BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F06 (481 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HQK5 Cluster: Cytochrome c oxidase polypeptide VIIC; ... 75 6e-13 UniRef50_Q1W2C6 Cluster: Putative mitochondrial cytochrome c oxi... 67 2e-10 UniRef50_Q7JW00 Cluster: LD14731p; n=7; Arthropoda|Rep: LD14731p... 58 1e-07 UniRef50_UPI00005189A2 Cluster: PREDICTED: hypothetical protein;... 55 7e-07 UniRef50_P15954 Cluster: Cytochrome c oxidase subunit 7C, mitoch... 47 3e-04 UniRef50_A6EE33 Cluster: Putative uncharacterized protein; n=1; ... 32 7.7 UniRef50_A7RPT2 Cluster: Predicted protein; n=1; Nematostella ve... 32 7.7 >UniRef50_Q1HQK5 Cluster: Cytochrome c oxidase polypeptide VIIC; n=4; Endopterygota|Rep: Cytochrome c oxidase polypeptide VIIC - Aedes aegypti (Yellowfever mosquito) Length = 67 Score = 75.4 bits (177), Expect = 6e-13 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +1 Query: 151 LGRNVVTNFVR-NHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITRH 312 + R +TN VR +HS+GGIPGENLPF + NRYKLT FI++ GSGL AP+ + RH Sbjct: 8 ISRTGMTNLVRYSHSHGGIPGENLPFSLTNRYKLTALFIVFLGSGLGAPFFVLRH 62 >UniRef50_Q1W2C6 Cluster: Putative mitochondrial cytochrome c oxidase polypeptide VIIc; n=1; Graphocephala atropunctata|Rep: Putative mitochondrial cytochrome c oxidase polypeptide VIIc - Graphocephala atropunctata Length = 65 Score = 66.9 bits (156), Expect = 2e-10 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = +1 Query: 157 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITRH 312 RN+ T+ R GGIPG NLPF + N++KLT F++Y GSG+S P+L+ RH Sbjct: 10 RNLSTSLARRSQPGGIPGVNLPFSLDNKFKLTALFVVYFGSGMSVPFLMLRH 61 >UniRef50_Q7JW00 Cluster: LD14731p; n=7; Arthropoda|Rep: LD14731p - Drosophila melanogaster (Fruit fly) Length = 66 Score = 57.6 bits (133), Expect = 1e-07 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = +1 Query: 142 SNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITRH 312 S+ + RN + VR +GG+PGENLPF + N+Y++T F + G +P+LI RH Sbjct: 5 SSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRH 61 >UniRef50_UPI00005189A2 Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 71 Score = 55.2 bits (127), Expect = 7e-07 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +1 Query: 184 NHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITRH 312 +H G PG NLP +I NRY LT FIL+ GSGLS P+L+ R+ Sbjct: 25 DHGPEGYPGANLPINIQNRYVLTATFILFFGSGLSLPFLVLRY 67 >UniRef50_P15954 Cluster: Cytochrome c oxidase subunit 7C, mitochondrial precursor; n=46; Deuterostomia|Rep: Cytochrome c oxidase subunit 7C, mitochondrial precursor - Homo sapiens (Human) Length = 63 Score = 46.8 bits (106), Expect = 3e-04 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +1 Query: 157 RNVVTNFVR-NHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITRH 312 R T+ VR +H G PG+NLPF + N++ L LY GS + P+L+ RH Sbjct: 7 RRFTTSVVRRSHYEEG-PGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRH 58 >UniRef50_A6EE33 Cluster: Putative uncharacterized protein; n=1; Pedobacter sp. BAL39|Rep: Putative uncharacterized protein - Pedobacter sp. BAL39 Length = 204 Score = 31.9 bits (69), Expect = 7.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +1 Query: 142 SNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGL 285 +NKL ++ NF+ N G EN+ IH Y L L F++Y+ + L Sbjct: 101 ANKLASHIFNNFISNWEEDGY--ENIVHGIHYMY-LNLRFVMYSAAQL 145 >UniRef50_A7RPT2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 78 Score = 31.9 bits (69), Expect = 7.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 205 PGENLPFDIHNRYKLTLYFILYAGSGLSAPYLITR 309 PG N+PF N+ +L + + Y G+ + P++ R Sbjct: 35 PGLNMPFQTQNKTRLLIVMVAYLGTCFALPFVAVR 69 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 398,071,417 Number of Sequences: 1657284 Number of extensions: 7315014 Number of successful extensions: 15994 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15988 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27290400475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -