

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H LDG+ IDPK   PR  Q         K+F+GG+ S+VTE D +  F
Sbjct: 60  EHYLDGKIIDPKRAIPREEQDKT-----SKIFVGGVGSDVTEEDYKQFF 103



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 33/91 (36%), Positives = 53/91 (58%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P  + D+  K+FVGG+  + ++E+ +++F +YG VID  +M + +SGR RGFGFVTF
Sbjct: 72  RAIPREEQDKTSKIFVGGVGSDVTEEDYKQFFEQYGTVIDAQLMIDKDSGRPRGFGFVTF 131

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRT 325
                +N +L      L  + I+ K    R+
Sbjct: 132 DSEQAMNTILAQPLLILKDKPIEVKRAENRS 162



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+V+E  +M D    KS G GFL+F D
Sbjct: 18  YFAQFGEVLECTVMRDHFSGKSRGFGFLTFRD 49



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V++  +M D+   +  G GF++F+ E
Sbjct: 102 FFEQYGTVIDAQLMIDKDSGRPRGFGFVTFDSE 134


>UniRef50_Q66IT0 Cluster: MGC84815 protein; n=1; Xenopus laevis|Rep:
           MGC84815 protein - Xenopus laevis (African clawed frog)
          Length = 291

 Score =  111 bits (266), Expect = 2e-23
 Identities = 53/123 (43%), Positives = 78/123 (63%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           MR   D   D+  KLFVGGL+ +T++++L+ Y+S++GE+ D VVMK+  S +SRGFGFVT
Sbjct: 1   MRQVGDPKADQDKKLFVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVT 60

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
           F + S V+    + PH++DG+ +D K   PR    P+      K+F+GGL  +VT  DL 
Sbjct: 61  FKEASSVDKAQADRPHKVDGKDVDSKRAMPREETSPEVHAAVKKIFVGGLKKDVTNEDLA 120

Query: 410 XIF 418
             F
Sbjct: 121 EYF 123



 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 28/71 (39%), Positives = 41/71 (57%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL  + + E+L  YF ++G V D  ++   ++  SRGF FVTF D   V+ V+  
Sbjct: 104 KIFVGGLKKDVTNEDLAEYFGKFGNVTDASIVVAKDTNTSRGFAFVTFDDTDSVDKVILA 163

Query: 269 GPHQLDGRTID 301
            PH + G   D
Sbjct: 164 RPHMIGGHKAD 174



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 12/35 (34%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           ++ ++G++ +VV+M D    KS G GF++F++  S
Sbjct: 32  YYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASS 66


>UniRef50_A7RG33 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 177

 Score =  110 bits (265), Expect = 2e-23
 Identities = 54/124 (43%), Positives = 76/124 (61%), Gaps = 1/124 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL+W T++E L+ YFS++G ++DCV+MK    GRSRGFGFVT+     VN VL+ 
Sbjct: 1   KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMK--RDGRSRGFGFVTYESSDSVNEVLKK 58

Query: 269 GPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGHGG 445
             H LD R I+PK   PR     P+      K+F+GGL S   E D++  F +L   +G 
Sbjct: 59  KDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGM 118

Query: 446 GHYV 457
           G  +
Sbjct: 119 GEVI 122



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 28/86 (32%), Positives = 48/86 (55%), Gaps = 7/86 (8%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRY------GEVIDCVVMKNSESG-RSRGFGFVTFADPSL 247
           K+FVGGL+  T +E+++ YF+        GEVID  + ++ ++  R RGF FVTF +  +
Sbjct: 90  KIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEI 149

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRT 325
           V  V     H++  +  + K   P++
Sbjct: 150 VEKVCAMKYHEIRMKQCEVKKAEPQS 175


>UniRef50_Q9HEH4 Cluster: Related to heterogeneous nuclear
           ribonucleoprotein; n=13; Fungi/Metazoa group|Rep:
           Related to heterogeneous nuclear ribonucleoprotein -
           Neurospora crassa
          Length = 503

 Score =  110 bits (265), Expect = 2e-23
 Identities = 50/109 (45%), Positives = 74/109 (67%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +F+GGL+WET+ ++L+ YFS++GEV++C VM++  +GRSRGFGF+TF DP  VN+V+   
Sbjct: 1   MFIGGLNWETTDQSLRDYFSQFGEVVECTVMRDGATGRSRGFGFLTFKDPKTVNIVMVK- 59

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H LDG+ IDPK   PR  Q+        K+F+GG+    T+ + R  F
Sbjct: 60  EHYLDGKIIDPKRAIPRDEQEKT-----SKIFVGGVSQETTDHEFREYF 103



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 7/101 (6%)
 Frame = +2

Query: 71  DDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           D+ EK  K+FVGG+S ET+    + YF+++G V+D  +M + ++GR RGFGFVTF   + 
Sbjct: 77  DEQEKTSKIFVGGVSQETTDHEFREYFAQFGRVVDATLMMDKDTGRPRGFGFVTFESEAG 136

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR------TLQKPKRGGG 352
           V   L +   ++ G+ I+ K   PR        +  +RGGG
Sbjct: 137 VEACL-SANLEIHGKPIEVKKAQPRGNLREEAEEAARRGGG 176



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+V+E  +M D    +S G GFL+F+D
Sbjct: 18  YFSQFGEVVECTVMRDGATGRSRGFGFLTFKD 49



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 11/33 (33%), Positives = 22/33 (66%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G+V++  +M D+   +  G GF++FE E
Sbjct: 102 YFAQFGRVVDATLMMDKDTGRPRGFGFVTFESE 134


>UniRef50_Q9SU99 Cluster: HnRNP-like protein; n=10; core
           eudicotyledons|Rep: HnRNP-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 524

 Score =  110 bits (264), Expect = 3e-23
 Identities = 53/129 (41%), Positives = 81/129 (62%), Gaps = 18/129 (13%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GKLF+GG+SW+T +E LQ YF +YG++++ V+M++  +GR+RGFGF+ FADPS+   V+ 
Sbjct: 8   GKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIM 67

Query: 266 NGPHQLDGRTIDPKPCNPRTLQK-------------PKRGGG-----YPKVFLGGLPSNV 391
           +  H +DGRT++ K   PR  Q+             P  GG        K+F+GGLPS++
Sbjct: 68  D-KHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSI 126

Query: 392 TETDLRXIF 418
           TE + +  F
Sbjct: 127 TEAEFKNYF 135



 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 30/80 (37%), Positives = 48/80 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    ++   + YF ++G + D VVM +  + R RGFGF+TF     V++VL  
Sbjct: 116 KIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHK 175

Query: 269 GPHQLDGRTIDPKPCNPRTL 328
             H+L+G+ ++ K   P+ L
Sbjct: 176 TFHELNGKMVEVKRAVPKEL 195



 Score = 39.1 bits (87), Expect = 0.075
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F ++G + +VV+MYD   ++  G GF++F+ E S      +T H
Sbjct: 134 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFH 178



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FG+YG ++E VIM D+   ++ G GF+ F D
Sbjct: 27  YFGKYGDLVEAVIMRDRTTGRARGFGFIVFAD 58


>UniRef50_Q6PNM9 Cluster: AUF1 similar protein; n=3; Paracentrotus
           lividus|Rep: AUF1 similar protein - Paracentrotus
           lividus (Common sea urchin)
          Length = 361

 Score =  109 bits (263), Expect = 4e-23
 Identities = 52/124 (41%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R+    + ++  KLFVGGL+W T+ E LQ+YFS YG V DC + K+  + + RGFGF+
Sbjct: 37  GERIYASKEQEDDKKLFVGGLAWNTTPETLQQYFSAYGTVQDCEIKKDQVTKKPRGFGFI 96

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F     V  VL    H++D +TIDPKP NP  L+KP++     K+F+GG+ S++ + D+
Sbjct: 97  LFESADSVTKVLDVPEHKVDDKTIDPKPANP--LKKPEK---KKKIFIGGIGSDLKDDDI 151

Query: 407 RXIF 418
           +  F
Sbjct: 152 KSYF 155



 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP    ++K K+F+GG+  +   ++++ YFS++G V++    ++  +GR  GF FV +  
Sbjct: 126 NPLKKPEKKKKIFIGGIGSDLKDDDIKSYFSQFGTVVETEFPEDKTTGRRLGFAFVKYET 185

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPR--TLQKPKRGG 349
                    +  H +  + ++      R    Q+  RGG
Sbjct: 186 SDEAQKAQNSRFHTISNKKVEVSEAVSREERQQQKMRGG 224



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +3

Query: 387 TLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           T P+ +   +F  YG V +  I  DQ  KK  G GF+ FE   S
Sbjct: 61  TTPETLQ-QYFSAYGTVQDCEIKKDQVTKKPRGFGFILFESADS 103


>UniRef50_Q7XDI5 Cluster: RNA recognition motif family protein,
           expressed; n=5; Magnoliophyta|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 464

 Score = 95.9 bits (228), Expect(2) = 4e-23
 Identities = 43/87 (49%), Positives = 62/87 (71%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + ++GKLF+GG+SWET++E L+ +F+ YG+V    VM++  +GR RGFGFV F+DPS V+
Sbjct: 2   ESDQGKLFIGGISWETTEEKLRDHFAAYGDVSQAAVMRDKLTGRPRGFGFVVFSDPSSVD 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQK 334
             L + PH LDGRT+D K    R  Q+
Sbjct: 62  AALVD-PHTLDGRTVDVKRALSREEQQ 87



 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 34/88 (38%), Positives = 47/88 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    +++  ++YF  YG V D VVM +  + R RGFGF+TF     V+ VL  
Sbjct: 129 KIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHK 188

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H L G+ ++ K   PR        GG
Sbjct: 189 TFHDLSGKMVEVKRALPREANPGSGSGG 216



 Score = 39.9 bits (89), Expect = 0.043
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F  YG V +VV+MYDQ  ++  G GF++F+ E +  +   +T H
Sbjct: 147 YFQTYGVVTDVVVMYDQNTQRPRGFGFITFDAEDAVDRVLHKTFH 191



 Score = 34.7 bits (76), Expect(2) = 4e-23
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +2

Query: 344 GGGYPKVFLGGLPSNVTETDLRXIFRT 424
           G    K+F+GGLPSN+TE + R  F+T
Sbjct: 124 GARTKKIFVGGLPSNLTEDEFRQYFQT 150


>UniRef50_Q8MS04 Cluster: RH49436p; n=9; Endopterygota|Rep: RH49436p
           - Drosophila melanogaster (Fruit fly)
          Length = 634

 Score =  109 bits (262), Expect = 5e-23
 Identities = 49/115 (42%), Positives = 74/115 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+  + RSRGFGF+TF +P  V 
Sbjct: 199 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVE 258

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H LDG+ IDPK   P+   +P++     K+F+GG+  + +  +++  F
Sbjct: 259 KVLKVPIHTLDGKKIDPKHATPK--NRPRQANKTKKIFVGGVSQDTSAEEVKAYF 311



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 33/97 (34%), Positives = 57/97 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S +TS E ++ YFS++G V + V++ + ++ R RGFGFVTF +  +V+ V + 
Sbjct: 292 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEI 351

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
             H +  + ++ K   P+    P       ++ LG L
Sbjct: 352 HFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 388



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G V E V++ DQ  K+  G GF++FE+E
Sbjct: 310 YFSQFGPVEETVMLMDQQTKRHRGFGFVTFENE 342


>UniRef50_Q32LZ4 Cluster: Msi2h protein; n=4; Eutheria|Rep: Msi2h
           protein - Mus musculus (Mouse)
          Length = 193

 Score =  109 bits (261), Expect = 6e-23
 Identities = 49/92 (53%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+F+GGLSW+TS ++L+ YFS++GE+ +C+VM++  + RSRGFGFVTFADP+ V+ V
Sbjct: 19  DPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKV 78

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGG 352
           L    H+LD +TIDPK   PR  Q K +  GG
Sbjct: 79  LGQPHHELDSKTIDPKVAFPRRAQPKSQEQGG 110


>UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 588

 Score =  107 bits (258), Expect = 1e-22
 Identities = 56/134 (41%), Positives = 83/134 (61%), Gaps = 21/134 (15%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+GK+F+GGL+W+T++++L+RYFS++GEV +C +M+++ +GRSRGF F+ F DP  VN V
Sbjct: 167 EEGKMFIGGLNWDTTEDSLRRYFSQFGEVGNCAIMRDNMTGRSRGFAFLNFVDPKAVNTV 226

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY---------------------PKVFLGG 376
           +    H LDG+ IDPK   PR  Q  ++GGG+                      K+F+GG
Sbjct: 227 MVR-EHYLDGKVIDPKRAIPRP-QHNQQGGGHHNNYNNGGGGGGGGGSYSASSQKLFVGG 284

Query: 377 LPSNVTETDLRXIF 418
           LP +VT    R  F
Sbjct: 285 LPPSVTPATFRTFF 298



 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 31/73 (42%), Positives = 45/73 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL    +    + +F ++G + DC  M + E+G+ RGFGF+T+AD S +N VL  
Sbjct: 279 KLFVGGLPPSVTPATFRTFFEQFGTLSDCTCMMDRETGKPRGFGFLTYADDSSLNHVLNT 338

Query: 269 GPHQLDGRTIDPK 307
            P   DG+ +D K
Sbjct: 339 RPIVFDGKEVDVK 351


>UniRef50_A3LZT4 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 481

 Score =  106 bits (254), Expect = 4e-22
 Identities = 51/113 (45%), Positives = 76/113 (67%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+F+GGL+W+T++E L  YFS++GEV+D  +MK++ +G+SRGFGF+TF DP  V+ V
Sbjct: 158 ETGKMFIGGLNWDTTEEGLVSYFSKFGEVVDYTIMKDNNTGKSRGFGFLTFRDPKSVDEV 217

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           ++   H LDG+ IDPK    R  ++ K G    K+F+GG+   V E +    F
Sbjct: 218 IKT-DHILDGKLIDPKRAIARE-EQDKVG----KIFVGGIDPMVNEKEFHDFF 264



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/84 (39%), Positives = 52/84 (61%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + D+ GK+FVGG+    +++    +FS++G +ID  +M + +SGRSRGFGF+TF  P  V
Sbjct: 239 EQDKVGKIFVGGIDPMVNEKEFHDFFSQFGSIIDAQLMIDKDSGRSRGFGFITFDSPDAV 298

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR 322
           + V  N    L G+ ++ K   PR
Sbjct: 299 DRVTVNKFLTLKGKAMEVKRAEPR 322



 Score = 36.3 bits (80), Expect = 0.53
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  IM D    KS G GFL+F D  S
Sbjct: 179 YFSKFGEVVDYTIMKDNNTGKSRGFGFLTFRDPKS 213


>UniRef50_Q1ENZ5 Cluster: RNA-binding protein, putative; n=2;
           Magnoliophyta|Rep: RNA-binding protein, putative - Musa
           acuminata (Banana)
          Length = 465

 Score =  105 bits (253), Expect = 6e-22
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 12/123 (9%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GKLF+GG+SW+T++++L++YFS +GEV++ V+MK+  +GR+RGFGFV FADP++   V+ 
Sbjct: 6   GKLFIGGISWDTNEDSLRKYFSAFGEVVEAVIMKDRTTGRARGFGFVVFADPAVTERVVT 65

Query: 266 NGPHQLDGRTIDPKPCNPRT----LQKPKRGG--GYP------KVFLGGLPSNVTETDLR 409
              H +DGR ++ K   PR     L K       G P      K+F+GGL S +TE D +
Sbjct: 66  E-KHTIDGRMVEAKKAVPRDDHQFLNKNSSSSIHGSPVPGHTKKIFVGGLSSTITEGDFK 124

Query: 410 XIF 418
             F
Sbjct: 125 KYF 127



 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 30/78 (38%), Positives = 50/78 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS   ++ + ++YF ++G + D VVM +  + R RGFGF+T+     V+ VL N
Sbjct: 108 KIFVGGLSSTITEGDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVDKVLLN 167

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H+L+G+ ++ K   P+
Sbjct: 168 AFHELNGKMVEVKRAVPK 185



 Score = 37.1 bits (82), Expect = 0.30
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           T +  + G   T+ +     +F ++G + +VV+MYD   ++  G GF++++ E
Sbjct: 106 TKKIFVGGLSSTITEGDFKKYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSE 158



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  +G+V+E VIM D+   ++ G GF+ F D
Sbjct: 25  YFSAFGEVVEAVIMKDRTTGRARGFGFVVFAD 56


>UniRef50_Q86ER1 Cluster: Clone ZZD1516 mRNA sequence; n=2;
           Schistosoma japonicum|Rep: Clone ZZD1516 mRNA sequence -
           Schistosoma japonicum (Blood fluke)
          Length = 313

 Score =  105 bits (253), Expect = 6e-22
 Identities = 48/121 (39%), Positives = 78/121 (64%), Gaps = 1/121 (0%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N D   ++  KLF+GGL+  T++  L+ ++S++GE++D VVMK+  + RSRGFGF+T+ +
Sbjct: 8   NNDRRTEQFRKLFIGGLTPLTTEAKLKDFYSQWGEIVDVVVMKDGRTNRSRGFGFITYKE 67

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
           P +V+    N PH++DG+T++ K   PR     P+      K+F+GGL  +VT  +LR  
Sbjct: 68  PEMVDAAQANRPHEIDGKTVEAKRAMPREDSNSPESHMTVTKLFVGGLKKDVTHEELREY 127

Query: 416 F 418
           F
Sbjct: 128 F 128



 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 34/73 (46%), Positives = 44/73 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + + E L+ YFS+YG + +C V+   ESG SRGFGFVTF D   V+  +  
Sbjct: 109 KLFVGGLKKDVTHEELREYFSKYGNITECEVVAWKESGESRGFGFVTFDDYDPVDKAILY 168

Query: 269 GPHQLDGRTIDPK 307
            PH +     D K
Sbjct: 169 KPHHIGSSRADVK 181



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 10/32 (31%), Positives = 24/32 (75%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F+ ++G++++VV+M D    +S G GF+++++
Sbjct: 36  FYSQWGEIVDVVVMKDGRTNRSRGFGFITYKE 67


>UniRef50_Q6BL35 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=4;
           Saccharomycetales|Rep: Debaryomyces hansenii chromosome
           F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 495

 Score =  105 bits (252), Expect = 8e-22
 Identities = 51/122 (41%), Positives = 79/122 (64%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++ P     + GK+F+GGL+W+T+++ L  YF++YGEVID  +M+++ +G+SRGFGF+TF
Sbjct: 159 QLPPSNMGKDHGKMFIGGLNWDTTEQGLVEYFTKYGEVIDHTIMRDNNTGKSRGFGFLTF 218

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
            DP  V+ V++   H LDG+ IDPK    R  ++ K G    K+F+GG+   V E D   
Sbjct: 219 KDPKSVDEVIKT-DHILDGKLIDPKRAIARE-EQDKVG----KIFVGGIDPMVNEKDFND 272

Query: 413 IF 418
            F
Sbjct: 273 FF 274



 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 54/84 (64%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + D+ GK+FVGG+    ++++   +FS++G +ID  +M + ++GRSRGFGF+T+  P  V
Sbjct: 249 EQDKVGKIFVGGIDPMVNEKDFNDFFSQFGSIIDAQLMIDKDTGRSRGFGFITYDSPDAV 308

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR 322
           + V  N    L G++++ K   PR
Sbjct: 309 DRVTVNKYLTLKGKSMEVKRAEPR 332



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YG+V++  IM D    KS G GFL+F+D  S
Sbjct: 189 YFTKYGEVIDHTIMRDNNTGKSRGFGFLTFKDPKS 223


>UniRef50_UPI000023D975 Cluster: hypothetical protein FG10273.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10273.1 - Gibberella zeae PH-1
          Length = 552

 Score =  105 bits (251), Expect = 1e-21
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+F+GGL+WET+ ++L+ YF+++GEV++C VM++S +GRSRGFGF+TF D   VN+V
Sbjct: 119 EDGKMFIGGLNWETTDQSLRDYFAQFGEVVECTVMRDSSTGRSRGFGFLTFKDAKTVNIV 178

Query: 260 LQNGPHQLDGR-----TIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +    H LDG+      IDPK   PR  Q+        K+F+GG+    T+ + +  F
Sbjct: 179 MVK-EHFLDGKILILLQIDPKRAIPRDEQEKT-----SKIFVGGVSQETTDQEFKEYF 230



 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +2

Query: 71  DDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           D+ EK  K+FVGG+S ET+ +  + YF+++G V+D  +M + ++GR RGFGFVTF + + 
Sbjct: 204 DEQEKTSKIFVGGVSQETTDQEFKEYFAQFGRVVDATLMMDKDTGRPRGFGFVTFENEAG 263

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR 322
           V+  + N P ++ G+ I+ K   PR
Sbjct: 264 VDACI-NVPLEIHGKPIEVKKAQPR 287



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+V+E  +M D    +S G GFL+F+D
Sbjct: 140 YFAQFGEVVECTVMRDSSTGRSRGFGFLTFKD 171



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 11/33 (33%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G+V++  +M D+   +  G GF++FE+E
Sbjct: 229 YFAQFGRVVDATLMMDKDTGRPRGFGFVTFENE 261


>UniRef50_Q5TTQ2 Cluster: ENSANGP00000026814; n=3;
           Endopterygota|Rep: ENSANGP00000026814 - Anopheles
           gambiae str. PEST
          Length = 358

 Score =  104 bits (250), Expect = 1e-21
 Identities = 45/111 (40%), Positives = 74/111 (66%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ + L+ YF ++G+V+D VVMK+ ++ RSRGFGF+T++   +++    +
Sbjct: 28  KLFIGGLDYRTTDDTLKAYFEKWGKVVDVVVMKDPKTKRSRGFGFITYSKSYMIDDAQAS 87

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            PH++DGR ++PK   PR  + +P+ G    K+F+GGL  +  E  LR  F
Sbjct: 88  RPHKIDGRVVEPKRAVPRQDINRPEAGSSVKKLFVGGLRDDFDEEHLREYF 138



 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 30/78 (38%), Positives = 48/78 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E+L+ YFS+YG VI   ++ + ++G+ RGFGFV F D   V+ ++  
Sbjct: 119 KLFVGGLRDDFDEEHLREYFSKYGNVISACIVTDKDNGKKRGFGFVEFDDYDPVDKIILQ 178

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H +  + +D K   P+
Sbjct: 179 KSHTIQNKLLDVKKALPK 196



 Score = 35.9 bits (79), Expect = 0.70
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           +F ++GKV++VV+M D   K+S G GF+++
Sbjct: 46  YFEKWGKVVDVVVMKDPKTKRSRGFGFITY 75



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG V+   I+ D+   K  G GF+ F+D
Sbjct: 137 YFSKYGNVISACIVTDKDNGKKRGFGFVEFDD 168


>UniRef50_Q5DH48 Cluster: SJCHGC06087 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06087 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 390

 Score =  104 bits (250), Expect = 1e-21
 Identities = 52/118 (44%), Positives = 72/118 (61%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +DD+  KLFVGGLSWET++ +L+ YFSR+G+V  C++  +  +G SRGFGFVT     
Sbjct: 52  DENDDDSRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESED 111

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            V+ VL    H L  + IDPK   P   ++P R     K+F+GG+   VTE  +R  F
Sbjct: 112 CVSKVLSVSEHWLKNKKIDPKKAKPS--REPLR-----KIFVGGIDPEVTEDQIREYF 162



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 18/71 (25%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  E +++ ++ YFS +G+V    +  +++ G+ + + FV+F+  +     +  
Sbjct: 143 KIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISK 202

Query: 269 GPHQLDGRTID 301
              ++ GR  D
Sbjct: 203 ERQEIFGRQCD 213



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F R+GKV + +I  D+    S G GF++ E E
Sbjct: 78  YFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESE 110


>UniRef50_A4V6K1 Cluster: DAZ-associated protein; n=2;
           Platyhelminthes|Rep: DAZ-associated protein - Dugesia
           japonica (Planarian)
          Length = 296

 Score =  104 bits (250), Expect = 1e-21
 Identities = 53/125 (42%), Positives = 76/125 (60%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G RM  D   +E GKLFVGGL   T+ E+L+ YFS++G+V++  VM +  +GRSRGFG+V
Sbjct: 2   GTRMATDDLGNEIGKLFVGGLHQSTTNESLKSYFSKFGDVVEASVMMDHRTGRSRGFGYV 61

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            ++D   V  V+    H L+G+ IDPKPCN     + +R     K+F+GG+     E  L
Sbjct: 62  RYSDNEAVQKVMST-KHHLEGKEIDPKPCNVNMKGRSRR---QLKIFVGGIAPEHNEETL 117

Query: 407 RXIFR 421
           R  F+
Sbjct: 118 RDFFK 122



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 24/78 (30%), Positives = 47/78 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG++ E ++E L+ +F ++G + +  +MK+    R RGF FV F D ++V  ++ +
Sbjct: 102 KIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLIND 161

Query: 269 GPHQLDGRTIDPKPCNPR 322
               +  + ++ KP  P+
Sbjct: 162 HILTIGNKQVEIKPMEPQ 179


>UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A2/B1 isoform 1; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A2/B1 isoform 1
           - Strongylocentrotus purpuratus
          Length = 360

 Score =  104 bits (249), Expect = 2e-21
 Identities = 49/119 (41%), Positives = 76/119 (63%), Gaps = 3/119 (2%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + +++ KLF+GGLS+ T ++N++ YF ++GE++DC V+K+  S +S+GFGFVTFA    V
Sbjct: 8   EPEQERKLFLGGLSYNTKEDNIKEYFGQFGEIVDCCVIKDPTSLKSKGFGFVTFASRKEV 67

Query: 251 NLVL---QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           N V+   +  PH+LD R +D +    R  + PK      K F+GG+P   TE +LR  F
Sbjct: 68  NKVMGARKENPHRLDNRAVDVRRAMARDEKGPKNPSF--KCFVGGIPKETTEEELRAYF 124



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 32/108 (29%), Positives = 60/108 (55%), Gaps = 12/108 (11%)
 Frame = +2

Query: 68  MDDDEKG------KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M  DEKG      K FVGG+  ET++E L+ YFS++G++++  +        S+GF F+T
Sbjct: 92  MARDEKGPKNPSFKCFVGGIPKETTEEELRAYFSQFGQIVELAL------HLSKGFSFIT 145

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNPR------TLQKPKRGGGY 355
           + D   V+ ++    H ++G+ ++ K    +       +++ ++GGGY
Sbjct: 146 YDDTDCVDQIVMKKFHHINGKKVEGKKAYSKEEMRDMKMREQQQGGGY 193


>UniRef50_A7SCX6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 305

 Score =  104 bits (249), Expect = 2e-21
 Identities = 55/116 (47%), Positives = 75/116 (64%), Gaps = 1/116 (0%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD+ GKLFVGGLS+ET++E+L+ YFS+YGE++   +  ++ +GR RGF FV F   S  +
Sbjct: 25  DDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEAD 84

Query: 254 LVL-QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL Q  PH LDGRTIDPKP  P  + KP       K+F+GGL    ++  +R  F
Sbjct: 85  AVLNQVDPHVLDGRTIDPKPAAP--IGKPPH-LRVKKIFVGGLKPETSDEKIREYF 137



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSR-YGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           K+FVGGL  ETS E ++ YF + Y  V +   +    S R RGF FV+F     V+ + +
Sbjct: 118 KIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICE 177

Query: 266 NGPHQLDGRTIDPKPCNPRTLQK 334
              H ++G  ++ K   P+ +Q+
Sbjct: 178 TQFHNIEGNKVEVKRALPKEVQQ 200


>UniRef50_A4V6K2 Cluster: PRM10 protein; n=1; Dugesia japonica|Rep:
           PRM10 protein - Dugesia japonica (Planarian)
          Length = 325

 Score =  103 bits (246), Expect = 4e-21
 Identities = 50/116 (43%), Positives = 72/116 (62%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +DD+  KLFVGGLSWET++E+L+ YF  +G+V  CV+  +  +G SRGFGFVT      +
Sbjct: 67  EDDDSRKLFVGGLSWETTEEDLKNYFETWGKVAHCVIKLDKMTGNSRGFGFVTMDTEDSL 126

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             VL+   H+L  + IDPKP  P   ++P +     K+F+GGL   VTE  ++  F
Sbjct: 127 KKVLEVPEHRLKNKKIDPKPAKP--TKEPNK-----KIFVGGLSPEVTEEQIKEYF 175



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/78 (28%), Positives = 40/78 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS E ++E ++ YFS+YG V    +  ++  G+ + + F++F         + N
Sbjct: 156 KIFVGGLSPEVTEEQIKEYFSQYGSVESVDLPFDTSKGKRKPYVFLSFTTEDAAKNAIIN 215

Query: 269 GPHQLDGRTIDPKPCNPR 322
               + G   D +   P+
Sbjct: 216 EKQDVLGSKCDVRMAVPK 233


>UniRef50_Q14103 Cluster: Heterogeneous nuclear ribonucleoprotein
           D0; n=123; Deuterostomia|Rep: Heterogeneous nuclear
           ribonucleoprotein D0 - Homo sapiens (Human)
          Length = 355

 Score =  102 bits (245), Expect = 5e-21
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>UniRef50_A7SIF0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 190

 Score =  102 bits (244), Expect = 7e-21
 Identities = 51/125 (40%), Positives = 77/125 (61%), Gaps = 4/125 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++D + KLFVGGL+ ET+ E L+ YF  YGE+ D VV+ +S + +SRGFG+VTFAD  + 
Sbjct: 9   NNDPRAKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVT 68

Query: 251 NLVL----QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             VL    +NG H++DG+ ++ K   PR            K+F+GGLP + T+ D++   
Sbjct: 69  RNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQEAI 128

Query: 419 RTLWE 433
            +L E
Sbjct: 129 ESLLE 133



 Score = 37.1 bits (82), Expect = 0.30
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 3/91 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYF-SRYGEVIDCV--VMKNSESGRSRGFGFVT 229
           N     ++  K+FVGGL  + ++E++Q    S   E +D V  +MK  +  + RGF FV 
Sbjct: 99  NSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVE 158

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
             +    + +       + G+ ++ K   PR
Sbjct: 159 LNNEDQADELCCVKKIHVKGKMVEAKKATPR 189



 Score = 35.9 bits (79), Expect = 0.70
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G +R         +F  YG++ +VV++ D   KKS G G+++F D
Sbjct: 18  VGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFAD 64


>UniRef50_P48810 Cluster: Heterogeneous nuclear ribonucleoprotein
           87F; n=16; Coelomata|Rep: Heterogeneous nuclear
           ribonucleoprotein 87F - Drosophila melanogaster (Fruit
           fly)
          Length = 385

 Score =  101 bits (242), Expect = 1e-20
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>UniRef50_Q8W034 Cluster: Ribonucleoprotein 1; n=5; core
           eudicotyledons|Rep: Ribonucleoprotein 1 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 411

 Score =  101 bits (241), Expect = 2e-20
 Identities = 53/130 (40%), Positives = 77/130 (59%), Gaps = 15/130 (11%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D ++GKLFVGG+SWET ++ L+ +F+ YGEV   +VM++  +GR RGFGFV F+DPS+++
Sbjct: 2   DSDQGKLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLD 61

Query: 254 LVLQNGPHQLDGRTIDPKPCNPR----------TLQKPKRGGG-----YPKVFLGGLPSN 388
            VLQ   H +D R +D K    R           L   +  GG       K+F+GGLP  
Sbjct: 62  RVLQE-KHSIDTREVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPT 120

Query: 389 VTETDLRXIF 418
           +T+ + R  F
Sbjct: 121 LTDEEFRQYF 130



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 35/93 (37%), Positives = 48/93 (51%), Gaps = 5/93 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    + E  ++YF  YG V D  +M +  + R RGFGFV+F     V+ VL  
Sbjct: 111 KIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHK 170

Query: 269 GPHQLDGRTID-----PKPCNPRTLQKPKRGGG 352
             H L G+ ++     PK  NP    +   GGG
Sbjct: 171 TFHDLSGKQVEVKRALPKDANPGGGGRSMGGGG 203



 Score = 40.3 bits (90), Expect = 0.033
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSD 533
           T +  + G   TL       +F  YG V +V IMYDQ   +  G GF+SF+ E +     
Sbjct: 109 TKKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVL 168

Query: 534 PRTLH 548
            +T H
Sbjct: 169 HKTFH 173


>UniRef50_Q99383 Cluster: Nuclear polyadenylated RNA-binding protein
           4; n=7; Saccharomycetales|Rep: Nuclear polyadenylated
           RNA-binding protein 4 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 534

 Score =  100 bits (240), Expect = 2e-20
 Identities = 49/113 (43%), Positives = 74/113 (65%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  K+F+GGL+W+T+++NL+ YF +YG V D  +MK+  +GRSRGFGF++F  PS V+ V
Sbjct: 157 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV 216

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           ++   H LDG+ IDPK   PR  ++ K G    K+F+GG+  +V   +    F
Sbjct: 217 VKT-QHILDGKVIDPKRAIPRD-EQDKTG----KIFVGGIGPDVRPKEFEEFF 263



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 35/100 (35%), Positives = 56/100 (56%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P  + D+ GK+FVGG+  +   +  + +FS++G +ID  +M + ++G+SRGFGFVT+
Sbjct: 232 RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY 291

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
                V+ V QN       R I+ K   PR +Q+     G
Sbjct: 292 DSADAVDRVCQNKFIDFKDRKIEIKRAEPRHMQQKSSNNG 331



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FG+YG V ++ IM D    +S G GFLSFE   S
Sbjct: 178 YFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSS 212


>UniRef50_UPI00015560CE Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A1; n=4; Mammalia|Rep:
           PREDICTED: similar to heterogeneous nuclear
           ribonucleoprotein A1 - Ornithorhynchus anatinus
          Length = 280

 Score = 99.1 bits (236), Expect = 7e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 15/40 (37%), Positives = 25/40 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRS 208
           K+FVGG+  +T + +L+ YF +YG++     +   ES RS
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIERKQSLAGEESQRS 145


>UniRef50_P09651 Cluster: Heterogeneous nuclear ribonucleoprotein
           A1; n=390; Euteleostomi|Rep: Heterogeneous nuclear
           ribonucleoprotein A1 - Homo sapiens (Human)
          Length = 372

 Score = 99.1 bits (236), Expect = 7e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>UniRef50_Q9LHL2 Cluster: Similarity to RNA binding protein; n=13;
           Magnoliophyta|Rep: Similarity to RNA binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 358

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 44/117 (37%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D    GK+F+GGL  +T+     ++F +YGE+ D V+M++  +G+ RGFGF+TFADPS+V
Sbjct: 14  DGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVV 73

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           + V+++  H ++G+ ++ K   P+       +     K+F+GG+PS VTE +L+  F
Sbjct: 74  DKVIED-THVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 30/99 (30%), Positives = 56/99 (56%), Gaps = 3/99 (3%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVGG+    +++ L+ +F++YG V++  V+++ E+ RSRGFGFV F    +V+
Sbjct: 105 DIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVD 164

Query: 254 LVLQNGPH-QLDGRTIDPKPCNPRTL--QKPKRGGGYPK 361
            +L  G    +    ++ K   P+    + P   G +P+
Sbjct: 165 ELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYGSHPR 203



 Score = 38.7 bits (86), Expect = 0.100
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G H+     +    FG+YG++ + VIM D+   +  G GF++F D
Sbjct: 23  IGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFAD 69



 Score = 36.3 bits (80), Expect = 0.53
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +3

Query: 333 NRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           N++  + T +  + G   T+ +     FF +YG V+E  ++ D    +S G GF+ F+ E
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE 160


>UniRef50_Q8W4A6 Cluster: Putative uncharacterized protein MJH23.3;
           n=2; Arabidopsis thaliana|Rep: Putative uncharacterized
           protein MJH23.3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 231

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 44/117 (37%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D    GK+F+GGL  +T+     ++F +YGE+ D V+M++  +G+ RGFGF+TFADPS+V
Sbjct: 14  DGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVV 73

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           + V+++  H ++G+ ++ K   P+       +     K+F+GG+PS VTE +L+  F
Sbjct: 74  DKVIED-THVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 25/66 (37%), Positives = 44/66 (66%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVGG+    +++ L+ +F++YG V++  V+++ E+ RSRGFGFV F    +V+
Sbjct: 105 DIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVD 164

Query: 254 LVLQNG 271
            +L  G
Sbjct: 165 ELLSKG 170



 Score = 38.7 bits (86), Expect = 0.100
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G H+     +    FG+YG++ + VIM D+   +  G GF++F D
Sbjct: 23  IGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFAD 69



 Score = 36.3 bits (80), Expect = 0.53
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +3

Query: 333 NRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           N++  + T +  + G   T+ +     FF +YG V+E  ++ D    +S G GF+ F+ E
Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSE 160


>UniRef50_Q5K6W6 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 480

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 50/119 (42%), Positives = 73/119 (61%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R+ P  D  ++GK+F+GGL+WET++  L  Y  ++GE+  C +M++  SGRSRGF F+T+
Sbjct: 102 RIKPS-DMPDEGKMFIGGLNWETTEAGLSEYMGQFGEIDACTIMRD-PSGRSRGFAFLTY 159

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLR 409
            DP+ V  V+    H LDG+ IDPK   PR   +        KVF+GGL  +VT   L+
Sbjct: 160 RDPASVTKVMAQ-THHLDGKQIDPKRAIPRAEHERT-----AKVFVGGLAPSVTGESLK 212



 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P  + +   K+FVGGL+   + E+L+ +  ++G+V+D  VM + E+GRS+GF F TF
Sbjct: 184 RAIPRAEHERTAKVFVGGLAPSVTGESLKSFLCQFGQVMDATVMFDKETGRSKGFAFATF 243

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGG 349
            D   V   +     +L+G+ I+ K   PR T Q  K GG
Sbjct: 244 QDEESVGRAMAASGVELEGKQIEIKKAQPRGTAQGSKFGG 283



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  ++G+VM+  +M+D+   +S G  F +F+DE S
Sbjct: 214 FLCQFGQVMDATVMFDKETGRSKGFAFATFQDEES 248


>UniRef50_P51991 Cluster: Heterogeneous nuclear ribonucleoprotein
           A3; n=98; Coelomata|Rep: Heterogeneous nuclear
           ribonucleoprotein A3 - Homo sapiens (Human)
          Length = 378

 Score = 95.5 bits (227), Expect = 8e-19
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ ++L+ +F ++G + DCVVM++ ++ RSRGFGFVT++    V
Sbjct: 30  EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEV 89

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R    KP       K+F+GG+  +  E +LR  F
Sbjct: 90  DAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYF 146



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + NL+ YF +YG++    VM++ +SG+ RGF FVTF D   V+ ++  
Sbjct: 127 KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQ 186

Query: 269 GPHQLDGRTIDPK 307
             H ++G   + K
Sbjct: 187 KYHTINGHNCEVK 199


>UniRef50_Q9LNP1 Cluster: F1L3.34; n=2; Arabidopsis thaliana|Rep:
           F1L3.34 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 392

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 2/112 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+SWET+ E    YF ++GEV+D V+M +  +G  RGFGFVTFAD ++   VL+ 
Sbjct: 90  KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE 149

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP--KRGGGYPKVFLGGLPSNVTETDLRXIF 418
             H +D R +D K   PR  +    K      K+F+GGLP  + E +L+  F
Sbjct: 150 -DHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYF 200



 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 1/79 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL     ++ L+ YF  YG++I+  +M +  +GRSRGFGFVTF     V+ +  +
Sbjct: 181 KIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSD 240

Query: 269 GP-HQLDGRTIDPKPCNPR 322
           G  H+L  + ++ K   P+
Sbjct: 241 GKVHELGDKQVEIKRAEPK 259



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F  YG ++E  IMYD    +S G GF++F+ E S
Sbjct: 199 YFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDS 233



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FG++G+V++ VIM D+      G GF++F D
Sbjct: 108 YFGKFGEVVDSVIMTDRITGNPRGFGFVTFAD 139


>UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;
           Magnoliophyta|Rep: Similarity to RNA binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 423

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 46/119 (38%), Positives = 74/119 (62%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D  GK+FVGGL+ ET+     ++F +YGE+ D V+MK+ ++G+ RGFGFVT+AD S+V+ 
Sbjct: 39  DSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDK 98

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
           V+Q+  H + G+ ++ K   PR            K+F+GG+PS+V + + +  F    E
Sbjct: 99  VIQDN-HIIIGKQVEIKRTIPRG-SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGE 155



 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 32/106 (30%), Positives = 58/106 (54%), Gaps = 4/106 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D +  K+FVGG+      +  + +F ++GE+ +  +M++  +GRSRGFGFVT+    +V
Sbjct: 125 NDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMV 184

Query: 251 NLVLQNGPH-QLDGRTIDPK---PCNPRTLQKPKRGGGYPKVFLGG 376
           + +L  G   +L G  ++ K   P  P ++  P +  G  +   GG
Sbjct: 185 DHLLAKGNRIELSGTQVEIKKAEPKKPNSVTTPSKRFGDSRSNFGG 230



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG+YG++ + VIM D+   +  G GF+++ D
Sbjct: 62  FGKYGEITDSVIMKDRKTGQPRGFGFVTYAD 92


>UniRef50_Q02926 Cluster: Ribonucleoprotein RB97D; n=7;
           Sophophora|Rep: Ribonucleoprotein RB97D - Drosophila
           melanogaster (Fruit fly)
          Length = 471

 Score = 94.7 bits (225), Expect = 1e-18
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 39.1 bits (87), Expect = 0.075
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>UniRef50_UPI0000E4934F Cluster: PREDICTED: similar to musashi
           nrp-1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to musashi nrp-1 - Strongylocentrotus
           purpuratus
          Length = 229

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 41/98 (41%), Positives = 66/98 (67%)
 Frame = +2

Query: 125 QENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDP 304
           +  L++YF ++GEV +CV+M+++ + RSRGFGFVTF+DP+ V  V+Q G H++D + +DP
Sbjct: 40  KHGLRKYFCQFGEVKECVIMRDTTTRRSRGFGFVTFSDPAHVETVIQRGTHEVDKKKVDP 99

Query: 305 KPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           K   P+    PK      K+F+GG+ ++ TE  L+  F
Sbjct: 100 KVAFPKR-SHPKPVSKTKKIFVGGIAASTTEPHLKKFF 136



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 29/84 (34%), Positives = 54/84 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG++  T++ +L+++F +YG+V +  +M +  + R RGFGFV F +   V+ V + 
Sbjct: 117 KIFVGGIAASTTEPHLKKFFEKYGKVEEVTLMFDRTTNRHRGFGFVIFDNEKTVDSVCEE 176

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK 340
             H+LDG+ ++ K   P+ +  P+
Sbjct: 177 HFHELDGKLVEVKKAQPKEVMMPQ 200



 Score = 40.7 bits (91), Expect = 0.025
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           T +  + G   +  +P    FF +YGKV EV +M+D+   +  G GF+ F++E
Sbjct: 115 TKKIFVGGIAASTTEPHLKKFFEKYGKVEEVTLMFDRTTNRHRGFGFVIFDNE 167



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+V E VIM D   ++S G GF++F D
Sbjct: 46  YFCQFGEVKECVIMRDTTTRRSRGFGFVTFSD 77


>UniRef50_UPI0000F2CBBE Cluster: PREDICTED: similar to musashi
           homolog 1 (Drosophila),; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to musashi homolog 1 (Drosophila), -
           Monodelphis domestica
          Length = 432

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 46/99 (46%), Positives = 63/99 (63%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTID 301
           + E L+ YF ++GEV +C+VM++  + RSRGFGFVTF D + V+ VL    H+LD +TID
Sbjct: 117 AHEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTID 176

Query: 302 PKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           PK   PR  Q PK      K+F+GGL  N T  D++  F
Sbjct: 177 PKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTVEDVKQYF 214



 Score = 37.9 bits (84), Expect = 0.17
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +FG++G+V E ++M D   K+S G GF++F D+
Sbjct: 124 YFGQFGEVKECLVMRDPLTKRSRGFGFVTFVDQ 156



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEV 166
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V
Sbjct: 184 RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKV 220


>UniRef50_A4R1M8 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 530

 Score = 92.7 bits (220), Expect = 6e-18
 Identities = 44/101 (43%), Positives = 64/101 (63%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRT 295
           +   E+L+ YFS++GEVI+C VM++  +GRSRGFGF+TF DP  VN+V+    H LDG+ 
Sbjct: 91  QADDESLRDYFSQFGEVIECTVMRDGTTGRSRGFGFLTFKDPKTVNIVMVK-EHYLDGKI 149

Query: 296 IDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           IDPK   PR  Q+        K+F+GG+    T+ + +  F
Sbjct: 150 IDPKRAIPRDEQEKT-----SKIFVGGVSQETTDQEFKDFF 185



 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 33/85 (38%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query: 71  DDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           D+ EK  K+FVGG+S ET+ +  + +F+++G V+D  +M + ++GR RGFGFVTF   + 
Sbjct: 159 DEQEKTSKIFVGGVSQETTDQEFKDFFAQFGRVVDATLMMDKDTGRPRGFGFVTFESEAG 218

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR 322
           V   L     ++ G+ I+ K   PR
Sbjct: 219 VEACLAR-DLEIHGKLIEVKKAQPR 242



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F ++G+V+E  +M D    +S G GFL+F+D
Sbjct: 100 YFSQFGEVIECTVMRDGTTGRSRGFGFLTFKD 131



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF ++G+V++  +M D+   +  G GF++FE E
Sbjct: 184 FFAQFGRVVDATLMMDKDTGRPRGFGFVTFESE 216


>UniRef50_Q26658 Cluster: Stage specific activator protein; n=3;
           Strongylocentrotus purpuratus|Rep: Stage specific
           activator protein - Strongylocentrotus purpuratus
           (Purple sea urchin)
          Length = 382

 Score = 92.3 bits (219), Expect = 8e-18
 Identities = 45/119 (37%), Positives = 72/119 (60%), Gaps = 3/119 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSES-GRSRGFGFVTFADPSLVN 253
           +E GK+FVGG+   T  +  + YF ++G++ D ++M + +  G+++GFGFVTFADP+ V+
Sbjct: 3   EEIGKIFVGGVDRNTHADTFRAYFEKFGKLSDIILMMDKDKPGQNKGFGFVTFADPACVD 62

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY--PKVFLGGLPSNVTETDLRXIFRT 424
            V     H L+G+ +D K C  R  +K    G     KVF+GG+    T+ DL  +FR+
Sbjct: 63  DVTNEKNHNLEGKGLDCKRCKARGSEKRMGPGDQRTKKVFVGGISQQATKEDLYELFRS 121



 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 35/102 (34%), Positives = 56/102 (54%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           RM P   D    K+FVGG+S + ++E+L   F  +G V D  +M ++++G+ RGFGFVT 
Sbjct: 90  RMGPG--DQRTKKVFVGGISQQATKEDLYELFRSHGNVEDVHIMNDTDTGKHRGFGFVTL 147

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
                V  +++    +L G++++ K   P    K  RG G P
Sbjct: 148 DSEEAVEKLVRMHHLELKGKSMEIKKAQP----KMNRGFGGP 185


>UniRef50_Q4S8N9 Cluster: Chromosome 7 SCAF14703, whole genome
           shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 7
           SCAF14703, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 157

 Score = 91.5 bits (217), Expect = 1e-17
 Identities = 38/79 (48%), Positives = 58/79 (73%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+F+GGLSW+TS ++L+ YFS++GE+ +C+VM++  + RSRGFGFVTF D + V+ V
Sbjct: 19  DPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKV 78

Query: 260 LQNGPHQLDGRTIDPKPCN 316
           L    H+LD +T     C+
Sbjct: 79  LAQQHHELDSKTFKLLQCS 97


>UniRef50_Q9D3U4 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:4933434H11 product:similar to
           telomeric and tetraplex DNA binding protein qTBP42 V;
           n=2; Murinae|Rep: Adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933434H11
           product:similar to telomeric and tetraplex DNA binding
           protein qTBP42 V - Mus musculus (Mouse)
          Length = 565

 Score = 91.5 bits (217), Expect = 1e-17
 Identities = 46/126 (36%), Positives = 73/126 (57%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +++   +  +  K+F+GGLS E S++ L  Y S++GE+ID ++  +  +G SRGFGFV
Sbjct: 20  GFKIDATKNQQDASKMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFV 79

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VLQ   H++DG+ I+ K       Q P +     K+F+GGL   ++E  +
Sbjct: 80  LFKDSATVEKVLQVKDHKVDGKKIEFKRAKALESQFPNK-----KIFVGGLNPRLSEEKI 134

Query: 407 RXIFRT 424
           R  F T
Sbjct: 135 RAYFGT 140



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 24/78 (30%), Positives = 42/78 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   S+E ++ YF  +G++    +   S++   R FGF+ + D + V  VL+N
Sbjct: 119 KIFVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLEN 178

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H +     + K   P+
Sbjct: 179 RYHFIGSSRCEVKMAYPK 196


>UniRef50_Q7XI13 Cluster: Glycine-rich RNA-binding protein-like;
           n=9; Magnoliophyta|Rep: Glycine-rich RNA-binding
           protein-like - Oryza sativa subsp. japonica (Rice)
          Length = 308

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M + E G++FVGGLSW+T++  L+R FS YG+VI+  V+   ++GRSRGFGFVTF++P  
Sbjct: 1   MAEKEVGRIFVGGLSWDTTERTLERAFSEYGKVIETQVVLERDTGRSRGFGFVTFSEPRA 60

Query: 248 VNLVLQNGPH--QLDGRTIDPKPCNPR 322
           V+  ++ G H  +LDGRTI      PR
Sbjct: 61  VDAAIR-GMHNGELDGRTISVNKAQPR 86


>UniRef50_A4V6N1 Cluster: HnRNP A2/B1 protein; n=1; Dugesia
           japonica|Rep: HnRNP A2/B1 protein - Dugesia japonica
           (Planarian)
          Length = 386

 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 45/123 (36%), Positives = 70/123 (56%), Gaps = 1/123 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  ++  K+FVGGL  +T++ ++++YFS+YG+V D V M++    +SRGFGFV F +   
Sbjct: 12  MTQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEAES 71

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
           V+      PHQL G+ +D K   P+     P       ++F+GG+    TE DL+  F T
Sbjct: 72  VDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEDDLKDYFST 131

Query: 425 LWE 433
             E
Sbjct: 132 FGE 134



 Score = 75.4 bits (177), Expect = 9e-13
 Identities = 33/94 (35%), Positives = 62/94 (65%), Gaps = 1/94 (1%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +NPD+  + K ++F+GG+    ++++L+ YFS +GE++DC + +++ SG SRGF F+TF 
Sbjct: 100 LNPDIHCNSK-RIFIGGIRRFFTEDDLKDYFSTFGEIVDCTIKRDNVSGLSRGFAFITFT 158

Query: 236 DPSLVNLVLQNGPHQLDGRTID-PKPCNPRTLQK 334
           D  +V+ V+ + PH +    +D  K  +P  L++
Sbjct: 159 DRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQ 192



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YG V +VV M D+   KS G GF+ F++  S
Sbjct: 37  YFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEAES 71


>UniRef50_UPI0001560FCC Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 501

 Score = 88.6 bits (210), Expect = 9e-17
 Identities = 47/126 (37%), Positives = 71/126 (56%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R+    +  +  K+F+GGLS   S++ L  Y S++GEV+D ++  +  +G SRGFGFV
Sbjct: 83  GFRIEATRNQQDGSKMFIGGLSGNVSKQGLLDYLSQFGEVVDFIIKIHPGTGLSRGFGFV 142

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VLQ   H+LDG+TI  +       + P +     KVF+GGL   ++E  +
Sbjct: 143 LFKDSATVEKVLQVKEHKLDGKTIQLRRAKAVVSRFPPK-----KVFVGGLNPRLSEEKI 197

Query: 407 RXIFRT 424
           R  F T
Sbjct: 198 RQYFGT 203



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 28/88 (31%), Positives = 51/88 (57%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+   S+E +++YF  +G + D  +  NS++   R F F+T+AD   V  +L+ 
Sbjct: 182 KVFVGGLNPRLSEEKIRQYFGTFGVIQDIKLPVNSKTNERRAFCFITYADEKAVRKLLET 241

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H++  R  + K   P+  ++ ++ GG
Sbjct: 242 RYHRIGSRRCEVKIAFPKEYKRLRQLGG 269


>UniRef50_UPI0000DB6DF2 Cluster: PREDICTED: similar to squid
           CG16901-PC, isoform C; n=2; Apocrita|Rep: PREDICTED:
           similar to squid CG16901-PC, isoform C - Apis mellifera
          Length = 320

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 45/115 (39%), Positives = 72/115 (62%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DDE+ KLFVGGLS  T+ + L+ +FS++GE+    V  +  +G SRGF F+ F +P  ++
Sbjct: 56  DDER-KLFVGGLSRNTTDKELRDHFSKFGEIESISVKIDPYTGISRGFAFMVFTNPKTID 114

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            +L +G H ++ R +DPK    R  +KP+ G    K+F+GGL   +T+ D++  F
Sbjct: 115 KLLASGEHYINKRKVDPK----RVSKKPQHG----KIFVGGLTPEITDEDIKTYF 161



 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+FVGGL+ E + E+++ YF +YG +++     +    + +GF F+TF    +V  +
Sbjct: 139 QHGKIFVGGLTPEITDEDIKTYFGQYGTIVELQAPFDKVKNQRKGFCFITFDSKEVVYKL 198

Query: 260 LQNGPHQLDGRTIDPK--PCNPRTLQKPKRGGGYPKVFLGG 376
           L+     ++G+ +D K    NP    +     GY   + GG
Sbjct: 199 LKTPKQTINGKEVDVKKVKVNPDPRNQGFWSPGYGYGYGGG 239


>UniRef50_Q54D98 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 687

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 48/120 (40%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSE-SGRSRGFGFVTFADPSLVN-LV 259
           GK+FVGGL   +S E L+ YFS +GEV + +V+K +E + +SRGFGFVTF DPS+++ ++
Sbjct: 106 GKIFVGGLLKTSSNEILKDYFSNFGEVKESIVIKATEKASKSRGFGFVTFVDPSVIDEVI 165

Query: 260 LQNGPHQLDGRTIDPKPCNPR--TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
           L N  H ++G+ ++ +   P+    ++PK+     K+F+GGLP ++T  D    F    E
Sbjct: 166 LIN--HSIEGKNVEIRRAIPKEEMTEEPKK----QKLFVGGLPKHITSDDFNNYFSEFGE 219



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/77 (32%), Positives = 46/77 (59%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++ +K KLFVGGL    + ++   YFS +GE+ +  ++   ++G  +GFGF+ F D S+ 
Sbjct: 189 EEPKKQKLFVGGLPKHITSDDFNNYFSEFGEISEYNLL-TEKNGTIKGFGFICFKDESVN 247

Query: 251 NLVLQNGPHQLDGRTID 301
            ++L    H + G+ +D
Sbjct: 248 EIILNEQQHIILGKRVD 264


>UniRef50_A3FQK0 Cluster: RNA recognition motif (RRM)-containing
           protein; n=2; Cryptosporidium|Rep: RNA recognition motif
           (RRM)-containing protein - Cryptosporidium parvum Iowa
           II
          Length = 202

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 40/81 (49%), Positives = 54/81 (66%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+FVGGLS + +   L  YF ++G ++D VVM ++ SGRSRGFGFVTF DP  V +V
Sbjct: 6   ESGKIFVGGLSQQVTSSILMEYFLQFGVILDAVVMYDNVSGRSRGFGFVTFKDPKTVEIV 65

Query: 260 LQNGPHQLDGRTIDPKPCNPR 322
               PH + G+ +D K  +PR
Sbjct: 66  QNITPHIIMGKVVDCKRASPR 86



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           K+FVGGL  + + E  + YF R+G + D V++ +  +GR RGFGFVTF     VN V + 
Sbjct: 122 KIFVGGLP-DLTLEEFKIYFQRFGNIKDAVLITDKNNGRPRGFGFVTFESVDAVNNVTKF 180

Query: 266 NGPHQLDGRTIDPKPCNPR 322
              H L G+ ++ K   PR
Sbjct: 181 YSNHYLKGKWVECKRALPR 199



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           + G  + +   I   +F ++G +++ V+MYD    +S G GF++F+D
Sbjct: 12  VGGLSQQVTSSILMEYFLQFGVILDAVVMYDNVSGRSRGFGFVTFKD 58


>UniRef50_UPI0000E45D7B Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A3, partial; n=2;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A3, partial -
           Strongylocentrotus purpuratus
          Length = 614

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 45/120 (37%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRS-RGFGFVTFADPSL 247
           + ++  K+F+GGLS++T++E++  YF ++GE+ DC V+++ +  R  RGFGFVT+A  + 
Sbjct: 460 EPEQMRKMFLGGLSFDTTEESVNEYFKKFGELTDCCVVRHKDGDRKPRGFGFVTYATSAC 519

Query: 248 VNLVL---QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V+ V+   ++  H LDGR ID K   P+     K      K F+GGL    T  DL+  F
Sbjct: 520 VDKVIDAKKDSAHVLDGREIDVKRALPKEEGGSKESTN--KAFVGGLAPGTTAEDLKAYF 577



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 26/62 (41%), Positives = 39/62 (62%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +   K FVGGL+  T+ E+L+ YF+ YG V D  +  ++E G+ R FGFVTF D   V+ 
Sbjct: 554 ESTNKAFVGGLAPGTTAEDLKAYFTNYGVVTDVSIPPSTE-GKKRVFGFVTFEDSDTVDK 612

Query: 257 VL 262
           ++
Sbjct: 613 LI 614


>UniRef50_Q9VFT3 Cluster: CG9654-PA; n=4; Drosophila
           melanogaster|Rep: CG9654-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 428

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 42/92 (45%), Positives = 60/92 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS +T+ E L+ +FS++G V D VV+++  S  SRGFGFVT+ DP  V +V + 
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKV 364
            PH +D + ++ K   PR  Q  KRGGG   V
Sbjct: 93  RPHTIDNKIVETKHALPR--QDFKRGGGVGSV 122



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQR-YFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++F+GGL  E   EN+ R YFS++G V    ++ + E+GR R FGF+ F DPS     L 
Sbjct: 137 RIFLGGLK-EYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
              H +    ++ K    R+ QK  R   +P
Sbjct: 196 PRKHWILQTLVEVK----RSTQKADRRFRFP 222


>UniRef50_Q4UI71 Cluster: RNA-binding (SR) protein, putative; n=2;
           Theileria|Rep: RNA-binding (SR) protein, putative -
           Theileria annulata
          Length = 303

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 47/117 (40%), Positives = 69/117 (58%), Gaps = 2/117 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D E  K+F GGL+  T+ E+L+ YFS+YGEV    ++++  +GRSRGFGFVTFAD   VN
Sbjct: 24  DYESLKIFAGGLTRSTTPEDLKEYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDSVN 83

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQK--PKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H++DG   D K    +   K    +     ++F+GG+   +TE+  R  F
Sbjct: 84  TVLRK-VHKIDGVEADVKLAVRKEKSKILAPQYDQTKRIFVGGVSEKITESYFRDYF 139



 Score = 45.6 bits (103), Expect = 9e-04
 Identities = 24/86 (27%), Positives = 45/86 (52%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  ++FVGG+S + ++   + YF+RYG +     + +  + R RG+GFV +   ++ + 
Sbjct: 116 DQTKRIFVGGVSEKITESYFRDYFARYGPITSYNYLVDRATNRPRGYGFVIY--ENMEDA 173

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQK 334
               G H   GR  + K   P+  +K
Sbjct: 174 EKSIGMHLSLGRNCEAKFAEPKYPEK 199



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +3

Query: 351 DTLRCSLAGCHR-TLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           ++L+    G  R T P+ +   +F +YG+V    I+ D+   +S G GF++F D  S
Sbjct: 26  ESLKIFAGGLTRSTTPEDLK-EYFSKYGEVTHTEIVRDKNTGRSRGFGFVTFADRDS 81


>UniRef50_Q22037 Cluster: Heterogeneous nuclear ribonucleoprotein
           A1; n=5; Caenorhabditis|Rep: Heterogeneous nuclear
           ribonucleoprotein A1 - Caenorhabditis elegans
          Length = 346

 Score = 86.2 bits (204), Expect = 5e-16
 Identities = 39/118 (33%), Positives = 73/118 (61%), Gaps = 1/118 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ +   K+FVGGL+  T+ + ++ ++S++GE+ D +VM++  + RSRGFGFVTF+  + 
Sbjct: 17  LEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTE 76

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V+  ++  PH +DG+T+DPK   PR    + +      ++++ G+  + TE  L   F
Sbjct: 77  VDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYF 134



 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+V G+  + +++ L  YF++YG V    ++ +  + + RGFGFVTF D   V+  +  
Sbjct: 115 RLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQ 174

Query: 269 GPHQLDGRTID 301
             H ++G   D
Sbjct: 175 KSHMVNGHRCD 185



 Score = 37.9 bits (84), Expect = 0.17
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +3

Query: 309 RAILALFKNRNVA-VDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXG 485
           RA+    KNR+ + V T R  ++G      + +   +F +YG V +  I+ D+  +K  G
Sbjct: 97  RAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRG 156

Query: 486 XGFLSFEDEXS 518
            GF++F+D  S
Sbjct: 157 FGFVTFDDHDS 167


>UniRef50_Q13151 Cluster: Heterogeneous nuclear ribonucleoprotein
           A0; n=22; Mammalia|Rep: Heterogeneous nuclear
           ribonucleoprotein A0 - Homo sapiens (Human)
          Length = 305

 Score = 85.4 bits (202), Expect = 9e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>UniRef50_Q4SQV2 Cluster: Chromosome 1 SCAF14529, whole genome
           shotgun sequence; n=10; Euteleostomi|Rep: Chromosome 1
           SCAF14529, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 487

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 1/120 (0%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGL+ +T  + L+++F ++G + DCVV+ N +  RSR FGFVT++ P   + 
Sbjct: 2   DQLCKLFVGGLNVDTDDDGLRKHFEQFGTLTDCVVVVNKQVQRSRCFGFVTYSTPEEADS 61

Query: 257 VLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
            +   PH +DG  ++ K    R    KP+      K+F+GGL  +  E  L   F    E
Sbjct: 62  AMAARPHTVDGNPVEVKRAVAREDAGKPEALAKVKKIFVGGLKDDTEENHLTEHFSQFGE 121



 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query: 152 RYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR-TL 328
           +YG++ DCVV+KN E GRSR FGF+T++ P   +  +   PH +DG  ++ K    R   
Sbjct: 280 KYGQLSDCVVVKNKELGRSRCFGFITYSTPEEADSAMAASPHVVDGHNVELKRAVARQDA 339

Query: 329 QKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             P+      K+F+GG+  +V    L   F
Sbjct: 340 DNPEVLANVKKIFVGGVQDHVEAEHLTDYF 369



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 39/123 (31%), Positives = 63/123 (51%), Gaps = 2/123 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL  +T + +L  +FS++GE+    V+ + E+G+ RGFGFV F D    +  +  
Sbjct: 97  KIFVGGLKDDTEENHLTEHFSQFGEIEKAEVISDKETGKKRGFGFVYFVDQDSADKSVVI 156

Query: 269 GPHQLDGRTID-PKPCNPRTLQKPKRGGGYPKV-FLGGLPSNVTETDLRXIFRTLWEGHG 442
             H ++G  ++  K    + LQ   RGG  P+    GG+  +      R        G+G
Sbjct: 157 KFHTINGHKVEVKKALTKQELQAAGRGGMAPRSRGRGGMRGSQNGYGNRDYGGNYNYGNG 216

Query: 443 GGH 451
           GG+
Sbjct: 217 GGY 219



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 30/98 (30%), Positives = 48/98 (48%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP++  + K K+FVGG+      E+L  YFS++G V    ++ +  +G+ RGFGFV F D
Sbjct: 341 NPEVLANVK-KIFVGGVQDHVEAEHLTDYFSQFGAVEKAEIISDKLTGKKRGFGFVFFVD 399

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
                  +    H + G  ++ K    +       GGG
Sbjct: 400 TDSATKAVLTRYHTISGNKVEAKKAMTKQEMSSGVGGG 437


>UniRef50_Q94AC3 Cluster: AT4g36960/C7A10_400; n=11;
           Magnoliophyta|Rep: AT4g36960/C7A10_400 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 379

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 1/116 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL V G+ W+   + L+ Y S++G++ DC+VMK+  +GRSRGFG+VTFA        L+ 
Sbjct: 4   KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALK- 62

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
           G H L  R ++ K   P+  +++P +     ++F+  +PS+V+E+D R  F    E
Sbjct: 63  GEHFLGNRILEVKVATPKEEMRQPAK--KVTRIFVARIPSSVSESDFRSHFERYGE 116



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/86 (33%), Positives = 46/86 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L  E S ++L+ YF R+G + D  + K+ +    RGFGFVTFA+  + + V + 
Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVARR 300

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG 346
             H++ G+ +      P     P  G
Sbjct: 301 S-HEICGQEVAIDSATPLDEAGPSAG 325



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/85 (29%), Positives = 44/85 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FV  +    S+ + + +F RYGE+ D  + K+  S + RG GF+TF+    V  ++++
Sbjct: 92  RIFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLMED 151

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKR 343
             H L G T+      P+    P R
Sbjct: 152 -THDLGGTTVAVDRATPKEDDHPPR 175


>UniRef50_Q08473 Cluster: RNA-binding protein squid; n=22;
           Endopterygota|Rep: RNA-binding protein squid -
           Drosophila melanogaster (Fruit fly)
          Length = 344

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>UniRef50_Q8WSM6 Cluster: Putative uncharacterized protein; n=4;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 336

 Score = 82.2 bits (194), Expect = 8e-15
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGLS +T+ E L  YFS++G V+D +V+++  +  SRGFGFVTFA        + +
Sbjct: 71  KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMND 130

Query: 269 GPHQLDGRTIDPKPCNPR 322
            PH+L G+T+D K   PR
Sbjct: 131 RPHKLGGKTVDSKRAIPR 148


>UniRef50_UPI00005A4DCF Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP-1) (Topoisomerase-inhibitor
           suppressed); n=2; Canis lupus familiaris|Rep: PREDICTED:
           similar to Heterogeneous nuclear ribonucleoprotein A1
           (Helix-destabilizing protein) (Single-strand binding
           protein) (hnRNP core protein A1) (HDP-1)
           (Topoisomerase-inhibitor suppressed) - Canis familiaris
          Length = 433

 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 39/109 (35%), Positives = 65/109 (59%), Gaps = 1/109 (0%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           F+ GLS++T+ E L+ +F ++G +IDCV M++  +  SRGFGFV +A    V+  ++  P
Sbjct: 58  FISGLSFKTTYETLRSHFEQWGMLIDCVAMRDPNTKLSRGFGFVMYATMEEVDAAMKARP 117

Query: 275 HQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           H++DGR ++ K   +    Q+P       K+F+GG+  +  E  LR  F
Sbjct: 118 HKVDGRVVERKRAVSQEDSQRPGAHLTVKKIFVGGIKEDTEEHHLRYYF 166



 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 147 KIFVGGIKEDTEEHHLRYYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 206

Query: 269 GPHQLDGRTIDPKPCNPR----TLQKPKRGGG 352
             H ++    + +    +    +    +RGGG
Sbjct: 207 KYHTVNDHNCEVRKALSKQEMASASSSQRGGG 238



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 165 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 199


>UniRef50_A7QJF1 Cluster: Chromosome chr8 scaffold_106, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_106, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 332

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 38/97 (39%), Positives = 60/97 (61%), Gaps = 1/97 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PS 244
           M   E+ ++FVGGL W TS+ +L+  FSRYG++++ +VM   ++GR RGFGF+TFAD  +
Sbjct: 1   MGGREENRIFVGGLGWNTSERHLEDAFSRYGKILESLVMMERDTGRPRGFGFITFADHRA 60

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
           + + + +    +LDGR I      P+ +     G GY
Sbjct: 61  MEDAIREMHGRELDGRVISVNKAQPK-MGSEDSGYGY 96



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F RYGK++E ++M ++   +  G GF++F D
Sbjct: 27  FSRYGKILESLVMMERDTGRPRGFGFITFAD 57


>UniRef50_Q501B0 Cluster: At2g46780; n=3; core eudicotyledons|Rep:
           At2g46780 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 336

 Score = 80.2 bits (189), Expect = 3e-14
 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 2/96 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N +  D +  K+FVGGL+WET ++ ++RYF ++GE+++ VV+ +  +GRS+G+GFVTF +
Sbjct: 13  NNNTTDTKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKE 72

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTL--QKPK 340
                   QN    +DGR  +   CN   L  QKP+
Sbjct: 73  AEAAMRACQNMNPVIDGRRAN---CNLACLGAQKPR 105


>UniRef50_Q9SYP9 Cluster: F9H16.14 protein; n=6; core
           eudicotyledons|Rep: F9H16.14 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 288

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +N    D    K+FVGGL+WET  E L+R+F +YG++++ VV+ +  +GRS+G+GFVTF 
Sbjct: 14  LNSPFGDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFR 73

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
           DP        +    +DGR  +   CN  +L + +
Sbjct: 74  DPEAARRACVDPTPIIDGRRAN---CNLASLGRSR 105



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG ++E V++ D+   +S G GF++F D
Sbjct: 44  FDQYGDILEAVVITDKNTGRSKGYGFVTFRD 74


>UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=74;
           cellular organisms|Rep: Glycine-rich RNA-binding protein
           8 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 169

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 37/88 (42%), Positives = 56/88 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           + FVGGL+W T+ E+LQR FS++G+VID  ++ + ESGRSRGFGFVTF D       +++
Sbjct: 7   RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEK----AMRD 62

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              +++G+ +D +       Q    GGG
Sbjct: 63  AIEEMNGKELDGRVITVNEAQSRGSGGG 90


>UniRef50_P41891 Cluster: Protein gar2; n=12; Ascomycota|Rep:
           Protein gar2 - Schizosaccharomyces pombe (Fission yeast)
          Length = 500

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 13/132 (9%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D +E   +FVG LSW    + L + F  YG ++   V+ + +SGRS+G+G+V F  P
Sbjct: 255 PSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETP 314

Query: 242 SLVN-LVLQNGPHQLDGRTI-----DPKPCNPRTLQKPKRGG-----GYPK--VFLGGLP 382
                 V  NG  ++DGR +     +P+P NP+   + + G        P   VF+G L 
Sbjct: 315 EAAKAAVAANGTKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLS 374

Query: 383 SNVTETDLRXIF 418
            N TE DL   F
Sbjct: 375 FNATEDDLSTAF 386



 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 28/96 (29%), Positives = 47/96 (48%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D   +    +FVG LS+  ++++L   F   G++    +  + +SGR +GFG+VTF+D  
Sbjct: 359 DQLSEPSDTVFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDID 418

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
                ++   H + GR     PC       P+ GGG
Sbjct: 419 SAKKCVEMNGHFIAGR-----PCR-LDFSTPRTGGG 448


>UniRef50_Q4W5P0 Cluster: Homologous to drosophila sqd (Squid)
           protein protein 1, isoform b; n=3; Caenorhabditis|Rep:
           Homologous to drosophila sqd (Squid) protein protein 1,
           isoform b - Caenorhabditis elegans
          Length = 308

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 44/114 (38%), Positives = 63/114 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E  K+FVGG+S E + E+L  +F++YGEV    V  +  +GRSRGF FV F       L
Sbjct: 26  NEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKL 85

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            L      + G++++ KP   R  +         KVF+GGLPS+ +E DLR  F
Sbjct: 86  ALAAREQTIKGKSVEVKPAKSRENK---------KVFVGGLPSDYSEQDLRSHF 130



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  K+FVGGL  + S+++L+ +F ++G+V D     + ++   R F F+ F +    +  
Sbjct: 108 ENKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKA 167

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
                     R  D K   P+  + P   G  P
Sbjct: 168 SSQTKQTFGTRECDVKKAVPQGKRFPGAQGRMP 200


>UniRef50_Q94BU4 Cluster: At1g33470/F10C21_14; n=2; Arabidopsis
           thaliana|Rep: At1g33470/F10C21_14 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 244

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 32/75 (42%), Positives = 50/75 (66%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M+D    K+FVGGL+WET + +L+ YF ++G++++ VV+ +  SGRS+G+GFVTF DP  
Sbjct: 1   MEDTTFTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEA 60

Query: 248 VNLVLQNGPHQLDGR 292
                 +    +DGR
Sbjct: 61  AQKACVDPAPVIDGR 75


>UniRef50_A3BDN9 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 285

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 35/83 (42%), Positives = 52/83 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  E L+ +F  YGE+++ VV+ +  +GRS+G+GFVTF DP    +   +
Sbjct: 34  KVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDRATGRSKGYGFVTFRDPDSARMACMD 93

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
               +DGR  +   CN   L +P
Sbjct: 94  PYPVIDGRRAN---CNLAILGRP 113



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F  YG+++E V++ D+   +S G GF++F D  S
Sbjct: 53  FEAYGEILEAVVITDRATGRSKGYGFVTFRDPDS 86


>UniRef50_Q5CS11 Cluster: Musashi. RRM domain containing protein,
           splicing related; n=2; Cryptosporidium|Rep: Musashi. RRM
           domain containing protein, splicing related -
           Cryptosporidium parvum Iowa II
          Length = 507

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 38/78 (48%), Positives = 52/78 (66%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F GGLS  T+  +L+ +FS YGE++D VV+    +GRSRGFGF+TFA    V+ VL +
Sbjct: 24  KIFCGGLSDVTTNASLRTHFSPYGEIVDSVVLTEKTTGRSRGFGFITFASEESVDAVL-S 82

Query: 269 GPHQLDGRTIDPKPCNPR 322
            P  +DG+ ID K   PR
Sbjct: 83  SPQIVDGKEIDCKRAVPR 100



 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    + E L+ +F +YG + +  VM + ++ R RGFGFV +  P  V  V+++
Sbjct: 167 KIFVGGLPQSCTDEKLREHFGKYGTIKNLSVMVDRDTNRHRGFGFVEYESPDAVEEVMRH 226

Query: 269 -GPHQLDGRTIDPKPCNPRTL 328
              HQ+D + ++ K   PR +
Sbjct: 227 YYDHQIDNKWVECKKALPREI 247


>UniRef50_A7ART3 Cluster: Ribonucleoprotein, putative; n=1; Babesia
           bovis|Rep: Ribonucleoprotein, putative - Babesia bovis
          Length = 306

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 46/146 (31%), Positives = 74/146 (50%), Gaps = 3/146 (2%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D E  K+F GGL+  T+ E L+ YFS+YG V+   ++ +  +GRSRGFGFVTF++ + + 
Sbjct: 28  DYEAYKIFAGGLNRSTTAETLRNYFSKYGTVVHSEIVADKTTGRSRGFGFVTFSNDAALK 87

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQK---PKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
            VL    H++D    D K    +   +   P R     ++F+GG+  N++E + +  F  
Sbjct: 88  AVLAVS-HKIDNVLADVKQAIKKERARDLLPTR-EEVNRIFVGGIADNISEDEFKDYFGK 145

Query: 425 LWEGHGGGHYV*SXEEKVXGFXILVF 502
                     V     K  GF  +V+
Sbjct: 146 YGSVLNYNFIVDKSTNKPRGFGFVVY 171



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/82 (32%), Positives = 47/82 (57%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E  ++FVGG++   S++  + YF +YG V++   + +  + + RGFGFV + DP+ V+ 
Sbjct: 120 EEVNRIFVGGIADNISEDEFKDYFGKYGSVLNYNFIVDKSTNKPRGFGFVVYEDPADVDK 179

Query: 257 VLQNGPHQLDGRTIDPKPCNPR 322
            +  G H   GR  + K   PR
Sbjct: 180 AI--GHHTKLGRNCEAKRAQPR 199



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +FG+YG V+    + D+   K  G GF+ +ED
Sbjct: 142 YFGKYGSVLNYNFIVDKSTNKPRGFGFVVYED 173


>UniRef50_A7NUC5 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 494

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 34/87 (39%), Positives = 52/87 (59%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS   ++E  + YF R+G + D VVM +S + R RGFGF+TF     V  V+QN
Sbjct: 124 KIFVGGLSSNLTEEEFKNYFERFGRITDVVVMHDSATRRPRGFGFITFESEESVEHVMQN 183

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG 349
             ++L+G+ ++ K   P+      + G
Sbjct: 184 NFYELNGKRVEVKRAVPKEANNNNKNG 210



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KLFVGG+S   ++  L+ YFS+YG V++  + ++S      GFGFVTFAD + ++  
Sbjct: 3   EQVKLFVGGVSGAITEGLLRDYFSKYGTVVETYIRRDSGRTPRGGFGFVTFADAASLSRA 62

Query: 260 LQN-GPHQLDGRTI 298
           LQ+   H + G+ +
Sbjct: 63  LQDQQQHFIQGQRV 76



 Score = 40.7 bits (91), Expect = 0.025
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F R+G++ +VV+M+D   ++  G GF++FE E S
Sbjct: 142 YFERFGRITDVVVMHDSATRRPRGFGFITFESEES 176



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 14/56 (25%), Positives = 27/56 (48%)
 Frame = +3

Query: 351 DTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           + ++  + G    + + +   +F +YG V+E  I  D  +    G GF++F D  S
Sbjct: 3   EQVKLFVGGVSGAITEGLLRDYFSKYGTVVETYIRRDSGRTPRGGFGFVTFADAAS 58


>UniRef50_A2X9R7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 355

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 35/95 (36%), Positives = 57/95 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + LQ +F +YGE+++ VV+ + E+ RS+G+GFVTF +P      ++N
Sbjct: 47  KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRN 106

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLG 373
               + GR  +   CN  ++  P+       + LG
Sbjct: 107 PNPTIGGRRAN---CNIASMGPPRPSPSRENLLLG 138



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++E V++ D+   +S G GF++F +  S
Sbjct: 66  FQQYGEILEAVVITDRETSRSKGYGFVTFREPES 99


>UniRef50_Q4PBV1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 192

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VG LSW T+ ++L   FS YG++ D +VMK+ E+GRSRGFGFVTFA  +  +  +  
Sbjct: 4   KVYVGNLSWNTTDDSLAHAFSTYGQLTDYIVMKDRETGRSRGFGFVTFATQAEADAAIAA 63

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
               +LDGR I     N R       GGGY
Sbjct: 64  LNEQELDGRRIRVNMANSR--PAGGMGGGY 91


>UniRef50_Q6IRQ4 Cluster: MGC82187 protein; n=6; Tetrapoda|Rep:
           MGC82187 protein - Xenopus laevis (African clawed frog)
          Length = 370

 Score = 75.4 bits (177), Expect = 9e-13
 Identities = 34/90 (37%), Positives = 57/90 (63%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F +YG V++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFCKYGRVVEVLLMKDRETNKSRGFAFVTFESPA- 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
                ++   +L+G+ +D KP       KP
Sbjct: 61  ---DAKDAARELNGKALDGKPIKVEQATKP 87



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           F +YG+V+EV++M D+   KS G  F++FE
Sbjct: 28  FCKYGRVVEVLLMKDRETNKSRGFAFVTFE 57


>UniRef50_Q67W00 Cluster: Putative RRM-containing protein; n=2;
           Oryza sativa|Rep: Putative RRM-containing protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 343

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  E L+R+F +YGE+++ VV+ +  +GRS+G+GFVTF +       +Q+
Sbjct: 40  KVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADRLTGRSKGYGFVTFREAEAARRAVQD 99

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK 340
               + GR  +   CN  +L  P+
Sbjct: 100 PNPMIAGRRAN---CNIASLGPPR 120



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 11/31 (35%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG+++E V++ D+   +S G GF++F +
Sbjct: 59  FEQYGEILEAVVIADRLTGRSKGYGFVTFRE 89


>UniRef50_Q0DXG2 Cluster: Os02g0755400 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os02g0755400 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 176

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 33/84 (39%), Positives = 54/84 (64%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + LQ +F +YGE+++ VV+ + E+ RS+G+GFVTF +P      ++N
Sbjct: 47  KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSRSKGYGFVTFREPESAREAVRN 106

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK 340
               + GR  +   CN  ++  P+
Sbjct: 107 PNPTIGGRRAN---CNIASMGPPR 127



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++E V++ D+   +S G GF++F +  S
Sbjct: 66  FQQYGEILEAVVITDRETSRSKGYGFVTFREPES 99


>UniRef50_Q14011 Cluster: Cold-inducible RNA-binding protein; n=62;
           Eukaryota|Rep: Cold-inducible RNA-binding protein - Homo
           sapiens (Human)
          Length = 172

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>UniRef50_A2YWJ2 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 424

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 32/102 (31%), Positives = 65/102 (63%)
 Frame = +2

Query: 116 ETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRT 295
           E  + +  ++F +YGE++D V+M++  + + RGFGF+T+++P++V+ V+ +  H+ +G+ 
Sbjct: 95  EPDEADFVKHFGQYGEIVDSVIMRDKHTSQPRGFGFITYSNPAVVDRVMDD-IHEFNGKQ 153

Query: 296 IDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           ++ K   P+   + K      K+F+GGLP  +TE D +  F+
Sbjct: 154 VEIKRTIPKDSVQSK-DFKTKKIFVGGLPQALTEDDFKHFFQ 194



 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 30/89 (33%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVGGL    ++++ + +F +YG V+D  +M++ ++ RSRGFGF+ F+   +V+
Sbjct: 169 DFKTKKIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVD 228

Query: 254 LVLQNGPH-QLDGRTIDPKPCNPRTLQKP 337
            +L NG    L G  ++ K   P+    P
Sbjct: 229 DLLANGNMIDLAGAKVEIKKAEPKKSSNP 257



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +3

Query: 354 TLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           T +  + G  + L +     FF +YG V++  IM D   K+S G GF+ F  +
Sbjct: 172 TKKIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSD 224



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 11/31 (35%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           FG+YG++++ VIM D+   +  G GF+++ +
Sbjct: 105 FGQYGEIVDSVIMRDKHTSQPRGFGFITYSN 135


>UniRef50_Q9M9E6 Cluster: F3F9.20; n=8; Arabidopsis thaliana|Rep:
           F3F9.20 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 302

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + ++RYF ++GE+++ V++ +  +G+S+G+GFVTF +       + +
Sbjct: 18  KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVAD 77

Query: 269 GPHQLDGRTIDPKPCN-PRTLQKPKRGGGY---PKVFLGGLPSNVT 394
               +DGR  +    +  R    P RG G    P  +  G PS  T
Sbjct: 78  PNPVIDGRKANCNIASFGRPRPSPPRGRGQTGSPSQYQSGGPSTYT 123


>UniRef50_Q1PES4 Cluster: RNA recognition motif-containing protein;
           n=2; Arabidopsis thaliana|Rep: RNA recognition
           motif-containing protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 317

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 32/74 (43%), Positives = 48/74 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    K+FVG L+W T+ ++L+RYF ++G+V+D  V+  +  GRS+G+GF+TF D     
Sbjct: 8   DTRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTV 67

Query: 254 LVLQNGPHQLDGRT 295
             LQN    +DGRT
Sbjct: 68  RALQNSKPIIDGRT 81


>UniRef50_A5BSV4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 195

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 31/84 (36%), Positives = 55/84 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET  + ++R+F ++GE+++ V++ +  +G+S+G+GFVTF DP        +
Sbjct: 17  KVFVGGLAWETPTDVMRRHFEQFGEILEAVIITDKNTGKSKGYGFVTFRDPESARRACVD 76

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK 340
               +DGR  +   CN  +L +P+
Sbjct: 77  PNPVIDGRRAN---CNIASLGRPR 97



 Score = 35.9 bits (79), Expect = 0.70
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 393 PKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           P  +    F ++G+++E VI+ D+   KS G GF++F D  S
Sbjct: 28  PTDVMRRHFEQFGEILEAVIITDKNTGKSKGYGFVTFRDPES 69


>UniRef50_Q13148 Cluster: TAR DNA-binding protein 43; n=36;
           Coelomata|Rep: TAR DNA-binding protein 43 - Homo sapiens
           (Human)
          Length = 414

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>UniRef50_Q9SVM8 Cluster: Glycine-rich RNA-binding protein 2,
           mitochondrial precursor; n=14; Magnoliophyta|Rep:
           Glycine-rich RNA-binding protein 2, mitochondrial
           precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 158

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-Q 265
           KLF+GGLSW T   +L+  F+ +G+V+D  V+ + E+GRSRGFGFV F D       + +
Sbjct: 36  KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISE 95

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               +L+GR I   P N R       GGG
Sbjct: 96  MDGKELNGRHIRVNPANDRPSAPRAYGGG 124


>UniRef50_Q3ED69 Cluster: Uncharacterized protein At1g22910.3; n=8;
           Magnoliophyta|Rep: Uncharacterized protein At1g22910.3 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 347

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           + D    K+FVGGL+WET +E ++++F ++GE+++ VV+ +  SGRS+G+GFVTF +   
Sbjct: 7   LGDTTYTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTL 427
                 +    +DGR  +   CN  +L   +     P    GG  +N     +R +  T+
Sbjct: 67  ARSACVDATPVIDGRRAN---CNLASLGLQRSKPSTPNHGGGGRINN-----MRVMMSTM 118

Query: 428 WEGHG 442
             G G
Sbjct: 119 QTGFG 123


>UniRef50_UPI000156016B Cluster: PREDICTED: hypothetical protein;
           n=1; Equus caballus|Rep: PREDICTED: hypothetical protein
           - Equus caballus
          Length = 223

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 40/121 (33%), Positives = 66/121 (54%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +N   ++++ GK FVG LSW+ S+++ + YF++  EV+D  +  +   GRSRG GF+ F 
Sbjct: 49  VNRSGNEEDAGKWFVGSLSWDISKKDPKDYFTKLREVVDRTIKMDPNIGRSRGLGFILFK 108

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
           D + V  VL     ++ G  ++ K     T++K        K+F+GGL    TE  +R  
Sbjct: 109 DVASVEKVLDQKERKVGGHRMNHK--KAVTMKKDP----MKKIFVGGLNPEATEEKIREY 162

Query: 416 F 418
           F
Sbjct: 163 F 163



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/74 (31%), Positives = 40/74 (54%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF ++GE+       + ES + +G  F+ F +   
Sbjct: 137 MKKDPMKKIFVGGLNPEATEEKIREYFGKFGEIEAIEFSLDPESNKRQGSVFIAFKEEEP 196

Query: 248 VNLVLQNGPHQLDG 289
           V  +L+   H + G
Sbjct: 197 VRSILEKF-HTISG 209


>UniRef50_Q9SM01 Cluster: RNA binding protein; n=2; Arabidopsis
           thaliana|Rep: RNA binding protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 381

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 25/140 (17%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D ++ KLFVGG++ ETS+E L++YFSRYG V++ VV K   +G+ RGFGFV FA+   V 
Sbjct: 2   DYDRYKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVV 61

Query: 254 LVLQNGPHQLDGRTIDPKPC--------NPRTLQKPKR-----GGGY------------P 358
             L++  H + G+ +D +           P ++Q  +R      GG              
Sbjct: 62  KALRD-THFILGKPVDVRKAIRKHELYQQPFSMQFLERKVQQMNGGLREMSSNGVTSRTK 120

Query: 359 KVFLGGLPSNVTETDLRXIF 418
           K+F+GGL SN TE + +  F
Sbjct: 121 KIFVGGLSSNTTEEEFKSYF 140



 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 32/78 (41%), Positives = 48/78 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS  T++E  + YF R+G   D VVM +  + R RGFGFVT+     V +V+Q+
Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQS 180

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H+L  + ++ K   P+
Sbjct: 181 NFHELSDKRVEVKRAIPK 198



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F R+G+  +VV+M+D    +  G GF++++ E S
Sbjct: 139 YFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDS 173


>UniRef50_Q8LPB0 Cluster: Glycine-rich RNA-binding protein; n=1;
           Physcomitrella patens|Rep: Glycine-rich RNA-binding
           protein - Physcomitrella patens (Moss)
          Length = 155

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 38/89 (42%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL+W T+ +N++  FS +GEV +  ++ + ++GRSRGFGFVTFA        LQ 
Sbjct: 43  KLFVGGLAWGTTDDNIKEAFSAFGEVTEVKIICDRDTGRSRGFGFVTFATDQDAEAALQA 102

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
                L GRTI       ++ Q  + GGG
Sbjct: 103 LDGRDLAGRTIRVNYATKQSPQDRQSGGG 131


>UniRef50_A7PIB0 Cluster: Chromosome chr13 scaffold_17, whole genome
           shotgun sequence; n=2; core eudicotyledons|Rep:
           Chromosome chr13 scaffold_17, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 287

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 27/68 (39%), Positives = 48/68 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET +E ++ +F +YGE+++ V++ +  +GRS+G+GFVTF +P       ++
Sbjct: 17  KVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAAKKACED 76

Query: 269 GPHQLDGR 292
               ++GR
Sbjct: 77  ATPMINGR 84



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +3

Query: 393 PKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           PK      F +YG+++E VI+ D+   +S G GF++F++
Sbjct: 28  PKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKE 66


>UniRef50_Q5CT90 Cluster: RRM domain containing protein; n=1;
           Cryptosporidium parvum Iowa II|Rep: RRM domain
           containing protein - Cryptosporidium parvum Iowa II
          Length = 199

 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 35/88 (39%), Positives = 57/88 (64%), Gaps = 1/88 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           K+FVG L    SQ+ L++YF ++G++ DCV+M + +SG  RGFGFVTF   S+V+ +++ 
Sbjct: 86  KIFVGNLPTTCSQDILRKYFEQFGQISDCVMMCDKKSGIGRGFGFVTFTSTSVVDEIIRA 145

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
              H +DG+ ++ K  +P   +   RGG
Sbjct: 146 YDEHYIDGQWVEVKRASP---ENALRGG 170


>UniRef50_UPI0000EB42F3 Cluster: UPI0000EB42F3 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB42F3 UniRef100
           entry - Canis familiaris
          Length = 133

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 35/75 (46%), Positives = 55/75 (73%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+GKLFVGGL++ T+++ L+ +FS +G + + VV+K+ E+ RSRGFGF+TF++P   +  
Sbjct: 4   EEGKLFVGGLNFITNEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFSNPEYASDT 63

Query: 260 LQ--NGPHQLDGRTI 298
           ++  NG   LDGR I
Sbjct: 64  MRAMNG-ESLDGRQI 77


>UniRef50_Q1LVU9 Cluster: Cold inducible RNA binding protein; n=8;
           Clupeocephala|Rep: Cold inducible RNA binding protein -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 223

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 34/75 (45%), Positives = 53/75 (70%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN-- 253
           ++GKLF+GGLS++T++++L+  FS+YG +    V+++ E+ RSRGFGFVTF +P      
Sbjct: 20  DEGKLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDA 79

Query: 254 LVLQNGPHQLDGRTI 298
           +   NG  Q+DGR I
Sbjct: 80  MAAMNG-KQVDGRMI 93


>UniRef50_Q8VXC4 Cluster: Glycine rich RNA binding protein; n=20;
           Magnoliophyta|Rep: Glycine rich RNA binding protein -
           Oryza sativa (Rice)
          Length = 194

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 40/102 (39%), Positives = 58/102 (56%), Gaps = 2/102 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T   +L+  FS YGE+++  ++ + E+GRSRGFGFVTF+    +  
Sbjct: 5   DVEYRCFVGGLAWATDDRSLEAAFSTYGEILESKIINDRETGRSRGFGFVTFSSEQAMRD 64

Query: 257 VLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
            ++  NG  +LDGR I       R       GGGY +   GG
Sbjct: 65  AIEGMNG-KELDGRNITVNEAQSRR-SGGGGGGGYGQRGGGG 104


>UniRef50_Q8RWN5 Cluster: RNA-binding protein-like; n=3; Arabidopsis
           thaliana|Rep: RNA-binding protein-like - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 310

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 29/53 (54%), Positives = 42/53 (79%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           E  ++FVGGLS E +  +L+R FSR+G+++DC +M   ++GRSRGFGF+TFAD
Sbjct: 5   EGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFAD 57


>UniRef50_Q2UQ21 Cluster: Predicted protein; n=3;
           Pezizomycotina|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 127

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+W T+ E+L+  F +YG V + +V+K+ ++GRSRGFGFV F+  +        
Sbjct: 3   KLFIGGLAWHTTDESLRSGFEKYGAVEEAIVVKDRDTGRSRGFGFVRFSSEADAEAAAHE 62

Query: 269 GPHQ-LDGRTIDPKPCNPRTLQKPKRGGGY 355
             +Q  DGRTI     + R    P+  GG+
Sbjct: 63  MNNQEFDGRTIRVDKASERA---PRNDGGF 89


>UniRef50_Q40437 Cluster: RGP-3; n=2; Nicotiana|Rep: RGP-3 -
           Nicotiana sylvestris (Wood tobacco)
          Length = 144

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGLSW T  ++L+  F+ +G+V+D  V+ + +SGRSRGFGFV F+D    N  ++ 
Sbjct: 39  KLFVGGLSWGTDDQSLRDAFATFGDVVDARVIVDRDSGRSRGFGFVNFSDDECANEAIK- 97

Query: 269 GPHQLDGRTIDPKPCNPRTLQ-KPKRGGGY 355
               +DG+ +  +    R  Q +  R GG+
Sbjct: 98  ---AMDGQELQGRNIRVRIAQERAPRSGGF 124


>UniRef50_Q6ZR81 Cluster: CDNA FLJ46566 fis, clone THYMU3040829,
           moderately similar to Cold- inducible RNA-binding
           protein; n=1; Homo sapiens|Rep: CDNA FLJ46566 fis, clone
           THYMU3040829, moderately similar to Cold- inducible
           RNA-binding protein - Homo sapiens (Human)
          Length = 135

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 29/51 (56%), Positives = 46/51 (90%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTF 54



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>UniRef50_O75526 Cluster: RNA-binding motif protein,
           X-linked-like-2; n=77; Euteleostomi|Rep: RNA-binding
           motif protein, X-linked-like-2 - Homo sapiens (Human)
          Length = 392

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 33/99 (33%), Positives = 56/99 (56%), Gaps = 1/99 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET ++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 248 VNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
                ++     LDG+ I          +  +RG   P+
Sbjct: 62  AKAAARDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPR 100



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>UniRef50_A7APD8 Cluster: RNA recognition motif domain containing
           protein; n=1; Babesia bovis|Rep: RNA recognition motif
           domain containing protein - Babesia bovis
          Length = 362

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 42/114 (36%), Positives = 62/114 (54%), Gaps = 1/114 (0%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT-FADPSLVNL 256
           E+ K FVGGL     +  L  +F +YG VI   VM++  SGRSRGFGFVT +   +  NL
Sbjct: 79  ERLKFFVGGLHPTVDEGMLTEHFMKYGRVITAQVMRDYNSGRSRGFGFVTLYVQENTENL 138

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +  H ++G+ +D +          KR     K+F+GGLP +++E  L+  F
Sbjct: 139 F--SDEHNVNGKHVDVRRMQNDAASNMKR-----KIFVGGLPKSLSEQMLKTFF 185



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 36/97 (37%), Positives = 52/97 (53%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           RM  D   + K K+FVGGL    S++ L+ +F R+G V    +M+  + G SRGFGFV F
Sbjct: 154 RMQNDAASNMKRKIFVGGLPKSLSEQMLKTFFERFGAVEKVTIMRQYD-GSSRGFGFVIF 212

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKR 343
           A    V  VL++  H + G  +D +    R+ Q   R
Sbjct: 213 AVDGAVEKVLESPSHFVYGSKVDVRAAESRSKQAAAR 249


>UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=16;
           cellular organisms|Rep: Glycine-rich RNA-binding protein
           7 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 176

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 35/76 (46%), Positives = 50/76 (65%), Gaps = 2/76 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T    L+  F++YG+VID  ++ + E+GRSRGFGFVTF D   +  
Sbjct: 5   DVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKD 64

Query: 257 VLQ--NGPHQLDGRTI 298
            ++  NG   LDGR+I
Sbjct: 65  AIEGMNG-QDLDGRSI 79



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +3

Query: 360 RCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           RC + G             F +YG V++  I+ D+   +S G GF++F+DE
Sbjct: 9   RCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDE 59


>UniRef50_Q5JK61 Cluster: RNA recognition motif (RRM)-containing
           protein-like; n=7; Oryza sativa|Rep: RNA recognition
           motif (RRM)-containing protein-like - Oryza sativa
           subsp. japonica (Rice)
          Length = 310

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 28/68 (41%), Positives = 47/68 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET +E ++ YF ++G++++ VV+ +  +GRS+G+GFVTF +P        +
Sbjct: 22  KVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDKNTGRSKGYGFVTFREPEAAMKACFD 81

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 82  PYPVIDGR 89


>UniRef50_UPI0000DB6D53 Cluster: PREDICTED: similar to CG32169-PA
           isoform 2; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG32169-PA isoform 2 - Apis mellifera
          Length = 426

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 33/95 (34%), Positives = 58/95 (61%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R +P M    K K+FVGGLS  T+ E+++ YF ++G + D ++M + ++ R RGFGFVTF
Sbjct: 177 RTHPKMVTRTK-KIFVGGLSAPTTLEDVKNYFEQFGPIEDAMLMFDKQTNRHRGFGFVTF 235

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V+ V +   H+++ + ++ K   P+ +  P
Sbjct: 236 QSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLP 270



 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 33/70 (47%), Positives = 44/70 (62%)
 Frame = +2

Query: 209 RGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSN 388
           +GFGF+TFADP+ V+ VL  G H+LDG+ IDPK   PR    PK      K+F+GGL + 
Sbjct: 139 KGFGFITFADPASVDKVLAQGNHELDGKKIDPKVAFPRRTH-PKMVTRTKKIFVGGLSAP 197

Query: 389 VTETDLRXIF 418
            T  D++  F
Sbjct: 198 TTLEDVKNYF 207


>UniRef50_Q6VYI5 Cluster: TARDBP S8; n=8; Coelomata|Rep: TARDBP S8 -
           Mus musculus (Mouse)
          Length = 302

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 39/109 (35%), Positives = 62/109 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K   P + Q P       KVF+G    ++T  +L+  F
Sbjct: 165 RHMIDGRWCDCK--LPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFF 211



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + + E LQ++F +YGEV+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPK-----PFRAFAFVTFADDKVAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFL 370
           +L+++     +     +PK  + R L++  R GG P + L
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGILL 284


>UniRef50_Q05C33 Cluster: Tardbp protein; n=14; Coelomata|Rep:
           Tardbp protein - Mus musculus (Mouse)
          Length = 288

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 39/109 (35%), Positives = 62/109 (56%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K   P + Q P       KVF+G    ++T  +L+  F
Sbjct: 165 RHMIDGRWCDCK--LPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFF 211



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 22/50 (44%), Positives = 31/50 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           K+FVG  + + + E LQ++F +YGEV+D  + K       R F FVTFAD
Sbjct: 192 KVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPK-----PFRAFAFVTFAD 236


>UniRef50_Q9FI04 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MGN6; n=3; Arabidopsis
           thaliana|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MGN6 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 100

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 31/78 (39%), Positives = 47/78 (60%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D + K++V GL W T  E L  YF R+GE++   V+ +  + RS+GFGFVTF +     
Sbjct: 5   NDRETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESAT 64

Query: 254 LVLQNGPHQLDGRTIDPK 307
              +N  H +DGRT++ K
Sbjct: 65  RACENPNHTIDGRTVNCK 82


>UniRef50_A7QX84 Cluster: Chromosome undetermined scaffold_215,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_215, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 273

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 50/127 (39%), Positives = 63/127 (49%), Gaps = 16/127 (12%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GK+FVGGLS    +E  ++YF  +G V D VVM +    R RGFGFV+F    LVN VL 
Sbjct: 9   GKIFVGGLSPALIEEGFRQYFEAFGHVTDLVVMYDQSIQRPRGFGFVSFDTEDLVNRVLY 68

Query: 266 NGPHQLD-GRTIDP----KPCNPRTLQKPKR-------GGG----YPKVFLGGLPSNVTE 397
              H L+  R +D     K    +T  K          GGG      K+F+GGLP  +TE
Sbjct: 69  KTFHDLNVSRRLDQIEILKKDEQQTSSKAGNFNSTRNFGGGGNLEAKKIFVGGLPPALTE 128

Query: 398 TDLRXIF 418
              R  F
Sbjct: 129 EGFRQYF 135



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 38/106 (35%), Positives = 54/106 (50%), Gaps = 5/106 (4%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  K+FVGGL    ++E  ++YF  +  V D VVM +    R  GF FV+F    +V+ V
Sbjct: 113 EAKKIFVGGLPPALTEEGFRQYFEAFSNVTDVVVMYDQSIQRPCGFRFVSFDIEDVVDRV 172

Query: 260 LQNGPHQLDGRTID-----PKPCNPRTLQKPKRGGGYPKVFLGGLP 382
           L    H L+G+ ++     PK  NP +      G G  +V  GGLP
Sbjct: 173 LYKTFHDLNGKQVEVKWAFPKDANP-SGGSHSMGCGVGRVAGGGLP 217



 Score = 37.1 bits (82), Expect = 0.30
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F  +G V ++V+MYDQ  ++  G GF+SF+ E
Sbjct: 28  YFEAFGHVTDLVVMYDQSIQRPRGFGFVSFDTE 60


>UniRef50_Q1DPW0 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 147

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+W T+ E L++ FS++G + + +V+K+ ++ RSRGFGFV FA        +  
Sbjct: 3   KLFIGGLAWHTTDETLRQGFSKFGSIEEAIVVKDRDTNRSRGFGFVRFASEGEAEAAMNE 62

Query: 269 GPHQ-LDGRTI 298
             +Q  DGRTI
Sbjct: 63  MNNQEFDGRTI 73


>UniRef50_Q10N14 Cluster: RNA recognition motif family protein,
           expressed; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: RNA recognition motif family
           protein, expressed - Oryza sativa subsp. japonica (Rice)
          Length = 310

 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 30/85 (35%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL+WET ++ L+ +F R+G++++ V++ +  +GRS+G+GFVTF +        ++
Sbjct: 34  KVFVGGLAWETHKDTLREHFERFGDILEAVIISDKLTGRSKGYGFVTFKEADAAKKACED 93

Query: 269 GPHQLDGRTIDPKPCNPRTL-QKPK 340
               ++GR  +   CN  +L  KP+
Sbjct: 94  ATPVINGRRAN---CNLASLGAKPR 115



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F R+G ++E VI+ D+   +S G GF++F++
Sbjct: 53  FERFGDILEAVIISDKLTGRSKGYGFVTFKE 83


>UniRef50_A2YHR7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 377

 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 35/96 (36%), Positives = 51/96 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++E  + YF  +G V D VV+ +S + RSRGFGFVTF     V  V+++
Sbjct: 145 KVFIGGLRDNITEEEFKTYFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSEEAVRKVIEH 204

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H L G  ++ K   P+     + G G      GG
Sbjct: 205 SFHDLKGTRVEAKIAIPKDASYYRNGRGRGSRNFGG 240



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 3/84 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KLFVGG+     +  L+ +F +YG V   +VM++ E+G  RGFGFV F +       
Sbjct: 18  ERRKLFVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKETGHGRGFGFVEFEEEEDAARA 77

Query: 260 LQNGPHQ---LDGRTIDPKPCNPR 322
           L +G H    + GR +D K    R
Sbjct: 78  LGDGEHPRHLICGRVVDVKRARAR 101



 Score = 35.9 bits (79), Expect = 0.70
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F  +G V +VV++YD    +S G GF++F+ E
Sbjct: 163 YFESFGTVTDVVVIYDSMTNRSRGFGFVTFDSE 195



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FG+YG V  V++M D+      G GF+ FE+E
Sbjct: 40  FGQYGAVRSVIVMRDKETGHGRGFGFVEFEEE 71


>UniRef50_A1CJX8 Cluster: Glycine-rich RNA-binding protein,
           putative; n=2; Aspergillus|Rep: Glycine-rich RNA-binding
           protein, putative - Aspergillus clavatus
          Length = 133

 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 34/90 (37%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+W T+ + L++ F ++G+V + +V+K+ ++ RSRGFGFV F+  S  +  +  
Sbjct: 3   KLFIGGLAWHTTDDALRQGFEQFGQVEEAIVVKDRDTNRSRGFGFVRFSSDSDADKAMDA 62

Query: 269 GPHQ-LDGRTIDPKPCNPRTLQKPKRGGGY 355
             +Q  DGRTI     + R    P+  GG+
Sbjct: 63  MNNQEFDGRTIRVDKASERA---PRNNGGF 89


>UniRef50_UPI0000211FC5 Cluster: PREDICTED: RNA binding motif
           protein 3; n=2; Eutheria|Rep: PREDICTED: RNA binding
           motif protein 3 - Pan troglodytes
          Length = 211

 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 28/62 (45%), Positives = 47/62 (75%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+GKLFVGGL++ T ++ L+ +FS +G + + VV+K+ E+ RSRGFGF+TF +P   ++ 
Sbjct: 4   EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVA 63

Query: 260 LQ 265
           ++
Sbjct: 64  MR 65


>UniRef50_Q9SIX3 Cluster: Putative glycine-rich RNA-binding protein;
           n=1; Arabidopsis thaliana|Rep: Putative glycine-rich
           RNA-binding protein - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 185

 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 2/76 (2%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D + + FVGGL+W T +++++R F+ +GEV D  ++ + E+GRS+GF FVTF D   +  
Sbjct: 41  DNEYRCFVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRT 100

Query: 257 VL--QNGPHQLDGRTI 298
            +   NG  +LDGR I
Sbjct: 101 AIDRMNG-QELDGRNI 115


>UniRef50_Q5PPI5 Cluster: Putative uncharacterized protein; n=1;
           Rattus norvegicus|Rep: Putative uncharacterized protein
           - Rattus norvegicus (Rat)
          Length = 148

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 28/54 (51%), Positives = 43/54 (79%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           E+GKLFVGGL++ T ++ L+ +FS +G + + VV+K+ E+ RSRGFGF+TF +P
Sbjct: 4   EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNP 57


>UniRef50_A6GJJ1 Cluster: Probable nucleic acid-binding protein;
           n=1; Plesiocystis pacifica SIR-1|Rep: Probable nucleic
           acid-binding protein - Plesiocystis pacifica SIR-1
          Length = 155

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 30/71 (42%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           +LFVGGLSW+T  ++L+  F++ G V+D +++ + ++G SRGFGFVT A+       + +
Sbjct: 77  RLFVGGLSWDTESDSLRELFAKVGAVVDAMIVTDRDTGDSRGFGFVTMANRKDATKAMKE 136

Query: 266 NGPHQLDGRTI 298
            G  +LDGR+I
Sbjct: 137 LGGTELDGRSI 147


>UniRef50_Q8GU29 Cluster: Glycin-rich RNA binding protein; n=6;
           cellular organisms|Rep: Glycin-rich RNA binding protein
           - Polytomella sp. Pringsheim 198.80
          Length = 177

 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L+VG LSW   +E+L+ YF ++GEV +  +  + ESGRSRGFGFVT       + + + 
Sbjct: 4   RLYVGNLSWNAKEEDLRTYFGKFGEVEEASIALDRESGRSRGFGFVTLPADVAKDAIEKT 63

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKR---GGGY 355
              +  GR I     +P   + P+    GGGY
Sbjct: 64  NGAEFMGRNIKVNEASPPGERPPRTNNYGGGY 95


>UniRef50_A5KRV2 Cluster: RNP-1 like RNA-binding protein; n=1;
           candidate division TM7 genomosp. GTL1|Rep: RNP-1 like
           RNA-binding protein - candidate division TM7 genomosp.
           GTL1
          Length = 108

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA-DPSLVNLVLQ 265
           KLF+G L++ T+ ++L+ +F+  GEV +  V+ + +SGRS+GFGFVT+  D      + +
Sbjct: 4   KLFIGSLAYATTDDSLRAHFAEKGEVEEAKVVTDRDSGRSKGFGFVTYVNDEDADTAIKE 63

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
               +LDGR I      PR  ++P+ GG
Sbjct: 64  LDNSELDGRNIHVNEARPRE-ERPRNGG 90


>UniRef50_Q75KB4 Cluster: Putative RNA binding protein; n=4; Oryza
           sativa|Rep: Putative RNA binding protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 291

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 31/79 (39%), Positives = 49/79 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL    + ++L  YF ++G + D VVM+N  + R+RGFGF++F     V  +L N
Sbjct: 113 KVFVGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFDSHEAVCKILLN 172

Query: 269 GPHQLDGRTIDPKPCNPRT 325
             H L+GR ++ K   P++
Sbjct: 173 RFHNLNGRDVEVKIAVPKS 191



 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 48/130 (36%), Positives = 62/130 (47%), Gaps = 17/130 (13%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ KLFV GL  +T + +L+ +F+RYGEV+   V+ +  SG SRGFGFV FAD +     
Sbjct: 3   EERKLFVAGLPQQTREGDLRGHFARYGEVVHTRVVLDMASGNSRGFGFVEFADEAATLRA 62

Query: 260 LQNGP---HQLDGRTIDPKPCNPR-----TLQKPKRGGG---------YPKVFLGGLPSN 388
           L +     H   GR +D K    R     T    K               KVF+GGL   
Sbjct: 63  LADDEMPNHVFRGRKVDVKRAERRHDHKQTSPSIKNQNDSVQKNQFIFQKKVFVGGLHET 122

Query: 389 VTETDLRXIF 418
           VT  DL   F
Sbjct: 123 VTVKDLISYF 132



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F RYG+V+   ++ D     S G GF+ F DE +
Sbjct: 25  FARYGEVVHTRVVLDMASGNSRGFGFVEFADEAA 58



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           + G H T+       +F ++G + + V+M ++   ++ G GF+SF+
Sbjct: 116 VGGLHETVTVKDLISYFEKFGTITDAVVMRNRTTNRARGFGFISFD 161


>UniRef50_A3AAN7 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 304

 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 25/47 (53%), Positives = 40/47 (85%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           K+FVGGL+WET+ E L+R++ R+GE+++ VV+ +  SGRS+G+GFV+
Sbjct: 38  KVFVGGLAWETTSERLRRFYDRFGEILEAVVITDRHSGRSKGYGFVS 84



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           F+ R+G+++E V++ D+   +S G GF+S
Sbjct: 56  FYDRFGEILEAVVITDRHSGRSKGYGFVS 84


>UniRef50_Q4MZK1 Cluster: Nucleic acid binding factor, putative;
           n=2; Theileria|Rep: Nucleic acid binding factor,
           putative - Theileria parva
          Length = 421

 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG +++ETS  +L+ YFS++GEVID  + K+  + + +GFGF+TFA+ + ++  L  
Sbjct: 339 KLFVGRIAFETSVHSLRTYFSQFGEVIDVYIPKDPHTQKGKGFGFITFANKNSIHSALDP 398

Query: 269 G-PHQLDGRTI 298
              H +DGR I
Sbjct: 399 SLKHVVDGREI 409



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 26/79 (32%), Positives = 51/79 (64%), Gaps = 4/79 (5%)
 Frame = +2

Query: 74  DDEK---GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK-NSESGRSRGFGFVTFADP 241
           DDEK    ++F+  +++E ++++L+ YF ++G V D    + N+ SG ++GFGF++F + 
Sbjct: 111 DDEKINANRIFITRIAFEATKDDLEDYFKKFGTVYDAYCPRQNNYSGLNKGFGFISFENE 170

Query: 242 SLVNLVLQNGPHQLDGRTI 298
             +  V ++GPH + GR +
Sbjct: 171 DSIRKVFESGPHVIMGREV 189


>UniRef50_Q4SJ02 Cluster: Chromosome 21 SCAF14577, whole genome
           shotgun sequence; n=2; Tetraodon nigroviridis|Rep:
           Chromosome 21 SCAF14577, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 278

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 30/79 (37%), Positives = 50/79 (63%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +GE+ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D S  +   ++    +DGR
Sbjct: 61  DRSAADRACKDPNPIIDGR 79


>UniRef50_Q9FFZ6 Cluster: Similarity to RNA-binding protein; n=2;
           core eudicotyledons|Rep: Similarity to RNA-binding
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 146

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 2/92 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLF+GGLS+ T+++ L   FS+ G+V++  ++ +  S RS+GFGFVTF  AD +   L+ 
Sbjct: 35  KLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALME 94

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
            NG  QL+GRTI       +  Q    GGGYP
Sbjct: 95  FNG-QQLNGRTIFVDYAKAK--QSLGGGGGYP 123


>UniRef50_A4RXB1 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 218

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 32/93 (34%), Positives = 52/93 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D     K+FVGGL     +  ++ +FS++G V++ +VM++  + +SRGFGF+TF      
Sbjct: 8   DASAGSKIFVGGLDRTVDEGVVRNFFSQFGPVMEVLVMRDPHNHQSRGFGFITFQRDDSA 67

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
             VLQN  H + G+ ++ K   PR    P + G
Sbjct: 68  KQVLQNRYHDMLGKRVEVKSAVPRGQAPPPQRG 100



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*Q 527
           + G  RT+ + +   FF ++G VMEV++M D    +S G GF++F+ + S  Q
Sbjct: 17  VGGLDRTVDEGVVRNFFSQFGPVMEVLVMRDPHNHQSRGFGFITFQRDDSAKQ 69


>UniRef50_Q4H2Q6 Cluster: Ci-Tardbp protein; n=1; Ciona
           intestinalis|Rep: Ci-Tardbp protein - Ciona intestinalis
           (Transparent sea squirt)
          Length = 440

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 37/109 (33%), Positives = 65/109 (59%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+ ++++L+ YF++YGE++  V++K  E+G+SRG+GF+ F+   +  LVL   
Sbjct: 141 LIVLGLPWKIAEDDLKEYFAKYGELV-MVLVKRDENGKSRGYGFIRFSSYEVQELVLSQ- 198

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +  R  D K  + +  QKP       K+F+G +   +T+ ++R  F
Sbjct: 199 RHIIGERWCDVKIPHSKD-QKPTVSS---KIFVGRITEKMTKDEIRQYF 243



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D       K+FVG ++ + +++ +++YF ++G+V D  +         R F FVTF D +
Sbjct: 216 DQKPTVSSKIFVGRITEKMTKDEIRQYFEQFGDVDDVYI-----PIPFRAFAFVTFRDSN 270

Query: 245 L-VNLV 259
           +  NL+
Sbjct: 271 VAANLI 276


>UniRef50_A7RU25 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 291

 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 43/117 (36%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           G L V GL + T++  ++ YF+R+GE+  C V  +  + RSRGFGFV F        VL 
Sbjct: 115 GDLIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLS 174

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
              H++ GR      C  R L +PK     P K+F+G LP + TE  L   F    E
Sbjct: 175 TS-HRIQGRL-----CEVR-LPRPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGE 224



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 33/89 (37%), Positives = 46/89 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L   T+++ L  YF+++GEV D  + K       R FGFVTFA   L   VL  
Sbjct: 200 KLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPK-----PFRHFGFVTFASGELAKKVLSQ 254

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
             H++ G  ++     P++  K   G GY
Sbjct: 255 N-HRISGSLLNITFAEPKSTAK-GMGSGY 281


>UniRef50_A0H648 Cluster: RNA-binding region RNP-1; n=3;
           Chloroflexus|Rep: RNA-binding region RNP-1 -
           Chloroflexus aggregans DSM 9485
          Length = 103

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 30/87 (34%), Positives = 46/87 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L+W      L+++F  YG+V    V+ + E+GRSRGFGFV      +  ++ Q 
Sbjct: 4   KLFVGNLAWSVDDATLEQFFQAYGDVRSARVINDRETGRSRGFGFVEMDVTDVAKVISQT 63

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG 349
               ++GR I       +  + P+ GG
Sbjct: 64  NGQPINGREIRVNEAEDKGSRGPRSGG 90


>UniRef50_Q9FZ84 Cluster: F26I16.3 protein; n=2; Arabidopsis
           thaliana|Rep: F26I16.3 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 155

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS  T  E L+  F  +G+++D VV+ + ESG SRGFGFVT+    + N  +Q 
Sbjct: 37  KIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA 96

Query: 269 GPH-QLDGRTIDPKPCN 316
             + +LDGR I   P +
Sbjct: 97  MQNKELDGRIIGVHPAD 113


>UniRef50_Q6X9Z2 Cluster: HnRNP core protein A1; n=2;
           Laurasiatheria|Rep: HnRNP core protein A1 - Equus
           caballus (Horse)
          Length = 61

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 27/53 (50%), Positives = 42/53 (79%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVT 61


>UniRef50_Q9BX46 Cluster: RNA-binding protein 24; n=52;
           Eumetazoa|Rep: RNA-binding protein 24 - Homo sapiens
           (Human)
          Length = 236

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 29/79 (36%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +GE+ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79


>UniRef50_UPI0000D9F579 Cluster: PREDICTED: similar to
           testes-specific heterogenous nuclear ribonucleoprotein
           G-T; n=1; Macaca mulatta|Rep: PREDICTED: similar to
           testes-specific heterogenous nuclear ribonucleoprotein
           G-T - Macaca mulatta
          Length = 415

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 33/79 (41%), Positives = 50/79 (63%), Gaps = 2/79 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M+ D   KLFVGGL+ +T ++ L+  F +YG +I+  +MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   MEADRPEKLFVGGLNLKTEEKALKAEFVKYGRIINVFLMKDRETNKSRGFAFVTFESPAD 61

Query: 248 VNLVLQ--NGPHQLDGRTI 298
                +  NG + LDG+ I
Sbjct: 62  AKAAARDLNGKY-LDGKAI 79


>UniRef50_O24306 Cluster: Ribonucleoprotein; n=3; Pisum sativum|Rep:
           Ribonucleoprotein - Pisum sativum (Garden pea)
          Length = 291

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 35/87 (40%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG LSWE     L++ FS +G+V+   V+ + E+GRSRGFGFVT +D   +N  +  
Sbjct: 207 RVYVGNLSWELDDSRLEQVFSEHGKVVSARVVYDRETGRSRGFGFVTMSDEKEMNDAIAA 266

Query: 269 GPHQ-LDGRTIDPKPCNPRTLQKPKRG 346
              Q L+GRTI       R    P+RG
Sbjct: 267 LDGQILEGRTIKVSVAEDR----PRRG 289



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 1/100 (1%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +  E  KLFVG L ++   E L   F   G V    V+ N E+ +SRGFGFVT +     
Sbjct: 104 EPSEDAKLFVGNLPYDVDSEKLAMLFEPAGTVEIAEVIYNRETDQSRGFGFVTMSTVEEA 163

Query: 251 NL-VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
                +   +  +GR +      PR   +P+R    P+ F
Sbjct: 164 EAGAAKFNRYDYNGRPLTVNKAAPRG-SRPEREERPPRTF 202



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  +GKV+   ++YD+   +S G GF++  DE
Sbjct: 226 FSEHGKVVSARVVYDRETGRSRGFGFVTMSDE 257


>UniRef50_Q20414 Cluster: Putative uncharacterized protein tag-169;
           n=3; Caenorhabditis|Rep: Putative uncharacterized
           protein tag-169 - Caenorhabditis elegans
          Length = 411

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 1/116 (0%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +   L V G+ ++T+ E  Q+YF   G V+ C + + S+ G S+GFGFV  +     N
Sbjct: 169 DSQPVDLIVLGVDFKTTDECFQKYFEDIGTVVFCEIKRKSD-GNSKGFGFVRMSSVGEQN 227

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL    H +DGR  D K  + R  Q +P       ++F+G L   V E  LR +F
Sbjct: 228 KVLAIPQHMIDGRRCDVKVPDGRDKQGRP----SISRIFVGRLTDKVDEHQLRKVF 279


>UniRef50_Q8LFQ5 Cluster: RNA binding protein-like; n=4; Arabidopsis
           thaliana|Rep: RNA binding protein-like - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 261

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 26/79 (32%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           +N    D +  K+FVGGL+W+T +E +  +F +YG++++ V++ +  + RS+G+GFVTF 
Sbjct: 7   VNGCFGDTKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFK 66

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D        ++    ++GR
Sbjct: 67  DAEAATRACEDSTPIINGR 85



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 13/31 (41%), Positives = 23/31 (74%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG ++E VI+ D+  ++S G GF++F+D
Sbjct: 37  FIKYGDILEAVIISDKLTRRSKGYGFVTFKD 67


>UniRef50_A7NXI6 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 283

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG LSW  + E+L + F  YG VI   V+ + E+GRSRG+GFV ++  + ++  L+ 
Sbjct: 203 KLFVGNLSWSVTSESLNQVFQEYGNVIGARVLYDGETGRSRGYGFVCYSTKAEMDTALES 262

Query: 266 -NGPHQLDGRTI 298
            NG  +L+GR I
Sbjct: 263 LNGV-ELEGRAI 273



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 5/116 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+ G L +      L      YG      V+ N ++GRSRGF FVT +     N V++N
Sbjct: 112 KLYFGNLPYSCDSAQLAGIIQNYGSPELVEVLYNRDTGRSRGFAFVTMSSVEDCNAVIEN 171

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK-RGGGYP----KVFLGGLPSNVTETDLRXIFR 421
               LDG     +        KPK +   YP    K+F+G L  +VT   L  +F+
Sbjct: 172 ----LDGSEYGGRTLRVNFSDKPKPKLPLYPETEYKLFVGNLSWSVTSESLNQVFQ 223


>UniRef50_UPI0000D5737C Cluster: PREDICTED: similar to RNA binding
           motif protein 24; n=3; Endopterygota|Rep: PREDICTED:
           similar to RNA binding motif protein 24 - Tribolium
           castaneum
          Length = 318

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 28/68 (41%), Positives = 46/68 (67%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL + T+ ++L+ +FS YGE+ + VV+ + ++G+SRG+GFV   D S  +   ++
Sbjct: 90  KLFVGGLPYHTTDQSLREHFSVYGEIEEAVVITDRQTGKSRGYGFVIMGDKSSSDRACKD 149

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 150 ANPIIDGR 157


>UniRef50_Q9H0Z9 Cluster: RNA-binding protein 38; n=16;
           Eutheria|Rep: RNA-binding protein 38 - Homo sapiens
           (Human)
          Length = 216

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79


>UniRef50_Q5K255 Cluster: Putative 29 kDa ribonucleoprotein A; n=1;
           Guillardia theta|Rep: Putative 29 kDa ribonucleoprotein
           A - Guillardia theta (Cryptomonas phi)
          Length = 170

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 38/98 (38%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVID-CVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           KL+VG LS++T  E+L +YFS++G+V D  V+M   + GRSRGFGFVT++  +     + 
Sbjct: 46  KLYVGNLSFDTRGEDLMQYFSQFGKVDDTTVIMDRDDPGRSRGFGFVTYSTIADAEYAIS 105

Query: 266 NGPH-QLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              + +  GR I      PR    P+ GGG   +  GG
Sbjct: 106 KTDNVEWMGRNIRVNMSRPRG-DGPRGGGGGGGMRSGG 142


>UniRef50_O23189 Cluster: RNA-binding like protein; n=1; Arabidopsis
           thaliana|Rep: RNA-binding like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 306

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 25/49 (51%), Positives = 37/49 (75%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           KL V G+ W+   + L+ Y S++G++ DC+VMK+  +GRSRGFG+VTFA
Sbjct: 4   KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFA 52



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/86 (33%), Positives = 46/86 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L  E S ++L+ YF R+G + D  + K+ +    RGFGFVTFA+  + + V + 
Sbjct: 185 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVARR 244

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG 346
             H++ G+ +      P     P  G
Sbjct: 245 S-HEICGQEVAIDSATPLDEAGPSAG 269


>UniRef50_UPI00015B48C0 Cluster: PREDICTED: similar to LOC443584
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to LOC443584 protein - Nasonia vitripennis
          Length = 518

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 28/97 (28%), Positives = 55/97 (56%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D D+K  +F+G + ++ +++ ++++F   G++    ++K+ +SG SRG G+V F +   V
Sbjct: 334 DHDQKRAVFLGNIPFDITEDEVRKHFDSCGKIESVRIVKDRKSGLSRGIGYVNFENQDSV 393

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
            L L+     L  R I  + C+P    K ++ GG P+
Sbjct: 394 TLALELNGTNLKNREIRVQICSPEPKGKKRKHGGKPQ 430


>UniRef50_UPI00005A129E Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) - Canis familiaris
          Length = 200

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 27/55 (49%), Positives = 42/55 (76%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCV M++  + RSRGFGFVT A
Sbjct: 34  EPEQLRKLFMGGLSFETTDESLRSHFEQWGTLTDCVEMRDPNTKRSRGFGFVTNA 88



 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 23/62 (37%), Positives = 38/62 (61%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D    +FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ 
Sbjct: 94  DAARNIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDK 153

Query: 257 VL 262
           ++
Sbjct: 154 IV 155



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 116 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 150


>UniRef50_A5K494 Cluster: Nucleic acid binding factor, putative;
           n=2; Plasmodium|Rep: Nucleic acid binding factor,
           putative - Plasmodium vivax
          Length = 753

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 29/78 (37%), Positives = 53/78 (67%), Gaps = 2/78 (2%)
 Frame = +2

Query: 71  DDDEKG--KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D+  KG  ++FV  L +E  +++L++YFS+YG+++D  V KN  + +++GFGFV+F   S
Sbjct: 356 DEALKGYPRIFVTRLPFEAGKKDLEKYFSKYGKIVDIYVSKNLSNNKNKGFGFVSFEKQS 415

Query: 245 LVNLVLQNGPHQLDGRTI 298
            ++ VL++  H + G+ I
Sbjct: 416 SMDKVLKDKLHIICGKEI 433



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 4/107 (3%)
 Frame = +2

Query: 50  MRMNPDMDD-DEKG-KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           +R  P  D+ +++G KLFV  L+  T+ E L+ YF  +GE+ID  +  +  + R RG  F
Sbjct: 649 VRKLPGGDEWNKRGYKLFVTKLNSVTTIETLRNYFEAFGEIIDIYMPNDVCTNRPRGIAF 708

Query: 224 VTFADPSLVNLVL--QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
           VTF D   V  +L  +N  H +DG+ +     +P T  K K+   YP
Sbjct: 709 VTFLDNDCVKKILSNKNSKHIIDGKEVVVDLADPET--KTKKNLCYP 753



 Score = 35.9 bits (79), Expect = 0.70
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK++++ +  +    K+ G GF+SFE + S
Sbjct: 382 YFSKYGKIVDIYVSKNLSNNKNKGFGFVSFEKQSS 416


>UniRef50_Q7XTU5 Cluster: OSJNBb0034I13.9 protein; n=4; Oryza
           sativa|Rep: OSJNBb0034I13.9 protein - Oryza sativa
           (Rice)
          Length = 515

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 30/73 (41%), Positives = 42/73 (57%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    KLFV GL W    ++L+  FSR+GE+ DC V+ + +SGRS+G+GFV F       
Sbjct: 110 DPASRKLFVHGLGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRSAL 169

Query: 254 LVLQNGPHQLDGR 292
             L+    Q+ GR
Sbjct: 170 RALRRPQLQIGGR 182



 Score = 41.5 bits (93), Expect = 0.014
 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 1/89 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D+ + K+FVG +  +   + L  YFS++GE+ +  +  +  +G+ +GF    +       
Sbjct: 226 DNMQRKIFVGNVHADVDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESAR 285

Query: 254 LVLQNGPHQLDGRTID-PKPCNPRTLQKP 337
             L+      DG+ ++  K  + RT   P
Sbjct: 286 RALEEPTRNFDGKMLNVQKAIDGRTKNTP 314


>UniRef50_Q4U8S8 Cluster: RNA-binding protein, putative; n=2;
           Theileria|Rep: RNA-binding protein, putative - Theileria
           annulata
          Length = 513

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 1/120 (0%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVN 253
           D   K FVGGL   T +  L  +F++YG+++   VM++  +GR RGFGFVT    P+ ++
Sbjct: 124 DSTLKFFVGGLHPNTDEGELSAHFAKYGQILASQVMRDMATGRHRGFGFVTLKVQPNTMS 183

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
           +      H + G+ +D      R +Q         K+F+GGL   + E  L+  F    E
Sbjct: 184 VF--KDTHVVSGKRVD-----VRAMQTDVAASLRKKIFVGGLSKALNEEMLQEYFSKFGE 236



 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 33/89 (37%), Positives = 48/89 (53%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M  D+    + K+FVGGLS   ++E LQ YFS++GEV    +M+  + G SRGFGF+ F 
Sbjct: 201 MQTDVAASLRKKIFVGGLSKALNEEMLQEYFSKFGEVDKVTIMRQLD-GTSRGFGFIVFM 259

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
                   L+N  H + G  +D +    R
Sbjct: 260 TEEGATGSLKNPTHFVYGNKVDVRAAETR 288


>UniRef50_P49314 Cluster: 31 kDa ribonucleoprotein, chloroplast
           precursor; n=10; core eudicotyledons|Rep: 31 kDa
           ribonucleoprotein, chloroplast precursor - Nicotiana
           plumbaginifolia (Leadwort-leaved tobacco)
          Length = 292

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   +++VG LSW      L+  FS  G V+D  V+ + +SGRSRGFGFVT++    VN 
Sbjct: 205 DSSNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVND 264

Query: 257 VLQN-GPHQLDGRTI 298
            + +     LDGR+I
Sbjct: 265 AIDSLNGIDLDGRSI 279



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/72 (43%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG L +      L   F R G V    V+ +  SGRSRGFGFVT +    V    Q 
Sbjct: 89  KLFVGNLPFSVDSAALAGLFERAGNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAAEQQ 148

Query: 266 -NGPHQLDGRTI 298
            NG +++DGR I
Sbjct: 149 FNG-YEIDGRAI 159


>UniRef50_Q109W0 Cluster: RNA recognition motif family protein,
           expressed; n=4; Oryza sativa|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 317

 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 2/90 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           KLF+GG+S+ T  ++L+  F+ YGEVI+  V+ +  +GRSRGFGFVT+   D +   +  
Sbjct: 32  KLFIGGISYGTDDQSLKEAFANYGEVIEARVIVDRTTGRSRGFGFVTYTSTDEAAAAITG 91

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
            +G   L GR +     + R  +    GGG
Sbjct: 92  MDG-KDLQGRIVRVSYAHDRGSRAGGYGGG 120


>UniRef50_Q6CHZ9 Cluster: Similar to tr|Q9C232 Neurospora crassa
           Conserved hypothetical protein; n=1; Yarrowia
           lipolytica|Rep: Similar to tr|Q9C232 Neurospora crassa
           Conserved hypothetical protein - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 419

 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 40/109 (36%), Positives = 58/109 (53%), Gaps = 5/109 (4%)
 Frame = +2

Query: 65  DMDDDEKG-KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           D+D   +G  LFV G+S   ++  L+  F  +GEV+ C +M +  SG SRGFGFV  AD 
Sbjct: 173 DVDAQNEGTNLFVTGVSRYVNETELEDLFKPFGEVLKCQIMMDPHSGESRGFGFVMMADV 232

Query: 242 SLVN--LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGG 376
           +  +  L   NG H+L G+T+  +    +  + P  G   G PK   GG
Sbjct: 233 TGADEALAKLNG-HELAGKTLAIEKAKRKRARTPTPGRYFGPPKARRGG 280


>UniRef50_Q9FI08 Cluster: Similarity to RNA-binding protein; n=1;
           Arabidopsis thaliana|Rep: Similarity to RNA-binding
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 169

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 28/73 (38%), Positives = 44/73 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++VGGL W T +E L  +F R+GE+I   V+ + E+ RS+G+GFVTF D        ++
Sbjct: 14  KIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKD 73

Query: 269 GPHQLDGRTIDPK 307
               ++GR  + K
Sbjct: 74  PNPTIEGRITNCK 86



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 13/35 (37%), Positives = 24/35 (68%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF R+G+++ V ++ D+   +S G GF++F+D  S
Sbjct: 32  FFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAES 66


>UniRef50_Q5CRM8 Cluster: T8M16_190-plant like protein with RRM
           domain; n=2; Cryptosporidium|Rep: T8M16_190-plant like
           protein with RRM domain - Cryptosporidium parvum Iowa II
          Length = 600

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 47/75 (62%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D  + KLFV  L +ET++++L     +YGE+ + V+++ ++SG S+G+GFVTFA      
Sbjct: 181 DAIRRKLFVRNLGFETNEDSLSEVMGQYGELEESVILR-TKSGESKGYGFVTFASSEATI 239

Query: 254 LVLQNGPHQLDGRTI 298
             LQ   H +DGR +
Sbjct: 240 KALQQPHHLIDGRLV 254



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 1/110 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L++  L +  + E++   FS++G+V + +V+K  + G+SRG+ FVTF       L  +N
Sbjct: 98  RLYIKNLPFSANTESVIEVFSQFGDVEEGIVLK--KDGKSRGYAFVTFKTIESALLACKN 155

Query: 269 GPHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
            P  + GR +  K   +P   +  +      K+F+  L     E  L  +
Sbjct: 156 -PVSMSGRFLMVKLAADPFPFETKRSDAIRRKLFVRNLGFETNEDSLSEV 204


>UniRef50_A7SIE8 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 184

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 7/128 (5%)
 Frame = +2

Query: 65  DMDDDEK-GKLFVGGLSWETSQENLQRYFSRYGE----VIDCVVMKNSESGRSRGFGFVT 229
           +M DD K  KLFVGGL+ +T++E ++ YF  + E     +  V +  +  G+SR F FV 
Sbjct: 3   EMGDDSKLMKLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPEGKSRKFCFVE 62

Query: 230 FADPS--LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETD 403
           F++ S  + N+V     H +D + ++ K   PR            K+F+GGL    +E D
Sbjct: 63  FSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPNELAHVRTKKLFIGGLKDEHSEED 122

Query: 404 LRXIFRTL 427
           ++     L
Sbjct: 123 VKTALAPL 130


>UniRef50_A7SFY3 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 817

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 34/121 (28%), Positives = 66/121 (54%), Gaps = 5/121 (4%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +  +  K+F+  L +  ++++L+  FS+ GEV+D  ++KN  +GRS+G+ +V F + S V
Sbjct: 596 ESSDPRKVFISNLLFSITEDHLRDKFSKLGEVLDVRIVKNM-AGRSKGYAYVEFNNESTV 654

Query: 251 NLVLQNGPHQLDGRTIDPKPC-----NPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXI 415
              L     +++GR +   PC     NP T + P     +  +F+  LP +  E+++  +
Sbjct: 655 QAALAMDREKMEGRPMFISPCVDKAKNPTTFKFPTSLDKH-TLFVSNLPFDAKESEIEEL 713

Query: 416 F 418
           F
Sbjct: 714 F 714



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 1/89 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNL 256
           +K  LFV  L ++  +  ++  FS++G V+  V +  + +G+ +G+G+V +  + S    
Sbjct: 692 DKHTLFVSNLPFDAKESEIEELFSKHG-VVKQVRLVTNRAGKPKGYGYVEYEQESSASTA 750

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKR 343
           VL     ++ GRTI     NP T + P R
Sbjct: 751 VLTLDKTEVKGRTISVALSNPPTRRGPPR 779


>UniRef50_A7AN88 Cluster: RNA recognition motif domain containing
           protein; n=1; Babesia bovis|Rep: RNA recognition motif
           domain containing protein - Babesia bovis
          Length = 643

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = +2

Query: 59  NPDMDDDEKG-KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           N   D  + G ++ +  LS+ T++E ++  FS  GEVI CV+ K  E+G+S G  F+ F 
Sbjct: 467 NDQSDIPQSGTEVCIRNLSYNTTEETMRELFSECGEVIRCVIPKFEENGKSMGRCFIGFT 526

Query: 236 DPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
                   ++    ++DGRT+  +   PRT +   RGG
Sbjct: 527 SEEAAARAVEYDNTEIDGRTVSIQYARPRTPRGESRGG 564


>UniRef50_Q5K249 Cluster: Putative glycine-rich RNA-binding protein;
           n=1; Guillardia theta|Rep: Putative glycine-rich
           RNA-binding protein - Guillardia theta (Cryptomonas phi)
          Length = 152

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           M + +  K FV GL W  + E+L+  F+ +G + D  V+ + E+GRSRGFGFVTFA+ + 
Sbjct: 55  MQELDPNKCFVSGLPWALTSEDLRDLFAEFGAIQDANVVYDRETGRSRGFGFVTFAESAD 114

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPR 322
               +       + GRT+  K  N R
Sbjct: 115 CEAAITAMDKANIGGRTVLVKQANVR 140


>UniRef50_Q2V9B8 Cluster: RNA-binding protein AKIP1-like; n=1;
           Solanum tuberosum|Rep: RNA-binding protein AKIP1-like -
           Solanum tuberosum (Potato)
          Length = 498

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 41/152 (26%), Positives = 66/152 (43%), Gaps = 8/152 (5%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    K+FV GL W+T+ E L   F+ YGE+ DC  + +  SG+S+G+GF+ F   S   
Sbjct: 155 DPAHRKIFVHGLGWDTTAETLTSVFATYGEIEDCKAVTDKVSGKSKGYGFILFKHRSGAR 214

Query: 254 LVLQNGPHQLDGR-------TIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLR 409
             L+    ++  R       +  P P  P T   P        K+F+  + +++    L 
Sbjct: 215 KALKEPQKKIGTRMTSCQLASAGPVPAPPPTTATPPVSEYTQRKIFVSNVAADLEPQKLL 274

Query: 410 XIFRTLWEGHGGGHYV*SXEEKVXGFXILVFR 505
             F    E   G   +     K  GF + V++
Sbjct: 275 EYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYK 306



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/79 (22%), Positives = 38/79 (48%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P + +  + K+FV  ++ +   + L  YFS++GEV +  +  + +SG+ +GF    +   
Sbjct: 249 PPVSEYTQRKIFVSNVAADLEPQKLLEYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYKTV 308

Query: 242 SLVNLVLQNGPHQLDGRTI 298
                 L+      +G T+
Sbjct: 309 EGARKALEEPHKTFEGHTL 327


>UniRef50_A7PVU6 Cluster: Chromosome chr8 scaffold_34, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_34, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 907

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFV GL+W T+ E L   F  +GE+ +  V+ +  +G+SRG+GF+T+         LQ 
Sbjct: 66  KLFVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGKSRGYGFITYKHMESTQSALQA 125

Query: 269 GPHQLDGR-TIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
               +DGR  +    C   +           K+++GGL  +VT   L   F
Sbjct: 126 PSKLIDGRMAVCNLACEGLSGASTTPDQAQRKLYIGGLAPDVTSEVLLSFF 176



 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 26/75 (34%), Positives = 42/75 (56%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D  + KL++GGL+ + + E L  +F R+GE+ +  V  + E+  SRGFGFVT+       
Sbjct: 152 DQAQRKLYIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAK 211

Query: 254 LVLQNGPHQLDGRTI 298
             + +    L GR+I
Sbjct: 212 KAIDDPQKFLGGRSI 226



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FFGR+G++ E  + YD+   +S G GF++++
Sbjct: 175 FFGRHGEIEEGSVAYDKETNESRGFGFVTYK 205


>UniRef50_A7PG82 Cluster: Chromosome chr6 scaffold_15, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_15, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 516

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 40/151 (26%), Positives = 64/151 (42%), Gaps = 7/151 (4%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    K+FV GL W+T+ E L   F +YGE+ DC  + +  SG+S+G+ F+ F   S   
Sbjct: 191 DPAHRKIFVHGLGWDTTAETLTSVFGKYGEIEDCKAVSDKISGKSKGYAFILFKHRSGAR 250

Query: 254 LVLQNGPHQLDGR-------TIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
             L+    ++  R       +  P P  P  +  P       K+F+  + S +    L  
Sbjct: 251 KALKQPQKKIGNRMTSCQLASAGPVPAPPPVV-PPVSEYTQRKIFVSNVSSEIDPQKLLE 309

Query: 413 IFRTLWEGHGGGHYV*SXEEKVXGFXILVFR 505
            F    E   G   +     K  GF + V++
Sbjct: 310 FFAKFGEIEEGPLGLDKSTGKPKGFALFVYK 340



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P + +  + K+FV  +S E   + L  +F+++GE+ +  +  +  +G+ +GF    +   
Sbjct: 283 PPVSEYTQRKIFVSNVSSEIDPQKLLEFFAKFGEIEEGPLGLDKSTGKPKGFALFVYKSI 342

Query: 242 SLVNLVLQNGPHQL-DGRTI 298
                 L+  PH++ +G T+
Sbjct: 343 ESSRRALEE-PHKIFEGHTL 361


>UniRef50_A7SHQ6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 105

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/70 (37%), Positives = 42/70 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFV  L W   +E+L  +F +YG+++   VM + +SGRS+ +GFV F D       + N
Sbjct: 10  KLFVAKLPWTACRESLTEHFKQYGQILSSKVMFDLKSGRSKKYGFVFFKDEEACEKAMGN 69

Query: 269 GPHQLDGRTI 298
            PH ++G+ +
Sbjct: 70  QPHFIEGQKV 79


>UniRef50_Q9LKA4 Cluster: Similarity to RNA-binding protein; n=5;
           Magnoliophyta|Rep: Similarity to RNA-binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 404

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 29/81 (35%), Positives = 51/81 (62%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           +R+  D D  ++ KLF+ GL+ +T+ E L+  FS YG++ + +V+ +  +G+S+G+GFVT
Sbjct: 64  VRLTADSDISQR-KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVT 122

Query: 230 FADPSLVNLVLQNGPHQLDGR 292
           F       L L+    ++DGR
Sbjct: 123 FMHVDGALLALKEPSKKIDGR 143



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 16/73 (21%), Positives = 35/73 (47%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K++V  + ++   + L  +F  YG+V +  +  +  +G+SRGF    +         L +
Sbjct: 168 KIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALAD 227

Query: 269 GPHQLDGRTIDPK 307
               +DG+ ++ K
Sbjct: 228 PVKVIDGKHLNCK 240


>UniRef50_Q7SGB3 Cluster: Predicted protein; n=5; Eukaryota|Rep:
           Predicted protein - Neurospora crassa
          Length = 193

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 35/96 (36%), Positives = 52/96 (54%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGLSW T    L+  F  +G V + VV+K+ ++GRSRGFGFV + + +     + N
Sbjct: 3   KLFVGGLSWNTDDNMLRAKFEEFGAVEEAVVVKDRDTGRSRGFGFVRYGNDADAENAIAN 62

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
               +DG+ +     + R       GGG+ +   GG
Sbjct: 63  ----MDGQEVRVDKASDRA--AGGGGGGFRQGGGGG 92


>UniRef50_P19683 Cluster: 31 kDa ribonucleoprotein, chloroplast
           precursor; n=23; Magnoliophyta|Rep: 31 kDa
           ribonucleoprotein, chloroplast precursor - Nicotiana
           sylvestris (Wood tobacco)
          Length = 315

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 30/80 (37%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P    ++  +++VG + W      L++ FS +G+V+   V+ + E+GRSRGFGFVT A  
Sbjct: 222 PPRTFEQSYRIYVGNIPWGIDDARLEQLFSEHGKVVSARVVYDRETGRSRGFGFVTMASE 281

Query: 242 SLVNLVLQNGPHQ-LDGRTI 298
           + ++  + N   Q LDGRTI
Sbjct: 282 AEMSDAIANLDGQSLDGRTI 301



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 4/117 (3%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNL 256
           E  KLFVG L ++   E L R F + G V    V+ N ++ +SRGFGFVT +        
Sbjct: 134 EDAKLFVGNLPYDVDSEGLARLFEQAGVVEIAEVIYNRDTDQSRGFGFVTMSTVEEAEKA 193

Query: 257 VLQNGPHQLDGR--TIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIF 418
           V     + ++GR  T++         ++P R      ++++G +P  + +  L  +F
Sbjct: 194 VEMYNRYDVNGRLLTVNKAARRGERPERPPRTFEQSYRIYVGNIPWGIDDARLEQLF 250


>UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2;
           cellular organisms|Rep: RNP-1 like RNA-binding protein -
           Solibacter usitatus (strain Ellin6076)
          Length = 132

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-- 265
           +FVG L +  S+E ++  F RYG+V    +M + E+GRSRGF FV   +    +  +   
Sbjct: 4   IFVGNLDFNASEEGVRSLFERYGQVNSARIMTDRETGRSRGFAFVEMENEGEADQAISAL 63

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
           NG + LDGR ++     P+  +    GGG  + F GG
Sbjct: 64  NG-YTLDGRALNVNEARPKPDRGFGGGGGGGRGFGGG 99


>UniRef50_A2XEH7 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 206

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = +2

Query: 68  MDDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           MD D    KLFVGGL WET  + ++R+F ++GE+++ VV+ +  + RS+G+GFV  A
Sbjct: 1   MDGDTTFTKLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADKHTSRSKGYGFVRLA 57


>UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA;
           n=4; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to GA10247-PA - Strongylocentrotus purpuratus
          Length = 519

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 3/112 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL + T+ E ++ YF +YGE++   V ++  + +S+GFGF+ + D      V++  
Sbjct: 121 LIVLGLDYNTTDEEMKEYFGKYGELLMAHVKRDPVTQKSKGFGFIRYKDVDSQEGVVEK- 179

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP---KVFLGGLPSNVTETDLRXIF 418
            H++D   +  + C    ++ P  GG  P   K+F+G L S+ T+ DL  IF
Sbjct: 180 RHKID---LSSRWCE---VKYPNTGGAQPSRKKLFIGRLTSDTTKEDLFDIF 225



 Score = 41.5 bits (93), Expect = 0.014
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           KLF+G L+ +T++E+L   FS+YGEV+D  + K       RGF FVT
Sbjct: 206 KLFIGRLTSDTTKEDLFDIFSKYGEVVDVFIPK-----PFRGFAFVT 247



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 16/63 (25%), Positives = 29/63 (46%)
 Frame = +3

Query: 330 KNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           K R +   T+   + G            +FG+YG+++   +  D   +KS G GF+ ++D
Sbjct: 110 KTRKIEAKTVDLIVLGLDYNTTDEEMKEYFGKYGELLMAHVKRDPVTQKSKGFGFIRYKD 169

Query: 510 EXS 518
             S
Sbjct: 170 VDS 172


>UniRef50_UPI00004996C0 Cluster: RNA-binding protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: RNA-binding protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 136

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNLVLQ 265
           +L++G L++  + E+L+  F ++G V DC V+ + +S RS+GFGFVTF  D      + +
Sbjct: 3   RLYIGSLAYSVTDESLKAAFEKFGTVTDCKVVTDRDSQRSKGFGFVTFEKDEDAKKAIEE 62

Query: 266 NGPHQLDGRTIDPKPCNPR 322
               +L+GR I      PR
Sbjct: 63  MNEQELEGRRIKVDVSRPR 81


>UniRef50_A7PG81 Cluster: Chromosome chr6 scaffold_15, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_15, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 410

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 4/143 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FV GL W+ + E L   F +YG++ +C V+ +  +GRS+G+GFV F   S     L+ 
Sbjct: 80  KIFVHGLGWDATNETLTSAFKQYGQIEECNVVTDKITGRSKGYGFVLFKTRSGARKALKQ 139

Query: 269 GPHQLDGR--TIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              ++  R          P +   P  G      ++++G +   ++   LR  F    E 
Sbjct: 140 PQKKIGNRMAACHLAAAGP-SGSNPAAGADVNERRLYVGNVGPQISAEKLRTFFAKFGEI 198

Query: 437 HGGGHYV*SXEEKVXGFXILVFR 505
             G         K  GF I+VF+
Sbjct: 199 EDGPLGFDKATGKFRGFAIIVFK 221



 Score = 38.7 bits (86), Expect = 0.100
 Identities = 16/53 (30%), Positives = 32/53 (60%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D  + +L+VG +  + S E L+ +F+++GE+ D  +  +  +G+ RGF  + F
Sbjct: 168 DVNERRLYVGNVGPQISAEKLRTFFAKFGEIEDGPLGFDKATGKFRGFAIIVF 220


>UniRef50_Q9VHP3 Cluster: CG8021-PA; n=3; Diptera|Rep: CG8021-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 91

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/76 (36%), Positives = 40/76 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L W    + L+ YFS+YG V +  V+ + + G S+ +GFV F+     N     
Sbjct: 11  KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQ 70

Query: 269 GPHQLDGRTIDPKPCN 316
             H LDGR +  +  N
Sbjct: 71  NTHFLDGRVLTVQRAN 86


>UniRef50_Q8IIT2 Cluster: Nucleic acid binding factor, putative;
           n=1; Plasmodium falciparum 3D7|Rep: Nucleic acid binding
           factor, putative - Plasmodium falciparum (isolate 3D7)
          Length = 580

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 25/73 (34%), Positives = 48/73 (65%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E  ++F   L +E S+++L++YFS++G+++D  V +N  + +++GFGFV+F     +N V
Sbjct: 224 EYPRIFATRLPFEASKKDLEKYFSKFGKIVDIYVSRNISNNKNKGFGFVSFEKQESMNKV 283

Query: 260 LQNGPHQLDGRTI 298
           L+   H + G+ I
Sbjct: 284 LKEKLHIICGKEI 296



 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-- 262
           KLFV  L+  T+ E L+ YF ++GE+ID  +  +  + R RG  FVTF D   V  +L  
Sbjct: 503 KLFVTKLNSATTIEKLRNYFEKFGEIIDIYMPNDVYTNRPRGIAFVTFLDNESVKNILSD 562

Query: 263 QNGPHQLDGRTIDPKPCNPRTL 328
           ++  H +DG+ +    CN + L
Sbjct: 563 EHSKHIIDGKEV----CNRKKL 580



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 11/35 (31%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++GK++++ +  +    K+ G GF+SFE + S
Sbjct: 245 YFSKFGKIVDIYVSRNISNNKNKGFGFVSFEKQES 279


>UniRef50_Q04836 Cluster: 31 kDa ribonucleoprotein, chloroplast
           precursor; n=22; Magnoliophyta|Rep: 31 kDa
           ribonucleoprotein, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 329

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 32/87 (36%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG L W+     L++ FS +G+V++  V+ + E+GRSRGFGFVT +D   +N  +  
Sbjct: 245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304

Query: 269 GPHQ-LDGRTIDPKPCNPRTLQKPKRG 346
              Q L+GR I       R    P+RG
Sbjct: 305 LDGQNLEGRAIRVNVAEER---PPRRG 328



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 4/120 (3%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +  E+ KLFVG L+++ + + L   F + G V    V+ N E+ +SRGFGFVT +     
Sbjct: 145 EPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEA 204

Query: 251 NLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP---KVFLGGLPSNVTETDLRXIF 418
              ++    + L+GR +      PR  +  +    Y    +V++G LP +V    L  +F
Sbjct: 205 ETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLF 264



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F  +GKV+E  ++YD+   +S G GF++  D
Sbjct: 264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSD 294


>UniRef50_O35698 Cluster: RNA-binding protein; n=7; Mus
           musculus|Rep: RNA-binding protein - Mus musculus (Mouse)
          Length = 380

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSL 247
           + ++ GK+F+GGL+ +T Q+ LQ  F R+G V   ++M++ E+ +SRGF F+TF      
Sbjct: 3   ETNQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADA 62

Query: 248 VNLVLQNGPHQLDGRTIDPKPC-NPRTLQ 331
            N V +     LDG+ I  K    P +L+
Sbjct: 63  KNAVKEMNGVILDGKRIKVKQARRPSSLE 91



 Score = 36.3 bits (80), Expect = 0.53
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           FGR+G V  V++M D+  KKS G  FL+F
Sbjct: 28  FGRFGPVARVILMRDRETKKSRGFAFLTF 56


>UniRef50_O64571 Cluster: Putative RNA-binding protein; n=3;
           Arabidopsis thaliana|Rep: Putative RNA-binding protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 613

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 30/92 (32%), Positives = 50/92 (54%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D  +  +FV G  W+T+QENL+  F  YGE+ +C V+ + ++GR +G+GFV F       
Sbjct: 404 DIAQRNIFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAR 463

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
             L+    ++  R +    CN  + +KP + G
Sbjct: 464 EALKRPEKRMYNRIV---VCNLAS-EKPGKAG 491


>UniRef50_Q8I2Y5 Cluster: RNA-binding protein, putative; n=4;
           Plasmodium|Rep: RNA-binding protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 388

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 31/96 (32%), Positives = 54/96 (56%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D  + KLFV  LS +T+   L+  F +YG++ +CV++ ++E G+S+G+GF+TF+ P    
Sbjct: 220 DHYQNKLFVRNLSQKTNVSTLRSIFEKYGKLEECVIIHDNE-GKSKGYGFLTFSSPREAF 278

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
            V+Q     +D R +       + L+K +    Y K
Sbjct: 279 KVMQQPERIIDNRVVFLHFAVSQNLKKYQNNQNYVK 314



 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 33/110 (30%), Positives = 52/110 (47%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +L V  + + T  E   +YF  +GE+ D ++++  E GRS+G+GFVTF     V   L++
Sbjct: 142 RLMVRNIPFSTRDEQFLKYFESFGEIEDGIIVREKE-GRSKGYGFVTFKYVESVQKCLKS 200

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
                   T+D K    R +  P       K+F+  L      + LR IF
Sbjct: 201 ------SHTLDNKELQVRLVADPFTDHYQNKLFVRNLSQKTNVSTLRSIF 244


>UniRef50_Q5BW90 Cluster: SJCHGC05136 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05136 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 184

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL + T+ E+L+ +F ++G + + VV+ + ++G+SRG+GFVT +      L +++
Sbjct: 13  KIFVGGLPYHTTDESLRCFFDQFGPIDEAVVITDRQTGKSRGYGFVTMSRTEDALLAIRD 72

Query: 269 GPHQLDGR--TIDPKPCNPRTLQKPKRGGGYPKVF--LGGLPSNVTETDL 406
               +DGR   ++      +    P    G P  F    GLP + ++  L
Sbjct: 73  PNPCIDGRKANVNLAVLGAKPRFMPGTNTGVPGFFPLHSGLPMDASQASL 122


>UniRef50_Q54NB8 Cluster: RNA-binding region-containing protein;
           n=1; Dictyostelium discoideum AX4|Rep: RNA-binding
           region-containing protein - Dictyostelium discoideum AX4
          Length = 1035

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 19/57 (33%), Positives = 41/57 (71%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P +  +E  ++++G ++W  +++ ++  FS++G VI C +M+N+++G+ +GFGFV F
Sbjct: 761 PPVPINEASRIYIGSINWNVTEDQVRSIFSQFGRVISCFLMQNADTGKHKGFGFVDF 817



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 14/63 (22%), Positives = 37/63 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           ++ +++VG L +  +++ ++  FS +G +    + K++ SG+S+G+ F+ + +       
Sbjct: 586 DQSRIYVGSLHFSLTEDVIRATFSVFGNIKSLALGKDA-SGKSKGYAFIEYDNQESAAKA 644

Query: 260 LQN 268
           LQ+
Sbjct: 645 LQS 647


>UniRef50_A7RRA7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 409

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           + K+FVG L+ +T    L  YFS +GE+    ++K+ E+G SRGF F+TF +P   +  +
Sbjct: 61  RSKVFVGNLNRDTKPVTLAEYFSVFGEIEGLRIVKDHETGISRGFAFITFTEPESASKAI 120

Query: 263 QNGPH---QLDGRTI 298
           +   H   QLDGR I
Sbjct: 121 RWCKHHHPQLDGRQI 135


>UniRef50_Q10KP0 Cluster: RNA recognition motif family protein,
           expressed; n=9; Magnoliophyta|Rep: RNA recognition motif
           family protein, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 265

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV-NL 256
           E  +++VG LSW      L   FS  GEV++  V+ + ESGRSRGFGFVT+     V N 
Sbjct: 178 EANRVYVGNLSWGVDNAALANLFSGEGEVLEAKVIYDRESGRSRGFGFVTYGSAEEVENA 237

Query: 257 VLQNGPHQLDGRTI 298
           V       +DGR I
Sbjct: 238 VSNLDGADMDGRQI 251



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           ++FVG L +      L   F + G V    V+ +  +GRSRGFGFVT +    V   ++ 
Sbjct: 87  RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEAAVEQ 146

Query: 266 -NGPHQLDGRTI----DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG + LDGR++     P P   ++ Q+  RG    +V++G L   V    L  +F
Sbjct: 147 FNG-YILDGRSLRVNSGPPPPREQSSQRAPRGEA-NRVYVGNLSWGVDNAALANLF 200


>UniRef50_A7PL41 Cluster: Chromosome chr7 scaffold_20, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr7 scaffold_20, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 458

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 1/153 (0%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           +R   D D   + K+FV GL W+T++E L   F  YG++ DC V+ +  +G+++G+GFV 
Sbjct: 81  IRETADRDVSHR-KIFVHGLGWDTTRETLLAAFEPYGQIEDCNVVTDRNTGKAKGYGFVL 139

Query: 230 FADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGY-PKVFLGGLPSNVTETDL 406
           F         L+    +++ R    +  +      P+       K+++  + ++V    L
Sbjct: 140 FKTRQGAVKALKQPGKKINNRMTQSQLASMGPSPPPQSQDTVGRKIYVSNVQADVDPERL 199

Query: 407 RXIFRTLWEGHGGGHYV*SXEEKVXGFXILVFR 505
           R  F    E   G     +   K  GF + V++
Sbjct: 200 RSFFAKFGEIETGPIGFDTQTGKSRGFALFVYK 232



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 16/74 (21%), Positives = 39/74 (52%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P   D    K++V  +  +   E L+ +F+++GE+    +  ++++G+SRGF    + + 
Sbjct: 175 PQSQDTVGRKIYVSNVQADVDPERLRSFFAKFGEIETGPIGFDTQTGKSRGFALFVYKNQ 234

Query: 242 SLVNLVLQNGPHQL 283
                 L++ P+++
Sbjct: 235 ESARKALED-PYRI 247


>UniRef50_A3QQP3 Cluster: Chloroplast single strand DNA binding
           protein; n=1; Mesostigma viride|Rep: Chloroplast single
           strand DNA binding protein - Mesostigma viride
          Length = 299

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 34/89 (38%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+VG L+W    E L + FS++GEV    V+ + ESGRSRGF FVT A P       + 
Sbjct: 91  KLYVGNLAWSCDDEMLNQAFSQFGEVKAAEVVLDRESGRSRGFAFVTMASPDAAEKARRG 150

Query: 269 -GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
               +L GR I      P+  + P+   G
Sbjct: 151 LDGTELAGRAIRVNFPQPKGERAPRAERG 179



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +  +  +L+VG L W      L+  F  +G V    V+ + +SGRSRGF FV  + P 
Sbjct: 197 DGEAGDANRLYVGNLPWSMDDGMLEDLFMEFGTVNYARVVMDRDSGRSRGFAFVALSTPE 256

Query: 245 LVNLVLQN-GPHQLDGRTI 298
             N  + N    ++ GRTI
Sbjct: 257 EANEAMANLDGEEIGGRTI 275


>UniRef50_A2AX49 Cluster: RNA recognition motif 1; n=1; Guillardia
           theta|Rep: RNA recognition motif 1 - Guillardia theta
           (Cryptomonas phi)
          Length = 199

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQ 265
           KLFVGGLSWE   + L   F  +G   +  VM +  SGRSRGFGFVTF++  S    + +
Sbjct: 89  KLFVGGLSWEVDDQQLMEAFQEFGN-CEAKVMVDRYSGRSRGFGFVTFSEEHSAAKAIEE 147

Query: 266 NGPHQLDGRTI 298
               +L GR I
Sbjct: 148 MNGRELLGRQI 158


>UniRef50_Q7RIJ3 Cluster: RNA recognition motif, putative; n=3;
           Plasmodium (Vinckeia)|Rep: RNA recognition motif,
           putative - Plasmodium yoelii yoelii
          Length = 498

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 25/70 (35%), Positives = 47/70 (67%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FV  L +E ++++L++YFS+YG++ID  V KN  + +++GFGFV+F +   ++  L  
Sbjct: 215 RIFVTRLPFEVNKKDLEKYFSKYGKIIDIYVSKNLSNNKNKGFGFVSFENQISMDKALSE 274

Query: 269 GPHQLDGRTI 298
             H + G+ I
Sbjct: 275 KLHIICGKEI 284



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 14/45 (31%), Positives = 28/45 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QSDPRTLH 548
           +F +YGK++++ +  +    K+ G GF+SFE++ S  ++    LH
Sbjct: 233 YFSKYGKIIDIYVSKNLSNNKNKGFGFVSFENQISMDKALSEKLH 277


>UniRef50_Q552K5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 699

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 20/57 (35%), Positives = 39/57 (68%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           K+FVGG+SW+  +  L+ YF ++G V++C ++ +  + +S+G+GF+TF +   +  V
Sbjct: 104 KIFVGGISWKADENTLKTYFLQFGNVLECKIIMDYNTNKSKGYGFITFENEDSIEKV 160



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = +3

Query: 294 PSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKK 473
           PS+LS +  + F + + +  T +  + G      +     +F ++G V+E  I+ D    
Sbjct: 83  PSSLSSSSSSTFSSSSSSKCT-KIFVGGISWKADENTLKTYFLQFGNVLECKIIMDYNTN 141

Query: 474 KSXGXGFLSFEDEXS 518
           KS G GF++FE+E S
Sbjct: 142 KSKGYGFITFENEDS 156


>UniRef50_A7SCR4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 607

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 34/94 (36%), Positives = 46/94 (48%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           DD+E   +F+G LS++  +E L  +F   G    C V+  ++ GRSRGFG+  F      
Sbjct: 363 DDNESMSVFLGNLSFDADEETLAAFFEEKGLSATCRVI--TQEGRSRGFGYADFTSKEDY 420

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
           N  L+       GR I   P N     KP RGGG
Sbjct: 421 NKALELNGEDCCGREIRINPAN----SKPSRGGG 450



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL-QN 268
           L V  LS++T+ ++L   F       +  V+ + ESG SRGFGFV + D      VL + 
Sbjct: 479 LIVRNLSYDTTTDSLGAAFEGCS---NAKVIFDRESGESRGFGFVDYDDVETAKKVLSEM 535

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
              ++DGR +     +PRT +   RGGG
Sbjct: 536 AGAEVDGRQVRLDFASPRT-EGGGRGGG 562


>UniRef50_Q6BY19 Cluster: Debaryomyces hansenii chromosome A of
           strain CBS767 of Debaryomyces hansenii; n=6;
           Saccharomycetales|Rep: Debaryomyces hansenii chromosome
           A of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 447

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 44/128 (34%), Positives = 58/128 (45%), Gaps = 13/128 (10%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           ++E   LFVG LSW    E L+R F   G VI   V+    +G+SRG+G+V F   S   
Sbjct: 194 NEEPATLFVGRLSWSIDDEWLRREFEPVGGVISARVIMERSTGKSRGYGYVDFDSKSAAE 253

Query: 254 LVLQN-GPHQLDGRTID-------PKPCNPRTLQKPKRGGGYPK-----VFLGGLPSNVT 394
             LQ     +LDGR I+       P   NP T  + K+ G  P      +F+G L  N  
Sbjct: 254 KALQEYQGKELDGRPINLDMSTGKPHASNPNT-DRAKQFGDVPSAPSDTLFVGNLSFNAE 312

Query: 395 ETDLRXIF 418
              L   F
Sbjct: 313 RDSLFNTF 320



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--D 238
           D+       LFVG LS+   +++L   F  YG V+ C +  + ++ + +GFG+V F+  D
Sbjct: 293 DVPSAPSDTLFVGNLSFNAERDSLFNTFGEYGTVVSCRIPTHPDTQQPKGFGYVQFSSVD 352

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
            +   L   NG + LDGR        PR      RGG
Sbjct: 353 EAKAALEALNGEY-LDGRACRLDFSTPRDNSNAPRGG 388


>UniRef50_UPI000049A1CF Cluster: TIA-1 protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: TIA-1 protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 306

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 39/123 (31%), Positives = 63/123 (51%), Gaps = 14/123 (11%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           K+FVGGL  E + + L + F ++G V D  V+K +++G+S+G+GFVTF   + +   + +
Sbjct: 130 KIFVGGLQPEVNDDLLYKTFQKFGRVTDARVLKFTQTGKSKGYGFVTFIRKEDAETAMQM 189

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQK---PKR---------GGGYPKVFLGGLPSNVTETDL 406
            NG  +L+GR I           K   PKR               V++G +P NV   DL
Sbjct: 190 MNG-EKLEGRNIKVNWVTSNIASKTEQPKRSYDEINNETSSQNCTVYIGNIPKNVESDDL 248

Query: 407 RXI 415
           + +
Sbjct: 249 KQL 251



 Score = 45.6 bits (103), Expect = 9e-04
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 2/110 (1%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPH 277
           V G+     +  L R FS  G V+ C +M++ +SG   G+GFV F D +       N   
Sbjct: 47  VSGIHESVDEILLGRIFSIVGHVVSCKIMRD-KSGVHAGYGFVEFVDSTTARFAKDN--- 102

Query: 278 QLDGRTIDPK--PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            +DGR +  +    N     + +  G Y K+F+GGL   V +  L   F+
Sbjct: 103 -MDGRVVYGRELKVNWSYTAQQENQGNY-KIFVGGLQPEVNDDLLYKTFQ 150


>UniRef50_UPI000065FE7B Cluster: RNA-binding protein 38 (RNA-binding
           motif protein 38) (RNA-binding region-containing protein
           1) (HSRNASEB) (ssDNA-binding protein SEB4)
           (CLL-associated antigen KW-5).; n=2; Takifugu
           rubripes|Rep: RNA-binding protein 38 (RNA-binding motif
           protein 38) (RNA-binding region-containing protein 1)
           (HSRNASEB) (ssDNA-binding protein SEB4) (CLL-associated
           antigen KW-5). - Takifugu rubripes
          Length = 287

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 24/59 (40%), Positives = 43/59 (72%), Gaps = 1/59 (1%)
 Frame = +2

Query: 56  MNPDMDDDEK-GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M+P M+ D    K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFV+
Sbjct: 1   MHPTMEKDTTYTKIFVGGLPYHTNDASLRKYFESFGDIDEAVVITDKQTGKSRGYGFVS 59


>UniRef50_A7RFA9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 134

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 37/110 (33%), Positives = 60/110 (54%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +FVGGL+  T +E L+ YF ++GEV    +M+ +  G SR +GFV F D      VL+  
Sbjct: 3   VFVGGLASGTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFKDDGPSKEVLKKS 61

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            H ++G+T+D             +   +  +++GGLPS+ TE  +R  F+
Sbjct: 62  -HVINGKTVD-----------VGKSRNFRVIYVGGLPSHFTEQTVREHFK 99


>UniRef50_Q15414 Cluster: RNA-binding motif protein, Y chromosome,
           family 1 member A1; n=37; Homo/Pan/Gorilla group|Rep:
           RNA-binding motif protein, Y chromosome, family 1 member
           A1 - Homo sapiens (Human)
          Length = 496

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 30/96 (31%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F ++G + + +++K+  S +SRGF F+TF +P+ 
Sbjct: 2   VEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    ++G+++  K       +KP  + GG
Sbjct: 60  ---DAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGG 92


>UniRef50_Q5Z4E8 Cluster: Putative uncharacterized protein
           B1386G10.2; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           B1386G10.2 - Oryza sativa subsp. japonica (Rice)
          Length = 284

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 25/48 (52%), Positives = 33/48 (68%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           KLFV GL W    ++L   FS +GE+ DC V+ N +SGRS+G+GFV F
Sbjct: 211 KLFVHGLGWGAEADDLHFAFSLFGELEDCCVISNKQSGRSKGYGFVLF 258


>UniRef50_Q012A5 Cluster: Ps16 protein; n=2; Ostreococcus|Rep: Ps16
            protein - Ostreococcus tauri
          Length = 1094

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = +2

Query: 53   RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
            R   D D  E  +++ G LSW   Q +LQ   S +G V D  ++ + ++GRSRGFGFVT 
Sbjct: 1004 RQRRDFDQAEGRRVYFGNLSWGMDQYDLQDLCSEFGSVEDSRLITDRDTGRSRGFGFVTM 1063

Query: 233  ADPSLVN-LVLQNGPHQLDGRTI 298
            ++ +  + +V Q     +DGR +
Sbjct: 1064 SNTTEADEVVAQLNGQDVDGRVL 1086



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 31/93 (33%), Positives = 48/93 (51%)
 Frame = +2

Query: 80   EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
            ++ +++VG LSW  + E+L   FS + +V D  VMK+ E+GRSRGF FV+  +   V   
Sbjct: 912  DEHRVYVGNLSWGVTDESLAELFSEF-DVRDASVMKDRETGRSRGFAFVSMNNEEDV--- 967

Query: 260  LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
             +     L+GR +D +       Q     G  P
Sbjct: 968  -ERASAALNGREVDGRELRVSKAQAQAERGERP 999


>UniRef50_Q5CIP3 Cluster: Single-stranded G-strand telomeric
           DNA-binding protein; n=3; Cryptosporidium|Rep:
           Single-stranded G-strand telomeric DNA-binding protein -
           Cryptosporidium hominis
          Length = 198

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query: 62  PDMDDDEKGK-LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           P + ++ KGK +FV  L+W+T+QE+L + F+  G +  C V    E GRSRG   + F D
Sbjct: 113 PPLKEENKGKQVFVTNLAWKTTQEDLAKAFNEIGPLESCEVFY-FEDGRSRGIATIVFTD 171

Query: 239 PSLVNLVLQN-GPHQLDGRTI 298
           P+   L ++     ++DGR I
Sbjct: 172 PNHAQLAVEKLNDREIDGREI 192



 Score = 38.7 bits (86), Expect = 0.100
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           M  D+  +++VG L W+    +L+ +  + G VI   V ++ E GRSRG G V ++ P
Sbjct: 1   MVSDKNCRVYVGNLPWKAKWHDLKDHMRQAGNVIRADVFED-EVGRSRGCGVVEYSFP 57


>UniRef50_Q5ZAN1 Cluster: Putative uncharacterized protein
           OSJNBb0053G03.9; n=5; Oryza sativa|Rep: Putative
           uncharacterized protein OSJNBb0053G03.9 - Oryza sativa
           subsp. japonica (Rice)
          Length = 407

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/82 (32%), Positives = 46/82 (56%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+K K+FVGGL    +++ L+ YF+++GEV   +V+ +  +   RGFGF+ FA       
Sbjct: 216 DQKRKIFVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTKMPRGFGFIQFASEESTAR 275

Query: 257 VLQNGPHQLDGRTIDPKPCNPR 322
            L+   H L G+ ++     P+
Sbjct: 276 ALKKDKHFLCGQWVEVSLAMPK 297



 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GK+FVGG+   TS+  L+ +FSR+G V      KN ++G +RGF FV F +P      + 
Sbjct: 29  GKVFVGGVPLGTSESELRAHFSRFGTVAFVGAPKNKQTGAARGFAFVQFVNPDDAAAAIA 88

Query: 266 NGP 274
            GP
Sbjct: 89  AGP 91


>UniRef50_O45189 Cluster: Suppressor protein 12; n=2;
           Caenorhabditis|Rep: Suppressor protein 12 -
           Caenorhabditis elegans
          Length = 248

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/68 (36%), Positives = 42/68 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL + TS + L  YF ++G++ + VV+ +  + +SRG+GFVT  D +      ++
Sbjct: 36  KIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKD 95

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 96  PNPIIDGR 103


>UniRef50_A7AWX7 Cluster: RNA recognition motif. (A.k.a. RRM, RBD,
           or RNP) domain containing protein; n=1; Babesia
           bovis|Rep: RNA recognition motif. (A.k.a. RRM, RBD, or
           RNP) domain containing protein - Babesia bovis
          Length = 110

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLF+G L  +TS   ++ YF ++GE+ +  + ++S + + +GFGF+TF     +  V+Q 
Sbjct: 30  KLFIGRLDPDTSVGTMRHYFGQFGEIAEAYIPRDSYTLKGKGFGFLTFTHKDSILAVMQP 89

Query: 266 NGPHQLDGRTI 298
           N  H +DGR +
Sbjct: 90  NAKHYIDGREV 100


>UniRef50_P27476 Cluster: Nuclear localization sequence-binding
           protein; n=3; Saccharomycetaceae|Rep: Nuclear
           localization sequence-binding protein - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 414

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 1/111 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + +E   +FVG LSW    E L++ F   G VI   V+    + RSRG+G+V F + S  
Sbjct: 163 ETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYA 222

Query: 251 NLVLQNGPHQLDGRTIDPKPCN-PRTLQKPKRGGGYPKVFLGGLPSNVTET 400
              +Q    ++ G+ ID +P N   +  KP       K F G  PS  ++T
Sbjct: 223 EKAIQ----EMQGKEIDGRPINCDMSTSKPAGNNDRAKKF-GDTPSEPSDT 268



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D   +    LF+G LS+   ++ +   F+++GEV+   +  + E+ + +GFG+V F++  
Sbjct: 260 DTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNME 319

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCN-PRTLQKPKRGGG 352
                L      L G  ID +P     +  +P   GG
Sbjct: 320 DAKKALD----ALQGEYIDNRPVRLDFSSPRPNNDGG 352


>UniRef50_UPI0000DA279E Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand RNA-binding protein) (hnRNP core
           protein A1) (HDP); n=1; Rattus norvegicus|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand RNA-binding protein) (hnRNP core protein
           A1) (HDP) - Rattus norvegicus
          Length = 131

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 1/95 (1%)
 Frame = +2

Query: 110 SWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDG 289
           S++   E  + +F ++G + DC VM++  + R R FGFVT A    V++ + + PH++DG
Sbjct: 14  SFKLMDECPRSHFEQWGTLTDCAVMRDPNTKRFRVFGFVTCATVVEVDVAVNSRPHKVDG 73

Query: 290 RTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNV 391
           R +DPK    R   QKP     Y +V     P++V
Sbjct: 74  RVVDPKRTVSREDSQKPV----YSEVIFVDFPNSV 104


>UniRef50_Q8LLE6 Cluster: RNA-binding protein AKIP1; n=7; core
           eudicotyledons|Rep: RNA-binding protein AKIP1 - Vicia
           faba (Broad bean)
          Length = 515

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/73 (35%), Positives = 40/73 (54%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D    K+FV GL W+T+   L   FS+YGE+ DC  + +  SG+S+G+GF+ F   S   
Sbjct: 147 DASHRKIFVHGLGWDTTSATLINAFSQYGEIEDCKAVTDKASGKSKGYGFILFKKRSGAR 206

Query: 254 LVLQNGPHQLDGR 292
             L+    ++  R
Sbjct: 207 NALKEPQKKIGNR 219



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 19/86 (22%), Positives = 37/86 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+++  +  E     L  YFSR+GE+ +  +  +  +G+ +GF    +         L+ 
Sbjct: 252 KIYISNVGPELDPHKLFAYFSRFGEIEEGPLGLDKATGKPKGFCLFVYKSAESARRSLEE 311

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG 346
              + +G  +    C  R +  PK G
Sbjct: 312 PHKEFEGHILH---CQ-RAIDGPKAG 333


>UniRef50_Q5A4G6 Cluster: Putative uncharacterized protein PUB1;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein PUB1 - Candida albicans (Yeast)
          Length = 510

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 43/137 (31%), Positives = 65/137 (47%), Gaps = 7/137 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           NP+  ++    +FVG LS E + E L+  FS++  +    VM + ++ RSRG+GFVTF +
Sbjct: 164 NPNNTEEPLFNIFVGDLSPEVNDEGLRNAFSKFESLKQAHVMWDMQTSRSRGYGFVTFGN 223

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKP-----KRGGGYPKVFLGGLPSNVTE 397
            S   L LQ  NG   L GR I     + +  Q+      + GGGY + +      N   
Sbjct: 224 QSDAELALQTMNG-EWLCGRAIRCNWASHKQQQQQQHYNNQHGGGYSRGYRNNNGGNNNN 282

Query: 398 TDLRXIFRTLWEGHGGG 448
              R  F  +  G+  G
Sbjct: 283 RQFRQ-FNNINNGNNNG 298


>UniRef50_UPI0000E4A54D Cluster: PREDICTED: hypothetical protein;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 244

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/68 (36%), Positives = 42/68 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL + T+ ++L+ +F  YG + + VV+ +  SG+S+G+GFVT +D        + 
Sbjct: 11  KIFVGGLPYHTTDKSLRDHFEIYGTIEEAVVITDRTSGKSKGYGFVTMSDQREAETATKE 70

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 71  ANPIIDGR 78


>UniRef50_UPI0000E4615D Cluster: PREDICTED: similar to heterogeneous
           nuclear ribonucleoprotein A3, partial; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           heterogeneous nuclear ribonucleoprotein A3, partial -
           Strongylocentrotus purpuratus
          Length = 697

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/78 (32%), Positives = 45/78 (57%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           ++   ++FVGG+   T++  +   F ++GEV++  +  N ++G+ RGF FVTFA   +V 
Sbjct: 112 NENTNRIFVGGIPENTTEAAMIDAFGKFGEVVEVEIPPNEKNGKPRGFAFVTFATKEIVG 171

Query: 254 LVLQNGPHQLDGRTIDPK 307
            V+    H   GR ++ K
Sbjct: 172 EVVATKYHTFLGRKVEVK 189



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 11/121 (9%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL  ++S+ +L   F  +G ++D V+M    + + +GFGFVTF+   ++  V+  
Sbjct: 17  KLFLGGLRSQSSERHLYEAFLPFGHIVD-VLMVRGPNHKPKGFGFVTFSKAYMMEAVITA 75

Query: 269 GPHQ---LDGRTIDPKPCNPRTLQKPKRG---GGYP-----KVFLGGLPSNVTETDLRXI 415
            P     +DG++++ K  +     + K        P     ++F+GG+P N TE  +   
Sbjct: 76  HPDMRVIVDGKSVEIKRISEGEPSRSKAALLKAAIPNENTNRIFVGGIPENTTEAAMIDA 135

Query: 416 F 418
           F
Sbjct: 136 F 136


>UniRef50_Q4SG98 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 413

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/104 (29%), Positives = 54/104 (51%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D++D+E  ++FV  +    S+E+L+  F  YG++  CV++KN  +G S+G G+V +  PS
Sbjct: 97  DVEDEELTRIFVT-IPKSYSEEDLKETFKEYGDIEYCVILKNKTTGESKGLGYVRYYKPS 155

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L ++N       R I  +P N     +    G     ++GG
Sbjct: 156 QAALAIENCDKTY--RAILAEPRNKAAATEDYSAGSSRNDYMGG 197


>UniRef50_Q6ID29 Cluster: At4g13860; n=9; cellular organisms|Rep:
           At4g13860 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 87

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 1/74 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG LS  T+ + L+  FS YG V+D +VM++  + RSRGFGFVT++  S     +  
Sbjct: 4   RVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSG 63

Query: 269 -GPHQLDGRTIDPK 307
               +L+GR +  K
Sbjct: 64  MDGKELNGRRVSVK 77


>UniRef50_Q4XN28 Cluster: RNA binding protein, putative; n=6;
           Plasmodium|Rep: RNA binding protein, putative -
           Plasmodium chabaudi
          Length = 369

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/101 (30%), Positives = 57/101 (56%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           +E  K F+GG+    + + +  YF +YG V + V+ ++ E+ R+RGF FVT +     + 
Sbjct: 100 NEPFKFFIGGIPQNITNKYISEYFEKYGPVQNVVIAQDHETKRNRGFAFVTMSSHINKDK 159

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
           +L +  H+L+G+ +D +  +  T    +R     K+F+GGL
Sbjct: 160 ILTDS-HELNGKRVDVREEHNTTPSDIQR-----KIFVGGL 194



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 27/66 (40%), Positives = 39/66 (59%)
 Frame = +2

Query: 143 YFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
           YFS +GE ID V +    SGRSR FGFV F + S V  VL++  H++  + ++ +   P+
Sbjct: 229 YFSAFGE-IDIVQIVVDSSGRSRCFGFVVFTNESSVAKVLKHKRHKIYDKMVEVRKAEPK 287

Query: 323 TLQKPK 340
              KPK
Sbjct: 288 ---KPK 290


>UniRef50_Q23RL2 Cluster: Nucleolar phosphoprotein, putative; n=2;
           Tetrahymena thermophila|Rep: Nucleolar phosphoprotein,
           putative - Tetrahymena thermophila SB210
          Length = 491

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/77 (40%), Positives = 47/77 (61%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           +D+D K  +FVG LS+ T +E L+++F+  G+V D  + +    G+SRGFG V F + S 
Sbjct: 365 VDEDSK-TIFVGNLSFRTDKETLKKFFASCGKVADARIAE--ADGKSRGFGHVEFEERSG 421

Query: 248 VNLVLQNGPHQLDGRTI 298
           V   L+    Q+DGR I
Sbjct: 422 VENALKKVGEQIDGRPI 438



 Score = 36.3 bits (80), Expect = 0.53
 Identities = 28/119 (23%), Positives = 52/119 (43%), Gaps = 4/119 (3%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRY-GEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D    ++ V GLS++  + ++  +     G V    ++KN E GRS+G  FV+F      
Sbjct: 274 DKFSNEVIVKGLSFDADENDIGNFLDENCGSVARVNLLKN-EQGRSKGIAFVSFETEEGC 332

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKR---GGGYPKVFLGGLPSNVTETDLRXIF 418
           N  ++    +  GR +  +   P+T ++P           +F+G L     +  L+  F
Sbjct: 333 NKAVEMSNSEFMGRYLIIEKTKPKT-ERPAHLPVDEDSKTIFVGNLSFRTDKETLKKFF 390


>UniRef50_Q6MCT2 Cluster: Probable nucleic acid-binding protein;
           n=1; Candidatus Protochlamydia amoebophila UWE25|Rep:
           Probable nucleic acid-binding protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 112

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 1/97 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG LSW+TS+E L+ +F  +G+V+   ++ +  +G+S+GFGFV     +      +N
Sbjct: 3   KIFVGNLSWKTSEEQLKAHFEAFGKVVSAKIVTDQMTGKSKGFGFVEMESAN----DAEN 58

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG-GGYPKVFLGG 376
              +L+G+ +  +       Q+  R     P+ F GG
Sbjct: 59  AIRELNGKPLVDRSLRVSLAQERDRSERREPRSFGGG 95


>UniRef50_Q8RYD4 Cluster: UBP1 interacting protein 1a; n=5;
           Arabidopsis thaliana|Rep: UBP1 interacting protein 1a -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 344

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K+FV GL WET++E L   F  YGE+ +C V+ +  +G+++GFGFV F
Sbjct: 106 KIFVYGLPWETTRETLVGVFEGYGEIEECTVLIDKATGKAKGFGFVMF 153


>UniRef50_A7PJ01 Cluster: Chromosome chr13 scaffold_17, whole genome
           shotgun sequence; n=3; Magnoliophyta|Rep: Chromosome
           chr13 scaffold_17, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 270

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 5/119 (4%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   K++VGG+ + +++++++ YF   G + +   M   ESG+ RG   ++F   +    
Sbjct: 34  DASNKVYVGGIPYYSTEDDIRSYFDSCGTITEVDCMMFPESGKFRGIAIISFKTEAAAKR 93

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQK-----PKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            L      + G  +  +P       K     P+   GY ++++G LP ++TE ++R  F
Sbjct: 94  ALALDGADMGGLFLKIQPYKTTRANKSSDFAPEMVEGYNRIYVGNLPWDITEDEVRKFF 152



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 22/86 (25%), Positives = 43/86 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +++VG L W+ +++ ++++FSR   V       + E+   RG+  V F+D   + + L  
Sbjct: 133 RIYVGNLPWDITEDEVRKFFSRC-NVSSIRFGMDKETQEFRGYAHVDFSDNPSLTMAL-- 189

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRG 346
              +LD   +  +P   R    PK+G
Sbjct: 190 ---KLDQEIVCGRPAKIR-CAVPKKG 211


>UniRef50_A7NYH5 Cluster: Chromosome chr6 scaffold_3, whole genome
           shotgun sequence; n=12; Eukaryota|Rep: Chromosome chr6
           scaffold_3, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 429

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/74 (35%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E   +FVGG+ ++ ++ +L   FS+YGE++D  ++++  +G+S+GF FV + D    NL 
Sbjct: 34  ESAYVFVGGIPFDLTEGDLLAVFSQYGEIVDVNLVRDKGTGKSKGFAFVAYEDQRSTNLA 93

Query: 260 LQN-GPHQLDGRTI 298
           + N    Q+ GR I
Sbjct: 94  VDNLNGAQILGRII 107



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 12/34 (35%), Positives = 24/34 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG++++V ++ D+   KS G  F+++ED+ S
Sbjct: 56  FSQYGEIVDVNLVRDKGTGKSKGFAFVAYEDQRS 89


>UniRef50_Q5CXY1 Cluster: T8M16_190 RRM protein of possible plant
           origin; n=2; Cryptosporidium|Rep: T8M16_190 RRM protein
           of possible plant origin - Cryptosporidium parvum Iowa
           II
          Length = 383

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/70 (37%), Positives = 46/70 (65%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K KLF+  LS  T+ E+L++ FS + ++ +C VM++  +G+SR +GF+TF +   +  VL
Sbjct: 192 KKKLFIRNLSESTTNESLRQAFSEFEDIEECFVMRDHNTGKSRKYGFITFNNLGDMMKVL 251

Query: 263 QNGPHQLDGR 292
           Q+    +DG+
Sbjct: 252 QHPERIVDGK 261



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           ++ V  +S++TS +     F ++GE+ D  +++  ++GRSRG+GFVT+     +      
Sbjct: 89  RVMVRNISFQTSDKVFLNLFEKFGEIEDSTIIRE-KNGRSRGYGFVTYKSSESIKKLFNE 147

Query: 251 NLVLQNGPHQL--------DGRTIDPKPCNPRTLQKPKRGGG---YPKVFLGGLPSNVTE 397
           NL+L NG   L           T  P  CN + ++  +R        K+F+  L  + T 
Sbjct: 148 NLIL-NGRQLLVKLAADPFSEFTCGPIDCNKQVMESNQRLTSTIFKKKLFIRNLSESTTN 206

Query: 398 TDLRXIF 418
             LR  F
Sbjct: 207 ESLRQAF 213


>UniRef50_A6N9V7 Cluster: RNA binding protein; n=1; Ornithodoros
           parkeri|Rep: RNA binding protein - Ornithodoros parkeri
          Length = 88

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           ++FVG LSW   ++ L+ YFS++G V   +V+ + ++G S+G+GFV F +    +N   Q
Sbjct: 9   RVFVGNLSWTVGKKELRDYFSQFGYVSSAMVIFDKDTGMSKGYGFVRFGNKDGYINATRQ 68

Query: 266 NGPHQLDGRTI 298
              H L+G T+
Sbjct: 69  Q-QHDLEGNTL 78


>UniRef50_UPI00005A196B Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP); n=1; Canis lupus familiaris|Rep:
           PREDICTED: similar to Heterogeneous nuclear
           ribonucleoprotein A1 (Helix-destabilizing protein)
           (Single-strand binding protein) (hnRNP core protein A1)
           (HDP) - Canis familiaris
          Length = 286

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 28/85 (32%), Positives = 48/85 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D    + ++  
Sbjct: 60  KIFVGGIEEDTEEHHLRGYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFNDHDSADKIVIQ 119

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKR 343
             H ++G   +      +  Q+PKR
Sbjct: 120 KYHTVNGHNCEVGKALLK--QEPKR 142


>UniRef50_Q569S7 Cluster: LOC443584 protein; n=5; Xenopus|Rep:
           LOC443584 protein - Xenopus laevis (African clawed frog)
          Length = 414

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/77 (33%), Positives = 45/77 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D K   FVG L ++  +E+++++FS+ G+V    ++++ ++G  +GFG+V F     V L
Sbjct: 270 DNKRSAFVGNLPYDIEEESIRKHFSQCGDVQGVRIIRDQKTGIGKGFGYVLFESADAVQL 329

Query: 257 VLQNGPHQLDGRTIDPK 307
            L+    QL GR I  K
Sbjct: 330 ALKLNNSQLSGRRIRVK 346


>UniRef50_O04240 Cluster: RNA- or ssDNA-binding protein; n=2;
           Papilionoideae|Rep: RNA- or ssDNA-binding protein -
           Vicia faba var. minor
          Length = 289

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLF+G LSW+ + E L   F  +G V+   V+ + E+G SRG+GFV++A+ S +   L  
Sbjct: 209 KLFIGNLSWKVTSEILTEAFQEHGTVVGARVIYDGETGNSRGYGFVSYANKSEMEAALTI 268

Query: 266 NGPHQLDGRTI 298
               +L+GR +
Sbjct: 269 MNDVELEGRAL 279



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 5/122 (4%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           ++D + KL+ G L +      L      YG      V+ + ++G+SRGF F T       
Sbjct: 112 EEDTRTKLYFGNLPYSVDSAKLAGLIEEYGSAELVEVLYDRDTGKSRGFAFATMTCVEDC 171

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGGYP----KVFLGGLPSNVTETDLRXI 415
             V++N    LDG+    +        KPK +   YP    K+F+G L   VT   L   
Sbjct: 172 KAVIEN----LDGKEFMGRTLRVNFSDKPKAKESLYPETEYKLFIGNLSWKVTSEILTEA 227

Query: 416 FR 421
           F+
Sbjct: 228 FQ 229


>UniRef50_A4S763 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 288

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 8/119 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYG-EVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVL 262
           + + G L+WETS+E L  + + +G  V+ C V + S  GRS+G+  V FA P    N + 
Sbjct: 113 RCYFGNLAWETSEETLTSHCASFGVNVVQCEVARQS-GGRSKGWALVDFATPEEAQNAIE 171

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP------KVFLGGLPSNVTETDLRXIFR 421
           Q    ++ GR+I  +   P   QK  R    P      ++ +  LP   T  DLR +F+
Sbjct: 172 QMHNSEIQGRSIIVRVERPGAGQKSARVETRPENSSGLQIVVRNLPWTTTSEDLRQVFQ 230



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 28/99 (28%), Positives = 45/99 (45%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D+D     +L+VG + W T+ E+L+  F+  G V   V +     GRSRG+G V F   +
Sbjct: 2   DVDGGSSARLYVGNIPWSTTIEDLRELFAECGGVTR-VDIPTGRQGRSRGYGLVEFNSEA 60

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
                 Q    ++DG  +  +    R  + P +  G  K
Sbjct: 61  ----EAQAAVTRMDGTPLGDRTITVREDKAPTKAAGGAK 95



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 17/48 (35%), Positives = 33/48 (68%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++ V  L W T+ E+L++ F + G V++ V + ++++GRS+G+G V F
Sbjct: 210 QIVVRNLPWTTTSEDLRQVFQQVGNVVNAVAVCHTDTGRSKGWGTVLF 257


>UniRef50_Q57XH6 Cluster: RNA-binding protein, putative; n=1;
           Trypanosoma brucei|Rep: RNA-binding protein, putative -
           Trypanosoma brucei
          Length = 318

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           + F+GGL  + + ++++ YFS +G+V+   ++K   SG SRGFG+V F  P     V + 
Sbjct: 22  RFFIGGLHRQITPQDVEEYFSNFGDVM-TFILKRDPSGNSRGFGWVVFNSPP--TGVQRP 78

Query: 269 GPHQLDG--RTIDPKPCNPRTLQKPKRGGG 352
            PH L G   T++P   N RT +  +  GG
Sbjct: 79  EPHYLKGVKLTVEPALANVRTDRVRRVPGG 108


>UniRef50_A2DHF2 Cluster: Putative uncharacterized protein; n=2;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 202

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 30/84 (35%), Positives = 49/84 (58%), Gaps = 5/84 (5%)
 Frame = +2

Query: 62  PDMDDDEKGK----LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           P  DD EK      + VG LS+ET++E+L+  FS +G VI   +   ++SG+S+GFGF+ 
Sbjct: 33  PQQDDKEKKPETITVHVGNLSFETTEESLKIKFSEFGNVISSRIPVRAQSGKSKGFGFIE 92

Query: 230 FADPSLVN-LVLQNGPHQLDGRTI 298
           +A     +  + +    + +GRTI
Sbjct: 93  YATQEEADKAIAEMNKKEFEGRTI 116


>UniRef50_Q5KBA9 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 373

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/70 (37%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           ++VGGL +E ++ +L   FS++GE++D  ++++ E+G+SRGFGF+ + D     L + N 
Sbjct: 33  IYVGGLPFELTEGDLITIFSQWGEIMDVNLVRDKETGKSRGFGFLMYEDQRSTVLAVDNM 92

Query: 269 GPHQLDGRTI 298
              Q+ GRT+
Sbjct: 93  NGTQVIGRTL 102



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F ++G++M+V ++ D+   KS G GFL +ED+ S
Sbjct: 51  FSQWGEIMDVNLVRDKETGKSRGFGFLMYEDQRS 84


>UniRef50_UPI0000498349 Cluster: RNA-binding protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: RNA-binding protein -
           Entamoeba histolytica HM-1:IMSS
          Length = 414

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +FVG L ++  +E L++ FS+ GE+    +++ S+SG  RG GFVTF +   V   L   
Sbjct: 284 IFVGNLPFKMEEEQLRKLFSKAGEIERVKIVRESKSGMGRGIGFVTFTNKEDVQKGLNMV 343

Query: 272 PHQLDGRTIDPKPC 313
             ++ GR I  +PC
Sbjct: 344 GEKVKGRQIRVEPC 357


>UniRef50_Q83CD7 Cluster: Nucleic acid binding domain protein; n=3;
           Coxiella burnetii|Rep: Nucleic acid binding domain
           protein - Coxiella burnetii
          Length = 103

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-ADPSLVNLV 259
           + K++VG LS++ + + LQ +F +YGE+ +  ++ + E+GRS+GF F+T+    +    V
Sbjct: 3   QNKIYVGSLSYDVTADELQSFFGQYGEIEEAKLIMDRETGRSKGFAFITYGTQDAAQEAV 62

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
            +     L GR I        T  + + GG   +   GG
Sbjct: 63  SKANGIDLQGRKIRVNIARENTGDRRRDGGSGGRGGRGG 101


>UniRef50_Q9ZUJ3 Cluster: T2K10.5 protein; n=3; Magnoliophyta|Rep:
           T2K10.5 protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 258

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG LSW  + E+L   F   G+V+   V+ + ++GRSRG+GFV ++  + +   L++
Sbjct: 178 KLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALES 237

Query: 269 -GPHQLDGRTI 298
               +L+GR I
Sbjct: 238 LDGFELEGRAI 248



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 3/114 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+ G L +      L +    +       V+ N ++G+SRGF FVT ++    N+++ N
Sbjct: 86  KLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDN 145

Query: 269 --GPHQLDGRTIDPKPCN-PRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
             G   L GR +     + P+  ++P       K+F+G L   VT   L   FR
Sbjct: 146 LDGTEYL-GRALKVNFADKPKPNKEPLYPETEHKLFVGNLSWTVTSESLAGAFR 198


>UniRef50_Q10N84 Cluster: RNA-binding protein, putative, expressed;
           n=5; Magnoliophyta|Rep: RNA-binding protein, putative,
           expressed - Oryza sativa subsp. japonica (Rice)
          Length = 173

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 1/84 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLVLQ 265
           KLF+ GLS  T+ E L+  F+ +G++++  V+ +  SGRS+GFGFV +A      N   +
Sbjct: 68  KLFISGLSRLTTDEKLKNAFAPFGQLLEAKVITDRISGRSKGFGFVRYATLEEAENARQE 127

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKP 337
                LDG  I   P  PR  QKP
Sbjct: 128 MNAKFLDGWVIFVDPAKPRQ-QKP 150


>UniRef50_A2XBX0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 252

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 10/126 (7%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E GK+   GL + T++  ++  F R+G +    + +  +SG  RG  FV+F    +    
Sbjct: 71  ETGKVVASGLPYTTTEAEIRELFERFGPLRSLQLSRFPDSGNFRGLAFVSFESNEVAMKS 130

Query: 260 LQNGPHQLDGRTIDPKPC-------NPRTLQ---KPKRGGGYPKVFLGGLPSNVTETDLR 409
           L+    ++  R +  + C         RT++    PK+  G    ++G L  +VTETDLR
Sbjct: 131 LELDGFKIGNRFMRVERCRLAAGSKRKRTVEFQTDPKKADGCLSAYVGNLKWDVTETDLR 190

Query: 410 XIFRTL 427
             F++L
Sbjct: 191 DFFKSL 196


>UniRef50_Q5KP11 Cluster: Single-stranded DNA binding protein,
           putative; n=2; Filobasidiella neoformans|Rep:
           Single-stranded DNA binding protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 441

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 27/76 (35%), Positives = 42/76 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D++    +FVG LSW    + L+  F   GEV+   V+ + +S +SRGFG+V FAD    
Sbjct: 188 DEEATTNVFVGQLSWNVDNDWLKSEFESCGEVVSARVVFDRDSQKSRGFGYVEFADLESS 247

Query: 251 NLVLQNGPHQLDGRTI 298
              ++    ++DGR I
Sbjct: 248 AKAIEKDGSEIDGRAI 263



 Score = 39.1 bits (87), Expect = 0.075
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           L++G LS+  +++ +   F ++G+V    +  + ++G  +GFG+V F+  D +   L   
Sbjct: 295 LWIGSLSFSVTEDQVYEAFGQHGDVQSVRLPTDRDTGAPKGFGYVQFSSVDDASAALKAM 354

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGG 349
           NG  ++ GR I      P+     +RGG
Sbjct: 355 NGA-EIAGRAIRVDFAPPKQ-DNGERGG 380


>UniRef50_A6SJV1 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 518

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 32/92 (34%), Positives = 45/92 (48%), Gaps = 2/92 (2%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS-- 244
           +D+    LFVG LSW    E L R F  +GE+    V+ +  +GRS+GFG+V F   S  
Sbjct: 261 EDNGSKNLFVGNLSWNIDDEWLYREFEEFGEISGARVISDKATGRSKGFGYVEFVKSSDA 320

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK 340
              L  + G   +DGR  +     PR    P+
Sbjct: 321 AAALAAKKGA-LIDGREANVDFSTPRDTTAPR 351



 Score = 40.3 bits (90), Expect = 0.033
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           D  +     LF+G LS++  +  +   F  +G V++  +  + E+G  +GFG+VTF
Sbjct: 363 DAKNPPSDTLFLGNLSFDADENVVGEAFGEHGTVVNVRLPTDQETGNPKGFGYVTF 418


>UniRef50_Q6ZZX5 Cluster: Heterogeneous nuclear ribonucleoprotein;
           n=2; Euteleostomi|Rep: Heterogeneous nuclear
           ribonucleoprotein - Salmo salar (Atlantic salmon)
          Length = 120

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 25/67 (37%), Positives = 39/67 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL  +   E+L  YFS++GE+    V+   E+G+ RGFGFV F D    +  +  
Sbjct: 36  KIFIGGLKDDIEDEHLNDYFSQFGEIEKAEVIAEKETGKKRGFGFVHFTDNDSADKAVVV 95

Query: 269 GPHQLDG 289
             H ++G
Sbjct: 96  KFHTING 102


>UniRef50_Q83D11 Cluster: RNA-binding protein; n=3; Coxiella
           burnetii|Rep: RNA-binding protein - Coxiella burnetii
          Length = 129

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D   +++VG L +   + +L +YFSR+G +    +++N  +GRS+G+ FVT+  P     
Sbjct: 41  DNNDQIYVGNLPYHVVENDLHQYFSRFGAIESVKIVRNFRTGRSKGYAFVTYVTPKQAVK 100

Query: 257 VLQNGPHQLDGRTI 298
            L      L GR++
Sbjct: 101 ALDAHGKDLQGRSL 114


>UniRef50_Q9LES2 Cluster: Putative uncharacterized protein
           T8M16_190; n=3; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein T8M16_190 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 478

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +D    K+FV GL W+T  E L   F +YGE+ DC  + +  SG+S+G+GF+ +   S  
Sbjct: 135 EDPVHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGA 194

Query: 251 NLVLQNGPHQLDGR 292
              L+    ++  R
Sbjct: 195 RNALKQPQKKIGSR 208


>UniRef50_Q9C5A7 Cluster: Putative uncharacterized protein
           At5g08700; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein At5g08700 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 768

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 31/127 (24%), Positives = 62/127 (48%), Gaps = 3/127 (2%)
 Frame = +2

Query: 50  MRMNPDMDDD--EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGF 223
           M +  D  DD  + G+LFV GL + T++E L  +FS++G++ +  ++ + ++   RG  F
Sbjct: 241 MEVEADGSDDVLDAGRLFVHGLPYSTTEEELMEHFSKFGDISEVHLVLDKDTRSCRGMAF 300

Query: 224 VTFADPSLVNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTET 400
           V +  P    + +         GRT+   P  PR +   +    + ++F+   P+    +
Sbjct: 301 VLYLIPESAKMAMDKLDKLPFQGRTLHILPAKPRAMSAKQ---DFHQMFIMDFPNRDNSS 357

Query: 401 DLRXIFR 421
           +L   F+
Sbjct: 358 NLPKSFK 364


>UniRef50_A5BLC5 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 443

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 24/61 (39%), Positives = 39/61 (63%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           +R   D D   + K+FV GL W+T++E L   F  YG++ DC V+ +  +G+++G+GFV 
Sbjct: 81  IRETADRDVSHR-KIFVHGLGWDTTRETLLAAFEPYGQIEDCNVVTDRNTGKAKGYGFVL 139

Query: 230 F 232
           F
Sbjct: 140 F 140



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 13/51 (25%), Positives = 29/51 (56%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           P   D    K++V  +  +   E L+ +F+++GE+    +  ++++G+SRG
Sbjct: 175 PQSQDTVGRKIYVSNVQADVDPERLRSFFAKFGEIETGPIGFDTQTGKSRG 225


>UniRef50_Q23RL1 Cluster: Nucleolar phosphoprotein; n=1; Tetrahymena
           thermophila SB210|Rep: Nucleolar phosphoprotein -
           Tetrahymena thermophila SB210
          Length = 320

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 28/75 (37%), Positives = 46/75 (61%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +   +FVG LS+ T++E L+++F+  G+V++  + +    G+SRGFG V F + S V 
Sbjct: 230 DQDSKTIFVGNLSFVTNKETLKKFFASCGKVVNARIAE--AEGKSRGFGHVEFEERSGVE 287

Query: 254 LVLQNGPHQLDGRTI 298
             L+    Q+DGR I
Sbjct: 288 NALKMAGEQIDGRPI 302



 Score = 38.3 bits (85), Expect = 0.13
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFS-RYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++ V GLS++ ++ ++  YF  + G+V    ++ NS+ GRS+G  FV+F      N  L+
Sbjct: 33  EVIVKGLSFDANENDISNYFDQKCGQVSKVKLLMNSQ-GRSKGIAFVSFETEEGYNKALE 91

Query: 266 NGPHQLDGR 292
               +  GR
Sbjct: 92  MNNSEFMGR 100



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 4/114 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRY-GEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++ V GLS++  + ++  Y +   G V    ++KN E G S+G  FV+F      N  ++
Sbjct: 143 EVIVKGLSFDADENDIGNYLNENCGSVTRVNLLKN-EQGCSKGVAFVSFETEEGCNKAVE 201

Query: 266 NGPHQLDGRTI---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
               +  GR I     KP   R  Q P        +F+G L     +  L+  F
Sbjct: 202 LSDSEFMGRQIFIEKTKPKIERPAQLPADQDS-KTIFVGNLSFVTNKETLKKFF 254


>UniRef50_Q17385 Cluster: Elav-type ribonucleoprotein; n=8;
           Caenorhabditis|Rep: Elav-type ribonucleoprotein -
           Caenorhabditis elegans
          Length = 584

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 26/66 (39%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLF+G LS + ++ENL+  F+++G + DC V+++ + G+SRG  FV
Sbjct: 129 VQMKPADTENRNERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRD-QDGKSRGCAFV 187

Query: 227 TFADPS 244
           TF + S
Sbjct: 188 TFTNRS 193



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 8/128 (6%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF-- 232
           +P   D +  K+FVG +  + ++ + +R F +YG V  C ++++  +  S+G  FVTF  
Sbjct: 46  SPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYH 105

Query: 233 ------ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVT 394
                 A  +L N+ +  G H      +  KP +  T  + +R     K+F+G L     
Sbjct: 106 RKDAIEAQGALHNIKVIEGMH----HPVQMKPAD--TENRNER-----KLFIGQLSKKHN 154

Query: 395 ETDLRXIF 418
           E +LR IF
Sbjct: 155 EENLREIF 162


>UniRef50_UPI0000E476D6 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 102

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 24/71 (33%), Positives = 42/71 (59%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FV  L W    + L+ YF+++G V +C +  +  +G S+GFGFV+F + S +   L+ 
Sbjct: 8   EVFVSRLPWTIGIQELRSYFTQFGPVRNCRIAFDDSTGFSKGFGFVSFGNTSGMQSALKR 67

Query: 269 GPHQLDGRTID 301
             H LDG  ++
Sbjct: 68  EQHLLDGHKVN 78


>UniRef50_UPI00005A96C6 Cluster: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP), partial; n=1; Canis lupus
           familiaris|Rep: PREDICTED: similar to Heterogeneous
           nuclear ribonucleoprotein A1 (Helix-destabilizing
           protein) (Single-strand binding protein) (hnRNP core
           protein A1) (HDP), partial - Canis familiaris
          Length = 285

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 23/49 (46%), Positives = 37/49 (75%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           K F+G LS+ET+ E+L+ +F ++G ++DCVVM +  +   RG+GFVT+A
Sbjct: 180 KPFIGVLSFETTDESLRSHFEQWGTLMDCVVMSDRNTKCPRGYGFVTYA 228



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           +FVGG+  +T + + + YF +YG++    +M +  S + RGF FVTF D   V  +
Sbjct: 230 IFVGGIKEDTEEHHPRDYFEQYGKIEVIEIMTDQGSDKKRGFAFVTFDDQDSVEKI 285



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM DQ   K  G  F++F+D+ S
Sbjct: 247 YFEQYGKIEVIEIMTDQGSDKKRGFAFVTFDDQDS 281


>UniRef50_UPI000065DEA8 Cluster: RNA-binding protein 24 (RNA-binding
           motif protein 24) (RNA-binding region-containing protein
           6).; n=1; Takifugu rubripes|Rep: RNA-binding protein 24
           (RNA-binding motif protein 24) (RNA-binding
           region-containing protein 6). - Takifugu rubripes
          Length = 258

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 22/58 (37%), Positives = 40/58 (68%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M+    D    K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFV+
Sbjct: 1   MHSAQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVS 58


>UniRef50_Q3B6Q3 Cluster: RNA-binding region RNP-1; n=6;
           Chlorobium/Pelodictyon group|Rep: RNA-binding region
           RNP-1 - Pelodictyon luteolum (strain DSM 273)
           (Chlorobium luteolum (strain DSM273))
          Length = 99

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D K  +++G L +  S+++L+  FS++G+V    ++ +  SGRS+GFGFV  +       
Sbjct: 7   DLKMNIYIGNLPYSVSEDDLRDAFSQFGQVDSANIIMDKFSGRSKGFGFVDMSSDEAGRA 66

Query: 257 VLQ-NGPHQLDGRTIDPKPCNPRTLQKPKR 343
            ++     +  GRTI      PR  + P+R
Sbjct: 67  AIEAMNEQEFKGRTIKVNEARPREERAPRR 96


>UniRef50_Q01L95 Cluster: OSIGBa0137L20.5 protein; n=7; Oryza
           sativa|Rep: OSIGBa0137L20.5 protein - Oryza sativa
           (Rice)
          Length = 137

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 5/96 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +LF+GGLS   ++++L   FS+YG+V++  ++ +  + R +GFGFV FA     N   + 
Sbjct: 38  RLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTDKMTNRPKGFGFVKFASEEAANKAKEE 97

Query: 266 -NGPHQLDGRTI---DPKPCNPRTLQKPKRGGGYPK 361
            NG   L+GR I     K    RT     R  G PK
Sbjct: 98  MNG-KVLNGRVIYVDIAKAKMNRTTDSSPRATGPPK 132



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +3

Query: 273 LINLMAGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           L++    P+  +R  L L  +R +   T R  + G  +   +      F +YG+V+E  I
Sbjct: 13  LVSRRESPAAYARPFL-LTHSRGI---TYRLFIGGLSQFATEDSLAEAFSQYGQVLEATI 68

Query: 453 MYDQXKKKSXGXGFLSFEDE 512
           + D+   +  G GF+ F  E
Sbjct: 69  VTDKMTNRPKGFGFVKFASE 88


>UniRef50_Q43349 Cluster: 29 kDa ribonucleoprotein, chloroplast
           precursor; n=5; Arabidopsis thaliana|Rep: 29 kDa
           ribonucleoprotein, chloroplast precursor - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 342

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG LSW      L+  F+  G+V++  V+ + +SGRS+GFGFVT +    V   +  
Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 317

Query: 266 -NGPHQLDGRTI 298
            NG   LDGR I
Sbjct: 318 LNGA-DLDGRQI 328



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 7/106 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           KLFVG LS+      L + F   G V    V+ +  +GRSRGFGFVT +  + V    Q 
Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQ 159

Query: 266 -NGPHQLDGRTI-----DPKPCNPRTLQKPKRGGGYPKVFLGGLPS 385
            NG ++ +GR +      P P    +  +  R GGY     GG  S
Sbjct: 160 FNG-YEFEGRPLRVNAGPPPPKREESFSRGPRSGGYGSERGGGYGS 204


>UniRef50_Q5EUH9 Cluster: Putative uncharacterized protein; n=1;
           Gemmata sp. Wa1-1|Rep: Putative uncharacterized protein
           - Gemmata sp. Wa1-1
          Length = 122

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KL+VG LSW  +   LQ  F+ YG V+   V+ + ++GRS+GFGFV           +  
Sbjct: 41  KLYVGNLSWGVTDSQLQDMFTPYGSVVSAQVIMDRDTGRSKGFGFVEMGTDQEAQAAI-T 99

Query: 269 GPH--QLDGRTIDPKPCNPRTL 328
           G H   ++GR +      P+ L
Sbjct: 100 GMHGQVIEGRPLTVNEARPKKL 121


>UniRef50_A7P2N7 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 140

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 24/71 (33%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++ V  LS+ TS+ +LQ  FS++G++++  V+K+  + R RG+ F+ +       L L+N
Sbjct: 39  RIMVTNLSYATSKSSLQEEFSKFGQIVEVDVVKDKAAKRPRGYAFIQYTSQDHAMLALEN 98

Query: 269 GPHQ-LDGRTI 298
             H+ LDGR +
Sbjct: 99  MDHKYLDGRVV 109


>UniRef50_Q553V5 Cluster: Putative uncharacterized protein; n=4;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 91

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FV  L W   +E L+ +FS++G + DC V+ +  + RS+GFGFV F     V   + N
Sbjct: 5   KIFVTRLPWSVCKEALKNHFSQFGNIKDCYVVLDRVTKRSKGFGFVQFESKESVQNAI-N 63

Query: 269 GPHQLDGRTI 298
             ++++GR +
Sbjct: 64  SDNEINGRKL 73


>UniRef50_Q4D4H5 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 601

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 1/115 (0%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D  D+ +  LFV GL    +   L ++F  YGE+    VM +  +G+SRG  FV F + +
Sbjct: 230 DPQDEIRSNLFVSGLHASVTDNELYKHFHPYGEIESAKVMLDIHTGKSRGIAFVKFKEVA 289

Query: 245 LVNLVLQNGPHQL-DGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
                 +   + +  G TI  +   P    +P  G    K F+  +P N+ + +L
Sbjct: 290 NAEKAAEEMNNSVFHGETIAVRVAKPHAAYRP--GAPTNKTFVRNIPLNMKKAEL 342


>UniRef50_Q18724 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 114

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 23/84 (27%), Positives = 42/84 (50%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +++  + W T +  L+ YF RYG +    +  + ++G  RGF  +TF      N  ++  
Sbjct: 27  VYLTHVKWVTGKSQLEHYFKRYGSIQSVNMFYDPDTGLHRGFASITFDSKDGANKAIEQR 86

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKR 343
           PH +DG  +D +P  P   +  K+
Sbjct: 87  PHVIDGDRVDVEPYIPLISKNKKK 110


>UniRef50_A7SMA3 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 259

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K ++G LS+   ++ L+  F  Y  V+D  V+ + E+GR RGFGFVTF     ++  +  
Sbjct: 113 KCYIGNLSYSVDEQALEEKFHGYN-VVDVKVITDRETGRPRGFGFVTFGSEDEMDKAID- 170

Query: 269 GPHQLDGRTIDPKPCNPRTLQ-KPKRGGG 352
              + DG  +D +P      Q + +RGGG
Sbjct: 171 ---KFDGEDLDGRPMKVNKAQPRGERGGG 196


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 576,710,105
Number of Sequences: 1657284
Number of extensions: 11935158
Number of successful extensions: 32741
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 29980
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32399
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 40658285374
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -