SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A3XPA0 Cluster: Molybdenum cofactor biosynthesis protei...    82   3e-15
UniRef50_Q39055 Cluster: Molybdopterin biosynthesis protein CNX2...    82   3e-15
UniRef50_Q9NZB8 Cluster: Molybdenum cofactor biosynthesis protei...    81   8e-15
UniRef50_Q8IQF1 Cluster: CG33048-PC, isoform C; n=16; cellular o...    81   1e-14
UniRef50_Q17Q71 Cluster: Molybdopterin cofactor synthesis protei...    80   2e-14
UniRef50_Q20624 Cluster: Uncharacterized protein F49E2.1; n=8; c...    79   2e-14
UniRef50_Q93KD1 Cluster: Molybdenum cofactor biosynthesis protei...    79   2e-14
UniRef50_UPI000065DA79 Cluster: Molybdenum cofactor biosynthesis...    79   4e-14
UniRef50_Q1E311 Cluster: Putative uncharacterized protein; n=1; ...    79   4e-14
UniRef50_A1CNJ4 Cluster: Molybdopterin cofactor biosynthetic pro...    77   1e-13
UniRef50_Q747W9 Cluster: Molybdenum cofactor biosynthesis protei...    77   1e-13
UniRef50_UPI00015B631F Cluster: PREDICTED: similar to CG33048-PC...    75   4e-13
UniRef50_Q0CMC0 Cluster: Molybdenum cofactor biosynthesis protei...    75   7e-13
UniRef50_Q6AIW0 Cluster: Probable molybdenum cofactor biosynthes...    72   4e-12
UniRef50_A1ZKS6 Cluster: Molybdenum cofactor biosynthesis protei...    72   4e-12
UniRef50_Q3A0V4 Cluster: Molybdopterin biosynthesis, protein A; ...    71   8e-12
UniRef50_A6GFN1 Cluster: Molybdenum cofactor biosynthesis protei...    71   1e-11
UniRef50_A5UV38 Cluster: Molybdenum cofactor biosynthesis protei...    70   2e-11
UniRef50_A4CL86 Cluster: Molybdenum cofactor biosynthesis protei...    70   2e-11
UniRef50_A6QXR9 Cluster: Molybdenum cofactor biosynthesis protei...    69   3e-11
UniRef50_A6C1Y9 Cluster: Molybdopterin cofactor synthesis protei...    69   4e-11
UniRef50_Q67KB1 Cluster: Molybdenum cofactor biosynthesis protei...    68   8e-11
UniRef50_Q2LXG6 Cluster: Molybdenum cofactor biosynthesis protei...    67   1e-10
UniRef50_Q8Y870 Cluster: Molybdenum cofactor biosynthesis protei...    66   2e-10
UniRef50_Q314Y6 Cluster: Elongator protein 3/MiaB/NifB; n=3; Des...    65   4e-10
UniRef50_Q8GDR9 Cluster: Molybdenum cofactor biosynthesis protei...    63   2e-09
UniRef50_A4M8F9 Cluster: Molybdenum cofactor biosynthesis protei...    63   2e-09
UniRef50_Q55369 Cluster: Molybdenum cofactor biosynthesis protei...    62   3e-09
UniRef50_A1IF08 Cluster: Molybdenum cofactor synthesis-like; n=3...    62   5e-09
UniRef50_Q01SM0 Cluster: Molybdenum cofactor biosynthesis protei...    61   9e-09
UniRef50_A7H8M4 Cluster: Molybdenum cofactor biosynthesis protei...    60   1e-08
UniRef50_Q2IIX4 Cluster: Molybdenum cofactor biosynthesis enzyme...    60   2e-08
UniRef50_Q095T8 Cluster: Radical SAM:Molybdenum cofactor synthes...    60   2e-08
UniRef50_A0UZU8 Cluster: Molybdenum cofactor biosynthesis protei...    60   2e-08
UniRef50_Q7UT69 Cluster: Molybdenum cofactor biosynthesis protei...    60   2e-08
UniRef50_Q9PIW6 Cluster: Molybdenum cofactor biosynthesis protei...    59   3e-08
UniRef50_Q835I4 Cluster: Molybdopterin cofactor biosynthesis pro...    59   4e-08
UniRef50_Q1AX93 Cluster: Molybdenum cofactor biosynthesis protei...    59   4e-08
UniRef50_A6BK62 Cluster: Putative uncharacterized protein; n=1; ...    59   4e-08
UniRef50_Q97HL8 Cluster: Molybdenum cofactor biosynthesis protei...    59   4e-08
UniRef50_Q9WX96 Cluster: Molybdenum cofactor biosynthesis protei...    58   5e-08
UniRef50_P65385 Cluster: Molybdenum cofactor biosynthesis protei...    58   5e-08
UniRef50_Q8NR60 Cluster: Molybdenum cofactor biosynthesis protei...    58   6e-08
UniRef50_Q47V92 Cluster: Molybdenum cofactor biosynthesis protei...    58   8e-08
UniRef50_P62588 Cluster: Molybdenum cofactor biosynthesis protei...    57   1e-07
UniRef50_Q8ZGW5 Cluster: Molybdenum cofactor biosynthesis protei...    57   1e-07
UniRef50_Q7VLN1 Cluster: Molybdenum cofactor biosynthesis protei...    57   1e-07
UniRef50_Q1FKI7 Cluster: Radical SAM:Molybdenum cofactor synthes...    56   3e-07
UniRef50_Q9AC48 Cluster: Molybdenum cofactor biosynthesis protei...    56   3e-07
UniRef50_Q7NV14 Cluster: Molybdenum cofactor biosynthesis protei...    55   4e-07
UniRef50_Q2RUV6 Cluster: Molybdenum cofactor synthesis protein; ...    55   4e-07
UniRef50_Q1NYF4 Cluster: Radical SAM:Molybdenum cofactor synthes...    55   4e-07
UniRef50_A3NB06 Cluster: Molybdenum cofactor biosynthesis protei...    55   4e-07
UniRef50_Q1PWN1 Cluster: Similar to molybdenum cofactor biosynth...    55   6e-07
UniRef50_Q1K2G0 Cluster: Radical SAM; n=1; Desulfuromonas acetox...    54   1e-06
UniRef50_A5WBY5 Cluster: Molybdenum cofactor biosynthesis protei...    54   1e-06
UniRef50_Q4FMK8 Cluster: Molybdenum cofactor biosynthesis protei...    54   1e-06
UniRef50_Q2JXS6 Cluster: Molybdenum cofactor biosynthesis protei...    54   1e-06
UniRef50_A0LVG0 Cluster: Molybdenum cofactor biosynthesis protei...    54   1e-06
UniRef50_Q9I3K7 Cluster: Molybdenum cofactor biosynthesis protei...    54   1e-06
UniRef50_A7DAP0 Cluster: Molybdenum cofactor biosynthesis protei...    52   4e-06
UniRef50_Q6FB29 Cluster: Molybdopterin biosynthesis, protein A; ...    52   5e-06
UniRef50_Q98MK6 Cluster: Molybdenum cofactor biosynthesis protei...    52   5e-06
UniRef50_Q8Y0K4 Cluster: Molybdenum cofactor biosynthesis protei...    51   7e-06
UniRef50_P56414 Cluster: Molybdenum cofactor biosynthesis protei...    51   7e-06
UniRef50_P59038 Cluster: Molybdenum cofactor biosynthesis protei...    51   7e-06
UniRef50_Q6AL74 Cluster: Probable molybdenum cofactor biosynthes...    51   1e-05
UniRef50_Q88LG4 Cluster: Molybdenum cofactor biosynthesis protei...    50   1e-05
UniRef50_Q1III4 Cluster: Molybdenum cofactor synthesis-like; n=1...    50   2e-05
UniRef50_A4BPZ7 Cluster: Molybdopterin biosynthesis, protein A; ...    49   3e-05
UniRef50_Q3ADX8 Cluster: Molybdenum cofactor biosynthesis protei...    48   5e-05
UniRef50_O67929 Cluster: Molybdenum cofactor biosynthesis protei...    48   5e-05
UniRef50_Q6SGI4 Cluster: Molybdenum cofactor biosynthesis protei...    47   1e-04
UniRef50_Q39NF5 Cluster: Molybdenum cofactor synthesis protein; ...    47   2e-04
UniRef50_A4XI56 Cluster: Radical SAM domain protein; n=1; Caldic...    46   2e-04
UniRef50_Q9X5W3 Cluster: Molybdenum cofactor biosynthesis protei...    46   2e-04
UniRef50_A3VUA3 Cluster: Molybdenum cofactor biosynthesis protei...    46   4e-04
UniRef50_UPI00015BD268 Cluster: UPI00015BD268 related cluster; n...    45   5e-04
UniRef50_Q72G60 Cluster: Molybdenum cofactor biosynthesis protei...    45   5e-04
UniRef50_A0L7R4 Cluster: Molybdenum cofactor biosynthesis protei...    45   5e-04
UniRef50_Q8PX29 Cluster: Probable molybdenum cofactor biosynthes...    44   0.001
UniRef50_O28273 Cluster: Probable molybdenum cofactor biosynthes...    44   0.001
UniRef50_Q8YQG6 Cluster: Molybdenum cofactor biosynthesis protei...    43   0.003
UniRef50_Q9K9W9 Cluster: Molybdenum cofactor biosynthesis protei...    42   0.003
UniRef50_O57854 Cluster: Probable molybdenum cofactor biosynthes...    42   0.006
UniRef50_Q9EYN8 Cluster: Molybdenum cofactor biosynthesis protei...    41   0.010
UniRef50_Q8TV60 Cluster: Probable molybdenum cofactor biosynthes...    40   0.024
UniRef50_UPI00015BAF60 Cluster: Radical SAM domain protein; n=1;...    39   0.031
UniRef50_Q11VH2 Cluster: Molybdenum cofactor biosynthesis protei...    39   0.031
UniRef50_O27593 Cluster: Probable molybdenum cofactor biosynthes...    39   0.031
UniRef50_Q58234 Cluster: Probable molybdenum cofactor biosynthes...    39   0.041
UniRef50_A6DTB1 Cluster: Molybdenum cofactor biosynthesis protei...    38   0.072
UniRef50_A4MJC8 Cluster: Radical SAM domain protein; n=2; Geobac...    38   0.096
UniRef50_Q9HST4 Cluster: Probable molybdenum cofactor biosynthes...    38   0.096
UniRef50_Q2FNW9 Cluster: Radical SAM; n=3; Euryarchaeota|Rep: Ra...    37   0.13 
UniRef50_Q979T0 Cluster: Probable molybdenum cofactor biosynthes...    37   0.13 
UniRef50_Q8DT69 Cluster: Putative coenzyme PQQ synthesis protein...    36   0.22 
UniRef50_Q2T4J9 Cluster: Radical SAM domain protein protein; n=1...    36   0.29 
UniRef50_Q0RLM0 Cluster: Putative uncharacterized protein; n=1; ...    36   0.29 
UniRef50_Q9YEV3 Cluster: Probable molybdenum cofactor biosynthes...    36   0.29 
UniRef50_Q97TG5 Cluster: AstB/chuR/nirj-related protein; n=1; Cl...    36   0.39 
UniRef50_A7GI36 Cluster: Radical SAM domain protein; n=1; Clostr...    35   0.51 
UniRef50_Q7XW59 Cluster: OSJNBb0096E05.12 protein; n=3; Oryza sa...    35   0.51 
UniRef50_A1RXS2 Cluster: Putative molybdenum cofactor biosynthes...    35   0.51 
UniRef50_Q9L730 Cluster: SanE; n=1; Streptomyces ansochromogenes...    34   0.89 
UniRef50_Q0YQN7 Cluster: Radical SAM; n=1; Chlorobium ferrooxida...    34   0.89 
UniRef50_Q4J8T0 Cluster: Probable molybdenum cofactor biosynthes...    34   0.89 
UniRef50_Q130F0 Cluster: Radical SAM; n=1; Rhodopseudomonas palu...    33   1.6  
UniRef50_A4M995 Cluster: Radical SAM domain protein; n=1; Petrot...    33   1.6  
UniRef50_Q2RWC8 Cluster: Radical SAM; n=1; Rhodospirillum rubrum...    33   2.1  
UniRef50_A0UV96 Cluster: Radical SAM; n=1; Clostridium celluloly...    33   2.1  
UniRef50_Q97LA4 Cluster: Fe-S oxidoreductase; n=1; Clostridium a...    33   2.7  
UniRef50_Q9V0T6 Cluster: MoaA-like intein containing molybdenum ...    33   2.7  
UniRef50_O31423 Cluster: Uncharacterized protein ybcP; n=1; Baci...    33   2.7  
UniRef50_UPI00015B4D4A Cluster: PREDICTED: similar to conserved ...    32   3.6  
UniRef50_UPI0000DB7030 Cluster: PREDICTED: similar to CG5639-PA;...    32   3.6  
UniRef50_Q2RX62 Cluster: Radical SAM; n=1; Rhodospirillum rubrum...    32   3.6  
UniRef50_Q1PW79 Cluster: Similar to moaA/nifB/ppqE/nirJ protein ...    32   3.6  
UniRef50_Q0YPF9 Cluster: Radical SAM; n=1; Chlorobium ferrooxida...    32   3.6  
UniRef50_A7DFU5 Cluster: Putative uncharacterized protein; n=2; ...    32   3.6  
UniRef50_Q6AM41 Cluster: Related to coenzyme PQQ synthesis prote...    32   4.8  
UniRef50_Q0YL03 Cluster: Radical SAM; n=2; Geobacter|Rep: Radica...    32   4.8  
UniRef50_A4M6K7 Cluster: Radical SAM domain protein precursor; n...    32   4.8  
UniRef50_A4M1J2 Cluster: Radical SAM domain protein; n=1; Geobac...    32   4.8  
UniRef50_A0UUQ4 Cluster: Radical SAM; n=1; Clostridium celluloly...    32   4.8  
UniRef50_Q2JB13 Cluster: Metal-dependent hydrolase; n=1; Frankia...    31   6.3  
UniRef50_A0B8B2 Cluster: Radical SAM domain protein; n=1; Methan...    31   6.3  
UniRef50_Q89FG1 Cluster: Coenzyme PQQ synthesis protein E; n=23;...    31   6.3  
UniRef50_Q64N00 Cluster: Putative Fe-S oxidoreductase; n=1; Bact...    31   8.3  
UniRef50_Q1K2I5 Cluster: Radical SAM; n=4; Bacteria|Rep: Radical...    31   8.3  
UniRef50_A7FR66 Cluster: Radical SAM domain protein; n=2; Clostr...    31   8.3  
UniRef50_A6LGQ5 Cluster: Putative Fe-S oxidoreductase; n=1; Para...    31   8.3  
UniRef50_A0RR85 Cluster: Radical SAM domain protein; n=1; Campyl...    31   8.3  
UniRef50_A0DI99 Cluster: Chromosome undetermined scaffold_51, wh...    31   8.3  

>UniRef50_A3XPA0 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=4; Bacteroidetes|Rep: Molybdenum cofactor
           biosynthesis protein A - Leeuwenhoekiella blandensis
           MED217
          Length = 335

 Score = 82.2 bits (194), Expect = 3e-15
 Identities = 36/71 (50%), Positives = 43/71 (60%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           A L+D HGR+HNYLRISL+E+CNLRC YCMP +G+P                       G
Sbjct: 6   AILTDTHGRKHNYLRISLSEKCNLRCTYCMPHDGIPLSPRANLMSAEEIEAFAKVFVENG 65

Query: 363 VDKLRXTGGEP 395
           VDK+R TGGEP
Sbjct: 66  VDKIRLTGGEP 76


>UniRef50_Q39055 Cluster: Molybdopterin biosynthesis protein CNX2;
           n=55; cellular organisms|Rep: Molybdopterin biosynthesis
           protein CNX2 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 390

 Score = 82.2 bits (194), Expect = 3e-15
 Identities = 38/70 (54%), Positives = 44/70 (62%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR H YLRISLTERCNLRC+YCMP+EGV                + G   +AGV+
Sbjct: 66  LIDKFGRLHTYLRISLTERCNLRCQYCMPSEGVELTPKPQLLSQSEIVRLAGLFVSAGVN 125

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 126 KIRLTGGEPT 135


>UniRef50_Q9NZB8 Cluster: Molybdenum cofactor biosynthesis protein 1
           B; n=36; Deuterostomia|Rep: Molybdenum cofactor
           biosynthesis protein 1 B - Homo sapiens (Human)
          Length = 636

 Score = 81.0 bits (191), Expect = 8e-15
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       
Sbjct: 58  SAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKE 117

Query: 360 GVDKLRXTGGEP 395
           G+DK+R TGGEP
Sbjct: 118 GIDKIRLTGGEP 129


>UniRef50_Q8IQF1 Cluster: CG33048-PC, isoform C; n=16; cellular
           organisms|Rep: CG33048-PC, isoform C - Drosophila
           melanogaster (Fruit fly)
          Length = 565

 Score = 80.6 bits (190), Expect = 1e-14
 Identities = 38/70 (54%), Positives = 41/70 (58%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR H YLRISLTERCNLRC YCMPAEGVP               +       GV 
Sbjct: 61  LTDSFGRHHTYLRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVEQGVR 120

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 121 KIRLTGGEPT 130


>UniRef50_Q17Q71 Cluster: Molybdopterin cofactor synthesis protein
           a; n=1; Aedes aegypti|Rep: Molybdopterin cofactor
           synthesis protein a - Aedes aegypti (Yellowfever
           mosquito)
          Length = 481

 Score = 79.8 bits (188), Expect = 2e-14
 Identities = 39/75 (52%), Positives = 44/75 (58%)
 Frame = +3

Query: 174 EAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALA 353
           E  + L+D  GR H+YLRISLTERCNLRCKYCMPAEGV                +     
Sbjct: 101 ETDSPLTDNFGRFHSYLRISLTERCNLRCKYCMPAEGVQLTPKDNLLTTDEVLRLATLFV 160

Query: 354 AAGVDKLRXTGGEPT 398
             GV K+R TGGEPT
Sbjct: 161 EQGVRKIRLTGGEPT 175


>UniRef50_Q20624 Cluster: Uncharacterized protein F49E2.1; n=8;
           cellular organisms|Rep: Uncharacterized protein F49E2.1
           - Caenorhabditis elegans
          Length = 600

 Score = 79.4 bits (187), Expect = 2e-14
 Identities = 37/68 (54%), Positives = 41/68 (60%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D+  R H YLRISLTE+CN RC YCMPAEGVP               +    AA GVDK+
Sbjct: 67  DMFMREHTYLRISLTEKCNFRCLYCMPAEGVPLKPKDKMLSNSEVLRLVKLFAAHGVDKV 126

Query: 375 RXTGGEPT 398
           R TGGEPT
Sbjct: 127 RLTGGEPT 134


>UniRef50_Q93KD1 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=5; Clostridiales|Rep: Molybdenum cofactor
           biosynthesis protein A - Eubacterium acidaminophilum
          Length = 325

 Score = 79.4 bits (187), Expect = 2e-14
 Identities = 36/69 (52%), Positives = 43/69 (62%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D +GRR NYLRIS+T+RCNLRC YCMP EG+P               +  AL   G+D
Sbjct: 7   LLDGYGRRINYLRISVTDRCNLRCMYCMPQEGIPKRAHHDIMTLEELQEVAVALVELGID 66

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 67  KIRITGGEP 75


>UniRef50_UPI000065DA79 Cluster: Molybdenum cofactor biosynthesis
           protein 1 A (MOCS1A).; n=1; Takifugu rubripes|Rep:
           Molybdenum cofactor biosynthesis protein 1 A (MOCS1A). -
           Takifugu rubripes
          Length = 550

 Score = 78.6 bits (185), Expect = 4e-14
 Identities = 36/72 (50%), Positives = 44/72 (61%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GRRHNYLRISLTE+CNLRC+YCMP +GV                +       
Sbjct: 3   SAFLTDKFGRRHNYLRISLTEKCNLRCQYCMPEDGVKLTPRGQLLSTSEVLKLARLFVHE 62

Query: 360 GVDKLRXTGGEP 395
           GV+K+R TGGEP
Sbjct: 63  GVEKIRLTGGEP 74


>UniRef50_Q1E311 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 733

 Score = 78.6 bits (185), Expect = 4e-14
 Identities = 36/73 (49%), Positives = 44/73 (60%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D   R+H+YLRIS+TERCNLRC YCMP EGVP               +     + 
Sbjct: 79  SAFLTDTFNRQHDYLRISITERCNLRCLYCMPEEGVPLSPPAHLLTTPEIVYLSTLFVSQ 138

Query: 360 GVDKLRXTGGEPT 398
           GV K+R TGGEPT
Sbjct: 139 GVTKIRLTGGEPT 151


>UniRef50_A1CNJ4 Cluster: Molybdopterin cofactor biosynthetic
           protein; n=15; Fungi/Metazoa group|Rep: Molybdopterin
           cofactor biosynthetic protein - Aspergillus clavatus
          Length = 698

 Score = 77.4 bits (182), Expect = 1e-13
 Identities = 34/70 (48%), Positives = 42/70 (60%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D   R+H+YLRIS+TERCNLRC YCMP EG+P               +     + GV 
Sbjct: 81  LTDTFNRQHDYLRISVTERCNLRCLYCMPEEGIPLSAPARLLTSPEIVYLSSLFVSQGVT 140

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 141 KIRLTGGEPT 150


>UniRef50_Q747W9 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=15; Desulfuromonadales|Rep: Molybdenum cofactor
           biosynthesis protein A - Geobacter sulfurreducens
          Length = 326

 Score = 77.0 bits (181), Expect = 1e-13
 Identities = 36/69 (52%), Positives = 42/69 (60%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GRR NYLR+S+T+RCNLRC YCMPAEGV                I  A  A G++
Sbjct: 3   LIDSFGRRINYLRLSVTDRCNLRCSYCMPAEGVEKLAHGDILSYEDLFRIARAAVAIGIE 62

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 63  KIRITGGEP 71


>UniRef50_UPI00015B631F Cluster: PREDICTED: similar to CG33048-PC;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG33048-PC - Nasonia vitripennis
          Length = 572

 Score = 75.4 bits (177), Expect = 4e-13
 Identities = 37/73 (50%), Positives = 41/73 (56%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           ++ L D  GR H YLRISLTERCNLRC YCMPA GV                I       
Sbjct: 41  SSMLVDTFGRYHTYLRISLTERCNLRCTYCMPANGVELSKKEDILKTDEIIKIAELFINE 100

Query: 360 GVDKLRXTGGEPT 398
           GV+K+R TGGEPT
Sbjct: 101 GVNKIRLTGGEPT 113


>UniRef50_Q0CMC0 Cluster: Molybdenum cofactor biosynthesis protein 1
           B; n=2; Aspergillus|Rep: Molybdenum cofactor
           biosynthesis protein 1 B - Aspergillus terreus (strain
           NIH 2624)
          Length = 621

 Score = 74.5 bits (175), Expect = 7e-13
 Identities = 34/70 (48%), Positives = 41/70 (58%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D   R+H+YLRIS+TERCNLRC YCMP EGV                +     + GV 
Sbjct: 92  LTDTFNRQHDYLRISVTERCNLRCVYCMPEEGVELSPPARLLTSPEIVYLSSLFVSQGVT 151

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 152 KIRLTGGEPT 161


>UniRef50_Q6AIW0 Cluster: Probable molybdenum cofactor biosynthesis
           protein; n=1; Desulfotalea psychrophila|Rep: Probable
           molybdenum cofactor biosynthesis protein - Desulfotalea
           psychrophila
          Length = 336

 Score = 72.1 bits (169), Expect = 4e-12
 Identities = 33/71 (46%), Positives = 40/71 (56%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           + L D HGR   YLR+S+T+RCNLRC+YCMP EGV                I       G
Sbjct: 12  SKLVDTHGRSITYLRLSITDRCNLRCRYCMPEEGVQFLDHSEILSYQELLRISRIFVGFG 71

Query: 363 VDKLRXTGGEP 395
           V+K+R TGGEP
Sbjct: 72  VNKIRITGGEP 82


>UniRef50_A1ZKS6 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Microscilla marina ATCC 23134|Rep: Molybdenum
           cofactor biosynthesis protein A - Microscilla marina
           ATCC 23134
          Length = 334

 Score = 72.1 bits (169), Expect = 4e-12
 Identities = 32/75 (42%), Positives = 45/75 (60%)
 Frame = +3

Query: 171 VEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGAL 350
           ++  + + D HGR  NYLR+++T+RCNLRC YCMP EG+                +   L
Sbjct: 1   MQLPSQIIDNHGRPINYLRLAVTDRCNLRCFYCMPEEGIKYLPKKHLLSYEEMERLVRLL 60

Query: 351 AAAGVDKLRXTGGEP 395
           A+ GV+K+R TGGEP
Sbjct: 61  ASMGVNKIRLTGGEP 75


>UniRef50_Q3A0V4 Cluster: Molybdopterin biosynthesis, protein A;
           n=1; Pelobacter carbinolicus DSM 2380|Rep: Molybdopterin
           biosynthesis, protein A - Pelobacter carbinolicus
           (strain DSM 2380 / Gra Bd 1)
          Length = 333

 Score = 70.9 bits (166), Expect = 8e-12
 Identities = 32/70 (45%), Positives = 40/70 (57%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           +L D +GR   YLR+S+T+RCNLRC+YCMPAEGV                +       GV
Sbjct: 7   TLQDNYGRTVEYLRLSVTDRCNLRCRYCMPAEGVDTVSHTDVLSYEEMLRVVAVAVRCGV 66

Query: 366 DKLRXTGGEP 395
            K+R TGGEP
Sbjct: 67  KKVRITGGEP 76


>UniRef50_A6GFN1 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Plesiocystis pacifica SIR-1|Rep: Molybdenum
           cofactor biosynthesis protein A - Plesiocystis pacifica
           SIR-1
          Length = 369

 Score = 70.5 bits (165), Expect = 1e-11
 Identities = 33/72 (45%), Positives = 42/72 (58%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           A LSD   RR  YLR+SLT+RC++RC YCMP EG+                +  A A  G
Sbjct: 30  ADLSDRQQRRVRYLRMSLTDRCSMRCTYCMPPEGIEHVARSEVLSLEEVALVAEAFARWG 89

Query: 363 VDKLRXTGGEPT 398
           V+++R TGGEPT
Sbjct: 90  VERVRLTGGEPT 101


>UniRef50_A5UV38 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=5; Chloroflexi (class)|Rep: Molybdenum cofactor
           biosynthesis protein A - Roseiflexus sp. RS-1
          Length = 356

 Score = 69.7 bits (163), Expect = 2e-11
 Identities = 34/72 (47%), Positives = 41/72 (56%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           A   D +GRR +YLRISLT+RCN+RC YCMP  G+                +  A A AG
Sbjct: 30  APAHDSYGRRIDYLRISLTDRCNMRCVYCMPEIGMKFMPRPELLTTGELLLVVRAAARAG 89

Query: 363 VDKLRXTGGEPT 398
             K+R TGGEPT
Sbjct: 90  FRKIRLTGGEPT 101


>UniRef50_A4CL86 Cluster: Molybdenum cofactor biosynthesis protein;
           n=2; Flavobacteriales|Rep: Molybdenum cofactor
           biosynthesis protein - Robiginitalea biformata HTCC2501
          Length = 327

 Score = 69.7 bits (163), Expect = 2e-11
 Identities = 31/69 (44%), Positives = 39/69 (56%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D H R  NY+R+++T+RCNLRC YCMP  G+                +   LA  GVD
Sbjct: 2   LIDNHNRVINYVRLAVTDRCNLRCNYCMPEHGIDFARKSDLMTVEEMKRLCSILAGLGVD 61

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 62  KIRITGGEP 70


>UniRef50_A6QXR9 Cluster: Molybdenum cofactor biosynthesis protein 1
           A; n=1; Ajellomyces capsulatus NAm1|Rep: Molybdenum
           cofactor biosynthesis protein 1 A - Ajellomyces
           capsulatus NAm1
          Length = 747

 Score = 69.3 bits (162), Expect = 3e-11
 Identities = 33/76 (43%), Positives = 42/76 (55%)
 Frame = +3

Query: 171 VEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGAL 350
           V  A +++     +H+YLRIS+TERCNLRC YCMP EGV                +    
Sbjct: 40  VAFALAIAVTTSMQHDYLRISVTERCNLRCLYCMPEEGVELSPAVKILTTPEIIYLSSLF 99

Query: 351 AAAGVDKLRXTGGEPT 398
            + GV K+R TGGEPT
Sbjct: 100 VSQGVTKIRLTGGEPT 115


>UniRef50_A6C1Y9 Cluster: Molybdopterin cofactor synthesis protein
           A; n=1; Planctomyces maris DSM 8797|Rep: Molybdopterin
           cofactor synthesis protein A - Planctomyces maris DSM
           8797
          Length = 333

 Score = 68.5 bits (160), Expect = 4e-11
 Identities = 33/75 (44%), Positives = 40/75 (53%)
 Frame = +3

Query: 171 VEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGAL 350
           +E    L D  GR HN LRIS+T+RCN+RC YCMP+E V                    +
Sbjct: 1   MEKLTQLIDTFGRVHNNLRISVTDRCNIRCFYCMPSEDVQFVHRSKIMSFEEIVRFIRLV 60

Query: 351 AAAGVDKLRXTGGEP 395
              GVDK+R TGGEP
Sbjct: 61  VPLGVDKIRLTGGEP 75


>UniRef50_Q67KB1 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Symbiobacterium thermophilum|Rep: Molybdenum
           cofactor biosynthesis protein A - Symbiobacterium
           thermophilum
          Length = 329

 Score = 67.7 bits (158), Expect = 8e-11
 Identities = 30/67 (44%), Positives = 38/67 (56%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D  GR+ NY+RIS+T+RCNLRC YCMP  GV                +  A    G+D++
Sbjct: 3   DQWGRKVNYMRISVTDRCNLRCVYCMPLTGVKLGPHDEYLRYEEILRVVKAAVGLGIDRI 62

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 63  RVTGGEP 69


>UniRef50_Q2LXG6 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=3; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Syntrophus aciditrophicus (strain SB)
          Length = 345

 Score = 67.3 bits (157), Expect = 1e-10
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAA-AG 362
           ++ D  GR+ NYLRIS+T+RCNLRC+YCMP EG+                    LAA  G
Sbjct: 19  TMKDSFGRQINYLRISVTDRCNLRCRYCMPEEGIESKLGHEGVLSLEAFARVVRLAAQVG 78

Query: 363 VDKLRXTGGEP 395
           + K+R TGGEP
Sbjct: 79  IRKVRLTGGEP 89


>UniRef50_Q8Y870 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=14; Bacilli|Rep: Molybdenum cofactor biosynthesis
           protein A - Listeria monocytogenes
          Length = 333

 Score = 66.5 bits (155), Expect = 2e-10
 Identities = 30/69 (43%), Positives = 38/69 (55%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR H+Y+RIS+T+RCNLRC YCMP EG+                    +   G+ 
Sbjct: 4   LKDKFGRVHDYIRISVTDRCNLRCVYCMPEEGLTFLPHEKVLSKDEIVSFMELMVKFGIK 63

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 64  KVRITGGEP 72


>UniRef50_Q314Y6 Cluster: Elongator protein 3/MiaB/NifB; n=3;
           Desulfovibrio|Rep: Elongator protein 3/MiaB/NifB -
           Desulfovibrio desulfuricans (strain G20)
          Length = 353

 Score = 65.3 bits (152), Expect = 4e-10
 Identities = 30/73 (41%), Positives = 41/73 (56%)
 Frame = +3

Query: 177 AAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAA 356
           AA   SD +GR+ +YLR+S+T+RCNLRC YC   +G+                +  A   
Sbjct: 20  AAERFSDEYGRQVSYLRLSVTDRCNLRCMYCWTCDGLSFIPHDSILKYEEMLQLVDAAVG 79

Query: 357 AGVDKLRXTGGEP 395
            GV+K+R TGGEP
Sbjct: 80  MGVEKVRLTGGEP 92


>UniRef50_Q8GDR9 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=7; Clostridia|Rep: Molybdenum cofactor biosynthesis
           protein A - Heliobacillus mobilis
          Length = 327

 Score = 63.3 bits (147), Expect = 2e-09
 Identities = 28/67 (41%), Positives = 38/67 (56%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D   R  +YLR+S+T+RCNLRC YCMP +G+P               +    AA G+ ++
Sbjct: 3   DPFARDIHYLRVSVTDRCNLRCVYCMPEQGIPLVDHEEVLRFEEFEQLIRIAAAEGIRRV 62

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 63  RVTGGEP 69


>UniRef50_A4M8F9 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Petrotoga mobilis SJ95
          Length = 323

 Score = 62.9 bits (146), Expect = 2e-09
 Identities = 29/67 (43%), Positives = 37/67 (55%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D +GR  +YLR+S+T+RCNLRC YCMP +GV                I       G+ K+
Sbjct: 3   DKYGRSIDYLRVSITDRCNLRCIYCMPPQGVTFKTHSSILRYEEIIKIVEVGTELGIKKV 62

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 63  RITGGEP 69


>UniRef50_Q55369 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Chroococcales|Rep: Molybdenum cofactor
           biosynthesis protein A - Synechocystis sp. (strain PCC
           6803)
          Length = 327

 Score = 62.5 bits (145), Expect = 3e-09
 Identities = 30/70 (42%), Positives = 41/70 (58%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           +L D +GRR   LR+SLT++CNLRC YCMP + +                I G L A G+
Sbjct: 17  TLVDSYGRRIRKLRVSLTDQCNLRCHYCMPVDAI-FLEQSSYLSCQEYGEIIGELIALGL 75

Query: 366 DKLRXTGGEP 395
           +++R TGGEP
Sbjct: 76  EEVRLTGGEP 85


>UniRef50_A1IF08 Cluster: Molybdenum cofactor synthesis-like; n=3;
           Deltaproteobacteria|Rep: Molybdenum cofactor
           synthesis-like - Candidatus Desulfococcus oleovorans
           Hxd3
          Length = 330

 Score = 61.7 bits (143), Expect = 5e-09
 Identities = 30/69 (43%), Positives = 36/69 (52%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D HGRR  YLR+S+T+RCNL C YC P+                   I  A A  G+ 
Sbjct: 6   LIDTHGRRITYLRVSVTDRCNLNCIYCNPSRYAKKLAHSDILTYEELLSIIEAGAGLGIT 65

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 66  KVRITGGEP 74


>UniRef50_Q01SM0 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Solibacter usitatus Ellin6076|Rep: Molybdenum
           cofactor biosynthesis protein A - Solibacter usitatus
           (strain Ellin6076)
          Length = 331

 Score = 60.9 bits (141), Expect = 9e-09
 Identities = 31/72 (43%), Positives = 36/72 (50%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           A  L D   R H+ LRIS+T+RCN+RC YCMP  GV                     A  
Sbjct: 3   ATPLVDSFHRVHDNLRISVTDRCNIRCFYCMPETGVTFVERREILDFEEIERFVRVAAGL 62

Query: 360 GVDKLRXTGGEP 395
           G+ KLR TGGEP
Sbjct: 63  GIRKLRVTGGEP 74


>UniRef50_A7H8M4 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=3; Anaeromyxobacter|Rep: Molybdenum cofactor
           biosynthesis protein A - Anaeromyxobacter sp. Fw109-5
          Length = 351

 Score = 60.5 bits (140), Expect = 1e-08
 Identities = 31/71 (43%), Positives = 38/71 (53%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           +L D  GR  +YLR+SLT+RCN RC YC PA   P               +    AA GV
Sbjct: 31  ALVDAQGRNISYLRVSLTDRCNFRCTYCSPAAHEPPDALLSRAELARLFRL---FAALGV 87

Query: 366 DKLRXTGGEPT 398
            ++R TGGEPT
Sbjct: 88  RRVRLTGGEPT 98


>UniRef50_Q2IIX4 Cluster: Molybdenum cofactor biosynthesis enzyme;
           n=2; Myxococcaceae|Rep: Molybdenum cofactor biosynthesis
           enzyme - Anaeromyxobacter dehalogenans (strain 2CP-C)
          Length = 334

 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 33/74 (44%), Positives = 38/74 (51%)
 Frame = +3

Query: 177 AAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAA 356
           A A L D  GRR  YLR+SLT+RCN RC YC PA                   I G L  
Sbjct: 9   AVAPLVDGQGRRIVYLRLSLTDRCNFRCSYCSPAAPETHEDPLARDEVARLVRIFGGL-- 66

Query: 357 AGVDKLRXTGGEPT 398
            G+ ++R TGGEPT
Sbjct: 67  -GIRRVRLTGGEPT 79


>UniRef50_Q095T8 Cluster: Radical SAM:Molybdenum cofactor synthesis
           C-terminal; n=1; Stigmatella aurantiaca DW4/3-1|Rep:
           Radical SAM:Molybdenum cofactor synthesis C-terminal -
           Stigmatella aurantiaca DW4/3-1
          Length = 362

 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 33/85 (38%), Positives = 40/85 (47%)
 Frame = +3

Query: 141 PDRLYSDDSRVEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXX 320
           P  L    SR   A  L D  GRR  YLR+S+T+RCN RC YC PA              
Sbjct: 3   PAMLPLASSRDPLAPPLLDAQGRRMTYLRLSVTDRCNFRCTYCSPAS---WGGKKDLLSA 59

Query: 321 XXXXXIXGALAAAGVDKLRXTGGEP 395
                I    A+ G+ ++R TGGEP
Sbjct: 60  LEFERIVSVFASMGIQRVRLTGGEP 84


>UniRef50_A0UZU8 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Clostridium cellulolyticum H10|Rep: Molybdenum
           cofactor biosynthesis protein A - Clostridium
           cellulolyticum H10
          Length = 328

 Score = 60.1 bits (139), Expect = 2e-08
 Identities = 28/69 (40%), Positives = 39/69 (56%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D +GR+ +YLRIS+T+RCNLRC YC+P  GV                     ++ G+ 
Sbjct: 4   LIDKYGRKIDYLRISVTDRCNLRCIYCIPQFGVLQTREEDMLSIKEIVSFVKVASSHGIK 63

Query: 369 KLRXTGGEP 395
           K++ TGGEP
Sbjct: 64  KIKITGGEP 72


>UniRef50_Q7UT69 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Planctomycetaceae|Rep: Molybdenum cofactor
           biosynthesis protein A - Rhodopirellula baltica
          Length = 359

 Score = 59.7 bits (138), Expect = 2e-08
 Identities = 30/71 (42%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALA-AAG 362
           +L D  GRRH+ LRIS+T+RCN+RC YCMP                    + G L    G
Sbjct: 29  ALVDRFGRRHDSLRISITDRCNIRCFYCMPEHDAEFLPRSGVLTFEEIERLAGLLVKRCG 88

Query: 363 VDKLRXTGGEP 395
           V  +R TGGEP
Sbjct: 89  VRDIRITGGEP 99


>UniRef50_Q9PIW6 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=15; Campylobacterales|Rep: Molybdenum cofactor
           biosynthesis protein A - Campylobacter jejuni
          Length = 320

 Score = 59.3 bits (137), Expect = 3e-08
 Identities = 29/69 (42%), Positives = 35/69 (50%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR+ NYLRIS+T+RCN RC YCMP                       A    G++
Sbjct: 2   LIDQFGRKINYLRISVTQRCNFRCLYCMPKIPFDYQPKENLLSFEELFLFVKAAIDEGIE 61

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 62  KIRITGGEP 70


>UniRef50_Q835I4 Cluster: Molybdopterin cofactor biosynthesis
           protein A, putative; n=1; Enterococcus faecalis|Rep:
           Molybdopterin cofactor biosynthesis protein A, putative
           - Enterococcus faecalis (Streptococcus faecalis)
          Length = 324

 Score = 58.8 bits (136), Expect = 4e-08
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           S+ D   R  +Y+R+SLT+RC+LRC YCMPA G+                +   LA   +
Sbjct: 3   SMKDAFNREIDYVRLSLTDRCDLRCTYCMPATGLCFLKKEQLLTDDEIIFLLRILAKEDI 62

Query: 366 DKLRXTGGEP 395
            K++ TGGEP
Sbjct: 63  KKVKLTGGEP 72


>UniRef50_Q1AX93 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Rubrobacter xylanophilus DSM 9941|Rep:
           Molybdenum cofactor biosynthesis protein A - Rubrobacter
           xylanophilus (strain DSM 9941 / NBRC 16129)
          Length = 328

 Score = 58.8 bits (136), Expect = 4e-08
 Identities = 30/69 (43%), Positives = 38/69 (55%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D + R+ +YLRIS+T+RCN RC+YCMP E +                   A  A GV 
Sbjct: 4   LIDSYRRKIDYLRISVTDRCNFRCQYCMP-EDIKFQDKSHILTLEEMLTFAEACLALGVT 62

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 63  KVRVTGGEP 71


>UniRef50_A6BK62 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 321

 Score = 58.8 bits (136), Expect = 4e-08
 Identities = 27/67 (40%), Positives = 38/67 (56%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D  GR  +Y+RIS+T+RCNLRC+YCMP +G+                +    A  G+ K+
Sbjct: 3   DAAGRVIDYMRISITDRCNLRCRYCMP-DGITQVSMAEILTYEEIRKVCILAAELGIQKI 61

Query: 375 RXTGGEP 395
           + TGGEP
Sbjct: 62  KITGGEP 68


>UniRef50_Q97HL8 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=8; Clostridia|Rep: Molybdenum cofactor biosynthesis
           protein A - Clostridium acetobutylicum
          Length = 318

 Score = 58.8 bits (136), Expect = 4e-08
 Identities = 29/67 (43%), Positives = 38/67 (56%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D HGR  +YLRIS+T+RCNLRC YCMP +                  +  A  + G++K+
Sbjct: 3   DKHGRNIDYLRISVTDRCNLRCIYCMP-KMKGYIQENNKISCSDIFKLLRAAVSVGINKV 61

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 62  RYTGGEP 68


>UniRef50_Q9WX96 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=3; Clostridium perfringens|Rep: Molybdenum cofactor
           biosynthesis protein A - Clostridium perfringens
          Length = 323

 Score = 58.4 bits (135), Expect = 5e-08
 Identities = 27/69 (39%), Positives = 37/69 (53%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D +GR  +YLRISLT++CNLRC YCM  +                  +    A+ G+ 
Sbjct: 1   MKDKYGREIDYLRISLTDKCNLRCAYCMEKDHNDFIHNDKLMTLDEILRVVKECASIGIK 60

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 61  KVRLTGGEP 69


>UniRef50_P65385 Cluster: Molybdenum cofactor biosynthesis protein A
           2; n=42; Actinomycetales|Rep: Molybdenum cofactor
           biosynthesis protein A 2 - Mycobacterium bovis
          Length = 360

 Score = 58.4 bits (135), Expect = 5e-08
 Identities = 33/81 (40%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
 Frame = +3

Query: 156 SDDSRVEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVP-XXXXXXXXXXXXXX 332
           +D   V     L D  GR  N LR+SLT+RCNLRC YCMP  G+                
Sbjct: 19  ADPRVVPTTGPLVDTFGRVANDLRVSLTDRCNLRCSYCMPERGLRWLPGEQLLRPDELAR 78

Query: 333 XIXGALAAAGVDKLRXTGGEP 395
            I  A+   GV  +R TGGEP
Sbjct: 79  LIHIAVTRLGVTSVRFTGGEP 99


>UniRef50_Q8NR60 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=4; Corynebacterium|Rep: Molybdenum cofactor
           biosynthesis protein A - Corynebacterium glutamicum
           (Brevibacterium flavum)
          Length = 377

 Score = 58.0 bits (134), Expect = 6e-08
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVP-XXXXXXXXXXXXXXXIXGALAAAGV 365
           L D  GR    LR+SLT+RCNLRC YCMPAEG+                 I  A+   G+
Sbjct: 42  LVDRFGRIARDLRVSLTDRCNLRCTYCMPAEGLEWLPTEQTLNDAEVLRLIRIAVVKLGI 101

Query: 366 DKLRXTGGEP 395
            ++R TGGEP
Sbjct: 102 RQIRFTGGEP 111


>UniRef50_Q47V92 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=3; Alteromonadales|Rep: Molybdenum cofactor
           biosynthesis protein A - Colwellia psychrerythraea
           (strain 34H / ATCC BAA-681) (Vibriopsychroerythus)
          Length = 323

 Score = 57.6 bits (133), Expect = 8e-08
 Identities = 28/69 (40%), Positives = 37/69 (53%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GRR +YLR+S+T+ CN  C YC+P +G                 I  A A  G +
Sbjct: 2   LTDNFGRRFSYLRLSITDVCNFSCTYCLP-DGYQCDQPRDFLSLCEIKRIAKAFAELGTE 60

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 61  KIRITGGEP 69


>UniRef50_P62588 Cluster: Molybdenum cofactor biosynthesis protein A
           3; n=14; Mycobacterium tuberculosis complex|Rep:
           Molybdenum cofactor biosynthesis protein A 3 -
           Mycobacterium bovis
          Length = 378

 Score = 57.2 bits (132), Expect = 1e-07
 Identities = 28/69 (40%), Positives = 35/69 (50%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D  GR    LR+S+ ++CNLRC+YCMP                    I  A  A GVD
Sbjct: 37  IRDRCGRTMGDLRLSVIDQCNLRCRYCMPEAEYAWLPRADLLSVDEISLIVDAFIAVGVD 96

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 97  KIRLTGGEP 105


>UniRef50_Q8ZGW5 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=54; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Yersinia pestis
          Length = 326

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 27/70 (38%), Positives = 37/70 (52%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D   R+  YLR+S+T+ CN RC YC+P EG                 +  A A  G +
Sbjct: 4   LTDAFARKFYYLRLSITDVCNFRCTYCLP-EGYRPDGVKSFLSLDEINRVSRAFALLGTE 62

Query: 369 KLRXTGGEPT 398
           K+R TGGEP+
Sbjct: 63  KIRLTGGEPS 72


>UniRef50_Q7VLN1 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=79; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Haemophilus ducreyi
          Length = 340

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 27/70 (38%), Positives = 35/70 (50%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D   R++ YLR+S+TE CN RC YC+P    P               +    A  G +
Sbjct: 17  LVDRFQRQYTYLRLSITEVCNFRCNYCLPDGYRPPSHKQRFLNLVEIKRLARTFANLGTE 76

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 77  KIRITGGEPT 86


>UniRef50_Q1FKI7 Cluster: Radical SAM:Molybdenum cofactor
           synthesis-like; n=2; Clostridium|Rep: Radical
           SAM:Molybdenum cofactor synthesis-like - Clostridium
           phytofermentans ISDg
          Length = 332

 Score = 56.0 bits (129), Expect = 3e-07
 Identities = 27/67 (40%), Positives = 38/67 (56%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D + R  +Y+RIS+T+RCNLRC YCMP E V                I  + ++ G+ K+
Sbjct: 3   DQYKRSIDYMRISITDRCNLRCTYCMP-EDVEKLEHESILTYEEILRICKSASSLGIRKI 61

Query: 375 RXTGGEP 395
           + TGGEP
Sbjct: 62  KITGGEP 68


>UniRef50_Q9AC48 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=56; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Caulobacter crescentus (Caulobacter
           vibrioides)
          Length = 349

 Score = 55.6 bits (128), Expect = 3e-07
 Identities = 30/70 (42%), Positives = 36/70 (51%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           SL D  GR   YLR+S+T+RC+LRC YCM AE +                +       GV
Sbjct: 22  SLIDGFGRAVTYLRVSVTDRCDLRCVYCM-AEHMTFLPKAEVLTLEELDRLASTFVGLGV 80

Query: 366 DKLRXTGGEP 395
            KLR TGGEP
Sbjct: 81  RKLRLTGGEP 90


>UniRef50_Q7NV14 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=6; Betaproteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Chromobacterium violaceum
          Length = 324

 Score = 55.2 bits (127), Expect = 4e-07
 Identities = 26/69 (37%), Positives = 35/69 (50%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           LSD  GR  +YLR+S+T+RC+LRC YC+P                    +  A    G  
Sbjct: 2   LSDRFGRAIDYLRLSVTDRCDLRCSYCLPKGFKGFEEPAHWLTFDEIERVAAAFVRLGAR 61

Query: 369 KLRXTGGEP 395
           ++R TGGEP
Sbjct: 62  RIRLTGGEP 70


>UniRef50_Q2RUV6 Cluster: Molybdenum cofactor synthesis protein;
           n=1; Rhodospirillum rubrum ATCC 11170|Rep: Molybdenum
           cofactor synthesis protein - Rhodospirillum rubrum
           (strain ATCC 11170 / NCIB 8255)
          Length = 330

 Score = 55.2 bits (127), Expect = 4e-07
 Identities = 29/69 (42%), Positives = 36/69 (52%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D  GR   YLR+S+T+RC+LRC+YCM    V                I GA    GV 
Sbjct: 1   MRDSFGRLITYLRLSVTDRCDLRCRYCMGPHPV-FIPKRDVLSLEDLGAIAGAFVDLGVR 59

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 60  KIRLTGGEP 68


>UniRef50_Q1NYF4 Cluster: Radical SAM:Molybdenum cofactor
           synthesis-like; n=2; delta proteobacterium MLMS-1|Rep:
           Radical SAM:Molybdenum cofactor synthesis-like - delta
           proteobacterium MLMS-1
          Length = 338

 Score = 55.2 bits (127), Expect = 4e-07
 Identities = 27/69 (39%), Positives = 37/69 (53%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR  NY+R+++T+RCNL C+YC P +G                 +   L A G+ 
Sbjct: 14  LVDNFGRAINYVRLAVTDRCNLNCRYCRP-KGPCEEPRRELLSYEELERLVRLLVAMGIS 72

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 73  KVRLTGGEP 81


>UniRef50_A3NB06 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Burkholderia pseudomallei|Rep: Molybdenum
           cofactor biosynthesis protein A - Burkholderia
           pseudomallei (strain 668)
          Length = 401

 Score = 55.2 bits (127), Expect = 4e-07
 Identities = 28/77 (36%), Positives = 41/77 (53%)
 Frame = +3

Query: 165 SRVEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXG 344
           +RV+ A +L D  GR   Y+R+S+ +RC+ RC YCM A+ +                +  
Sbjct: 29  ARVDGARALVDRFGRAVTYVRLSVADRCDFRCVYCM-AQDMRFLPRSDVLTLDALAALAR 87

Query: 345 ALAAAGVDKLRXTGGEP 395
           A  A GV ++R TGGEP
Sbjct: 88  AFVALGVRRIRLTGGEP 104


>UniRef50_Q1PWN1 Cluster: Similar to molybdenum cofactor
           biosynthesis protein A; n=1; Candidatus Kuenenia
           stuttgartiensis|Rep: Similar to molybdenum cofactor
           biosynthesis protein A - Candidatus Kuenenia
           stuttgartiensis
          Length = 328

 Score = 54.8 bits (126), Expect = 6e-07
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           +++D + R+ N LRIS+TE CNLRC YC P  G+                I  +    G+
Sbjct: 7   AITDSYSRQINRLRISVTELCNLRCTYCRPEAGIALMEHKDILTYEEIIAIIQSALKFGI 66

Query: 366 DKLRXTGGEP 395
              R TGGEP
Sbjct: 67  TSFRLTGGEP 76


>UniRef50_Q1K2G0 Cluster: Radical SAM; n=1; Desulfuromonas
           acetoxidans DSM 684|Rep: Radical SAM - Desulfuromonas
           acetoxidans DSM 684
          Length = 319

 Score = 54.0 bits (124), Expect = 1e-06
 Identities = 27/70 (38%), Positives = 37/70 (52%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           +L D + R  NYLR+S+T++CNLRC+YC P  G                 +       GV
Sbjct: 2   TLIDPYQRTINYLRLSITDQCNLRCRYCQP-HGRAANRTRRLLRDREIMFLAQQAIDLGV 60

Query: 366 DKLRXTGGEP 395
           +K+R TGGEP
Sbjct: 61  EKIRITGGEP 70


>UniRef50_A5WBY5 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=3; Psychrobacter|Rep: Molybdenum cofactor
           biosynthesis protein A - Psychrobacter sp. PRwf-1
          Length = 437

 Score = 54.0 bits (124), Expect = 1e-06
 Identities = 28/72 (38%), Positives = 36/72 (50%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           A L+D   RR  YLR+S+T+ CN RC YC+P  G                 +  A A  G
Sbjct: 114 ALLTDGFSRRLTYLRLSITDFCNFRCGYCLP-NGYQGKRPDNELTLQEIEVLIKAFAQVG 172

Query: 363 VDKLRXTGGEPT 398
             K+R TGGEP+
Sbjct: 173 TKKVRLTGGEPS 184


>UniRef50_Q4FMK8 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Candidatus Pelagibacter ubique|Rep: Molybdenum
           cofactor biosynthesis protein A - Pelagibacter ubique
          Length = 330

 Score = 53.6 bits (123), Expect = 1e-06
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMP-AEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           LSD  GR+  Y+R+S+T+ CN +C YC+P                     +  AL+  GV
Sbjct: 4   LSDTFGRKFPYIRLSITDVCNYKCSYCLPQGYKKTPGDTRSFMSAQEISRLTKALSELGV 63

Query: 366 DKLRXTGGEPT 398
            K+R TGGEPT
Sbjct: 64  CKIRLTGGEPT 74


>UniRef50_Q2JXS6 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Synechococcus sp. JA-3-3Ab|Rep: Molybdenum
           cofactor biosynthesis protein A - Synechococcus sp.
           (strain JA-3-3Ab) (Cyanobacteria bacteriumYellowstone
           A-Prime)
          Length = 312

 Score = 53.6 bits (123), Expect = 1e-06
 Identities = 28/69 (40%), Positives = 36/69 (52%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D   RR   LR+SLT++CNLRC+YCMP                    I G L   G++
Sbjct: 3   LVDQWNRRIRKLRVSLTDQCNLRCRYCMPLH-PEFLDKSSYLTPQQYKEIIGELLDYGIE 61

Query: 369 KLRXTGGEP 395
           ++R TGGEP
Sbjct: 62  EVRITGGEP 70


>UniRef50_A0LVG0 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Acidothermus cellulolyticus (strain ATCC
           43068 / 11B)
          Length = 362

 Score = 53.6 bits (123), Expect = 1e-06
 Identities = 30/73 (41%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAE----GVPXXXXXXXXXXXXXXXIXGALAA 356
           + D  GR    LRIS+T+RCN+RC+YCMP E                      I  A   
Sbjct: 5   IRDSLGRPLRDLRISVTDRCNMRCRYCMPREIFGPNFTFLPRSELLTFEEITRIAAAFIR 64

Query: 357 AGVDKLRXTGGEP 395
           AGV K+R TGGEP
Sbjct: 65  AGVRKIRLTGGEP 77


>UniRef50_Q9I3K7 Cluster: Molybdenum cofactor biosynthesis protein A
           2; n=67; Proteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A 2 - Pseudomonas aeruginosa
          Length = 331

 Score = 53.6 bits (123), Expect = 1e-06
 Identities = 27/69 (39%), Positives = 36/69 (52%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GRR  YLR+S+T+RC+ RC YCM +E +                +  A    GV 
Sbjct: 6   LVDPFGRRITYLRLSVTDRCDFRCTYCM-SEDMQFLPRDQVLSLEELYAVADAFIGLGVR 64

Query: 369 KLRXTGGEP 395
           ++R TGGEP
Sbjct: 65  RIRITGGEP 73


>UniRef50_A7DAP0 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=4; Alphaproteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Methylobacterium extorquens PA1
          Length = 408

 Score = 52.0 bits (119), Expect = 4e-06
 Identities = 29/71 (40%), Positives = 35/71 (49%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           A L D   R   YLRIS+T+RC+ RC YCM +E +                + G     G
Sbjct: 79  APLIDPFQRAITYLRISVTDRCDFRCAYCM-SEDMQFLPKRDLLTLEELDRLCGVFIDRG 137

Query: 363 VDKLRXTGGEP 395
           V KLR TGGEP
Sbjct: 138 VRKLRITGGEP 148


>UniRef50_Q6FB29 Cluster: Molybdopterin biosynthesis, protein A;
           n=2; Acinetobacter|Rep: Molybdopterin biosynthesis,
           protein A - Acinetobacter sp. (strain ADP1)
          Length = 335

 Score = 51.6 bits (118), Expect = 5e-06
 Identities = 27/71 (38%), Positives = 34/71 (47%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           A  SD +GR    LRIS+T+RCN +C YCMP E                      +   G
Sbjct: 4   AIFSDQYGRYKRKLRISVTDRCNFKCMYCMP-EHPEWIKKKDLLDFEALYLFCEFMVQNG 62

Query: 363 VDKLRXTGGEP 395
           + K+R TGGEP
Sbjct: 63  IQKIRITGGEP 73


>UniRef50_Q98MK6 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=6; Proteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Rhizobium loti (Mesorhizobium
           loti)
          Length = 331

 Score = 51.6 bits (118), Expect = 5e-06
 Identities = 26/70 (37%), Positives = 36/70 (51%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           ++ D  GR  +YLR+S+T+RC+ RC YCM AE +                +       GV
Sbjct: 2   NMIDPFGRTISYLRVSVTDRCDFRCTYCM-AEDMAFLPKKDLLSLEELDRLCSVFIEKGV 60

Query: 366 DKLRXTGGEP 395
            +LR TGGEP
Sbjct: 61  RRLRLTGGEP 70


>UniRef50_Q8Y0K4 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=84; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - Ralstonia solanacearum (Pseudomonas
           solanacearum)
          Length = 345

 Score = 51.2 bits (117), Expect = 7e-06
 Identities = 28/73 (38%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAE----GVPXXXXXXXXXXXXXXXIXGALAA 356
           L+D +GRR + LRIS+T+RCN RC YCMP +                      +      
Sbjct: 7   LADTYGRRLHDLRISVTDRCNFRCIYCMPKDVFDKDYRFLQHSELLSFEEIERMVRLFIE 66

Query: 357 AGVDKLRXTGGEP 395
            GV+K+R TGGEP
Sbjct: 67  HGVEKIRLTGGEP 79


>UniRef50_P56414 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=10; Epsilonproteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Helicobacter pylori
           (Campylobacter pylori)
          Length = 321

 Score = 51.2 bits (117), Expect = 7e-06
 Identities = 25/69 (36%), Positives = 34/69 (49%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D   R  +Y+R+S+T++CN RC+YCMPA  +                        GV 
Sbjct: 2   LVDSFNRVIDYIRVSVTKQCNFRCQYCMPATPLNFFDNEELLPLDNVLEFLKIAIDEGVK 61

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 62  KIRITGGEP 70


>UniRef50_P59038 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=9; Chlorobiaceae|Rep: Molybdenum cofactor
           biosynthesis protein A - Chlorobium tepidum
          Length = 330

 Score = 51.2 bits (117), Expect = 7e-06
 Identities = 28/69 (40%), Positives = 36/69 (52%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR  +Y+RI++T  CNLRC YC+  E  P               +   LA  GV 
Sbjct: 11  LTDRFGRTVDYVRIAVTSACNLRCTYCL-KEDAP--TQTQQLDVVETSKLIALLAGMGVR 67

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 68  KIRFTGGEP 76


>UniRef50_Q6AL74 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=1; Desulfotalea psychrophila|Rep: Probable
           molybdenum cofactor biosynthesis protein A -
           Desulfotalea psychrophila
          Length = 408

 Score = 50.8 bits (116), Expect = 1e-05
 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 8/77 (10%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAE--------GVPXXXXXXXXXXXXXXXIXG 344
           L D + R  +YLRISLT+RCNLRC YCMP +        GV                +  
Sbjct: 71  LVDKYDRNISYLRISLTDRCNLRCIYCMPEDEDGRHTTTGV-ILQHADLLTYEEILRVSR 129

Query: 345 ALAAAGVDKLRXTGGEP 395
              A G+ K+R TGGEP
Sbjct: 130 LATAMGIRKIRLTGGEP 146


>UniRef50_Q88LG4 Cluster: Molybdenum cofactor biosynthesis protein
           A, putative; n=10; Pseudomonadaceae|Rep: Molybdenum
           cofactor biosynthesis protein A, putative - Pseudomonas
           putida (strain KT2440)
          Length = 337

 Score = 50.4 bits (115), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 32/67 (47%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D  GRR   LR+SLT  CN  C YC+P                    +   + AAG+++L
Sbjct: 19  DRQGRRFRNLRVSLTAACNYACTYCVPDGKRLVAAQDELSADALARGVAYLIEAAGIERL 78

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 79  RITGGEP 85


>UniRef50_Q1III4 Cluster: Molybdenum cofactor synthesis-like; n=1;
           Acidobacteria bacterium Ellin345|Rep: Molybdenum
           cofactor synthesis-like - Acidobacteria bacterium
           (strain Ellin345)
          Length = 338

 Score = 50.0 bits (114), Expect = 2e-05
 Identities = 26/70 (37%), Positives = 34/70 (48%)
 Frame = +3

Query: 186 SLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           +L+D  GR  N LR+S+T+RCN RC YC      P               I     + G+
Sbjct: 11  TLTDKFGRTINDLRLSITDRCNYRCVYCRSGNNGP---SFAELRFQDYVRIARVFVSLGI 67

Query: 366 DKLRXTGGEP 395
            K+R TGGEP
Sbjct: 68  TKIRLTGGEP 77


>UniRef50_A4BPZ7 Cluster: Molybdopterin biosynthesis, protein A;
           n=1; Nitrococcus mobilis Nb-231|Rep: Molybdopterin
           biosynthesis, protein A - Nitrococcus mobilis Nb-231
          Length = 349

 Score = 49.2 bits (112), Expect = 3e-05
 Identities = 26/69 (37%), Positives = 32/69 (46%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR    LR+SLT+RCN RC YCMP +                      ++  GV 
Sbjct: 27  LVDRFGRSKRKLRLSLTDRCNFRCGYCMPEDPEWTPRHELLSFEELLGIAQLFVSRMGVT 86

Query: 369 KLRXTGGEP 395
            +R TGGEP
Sbjct: 87  NIRLTGGEP 95


>UniRef50_Q3ADX8 Cluster: Molybdenum cofactor biosynthesis protein
           MoaA; n=1; Carboxydothermus hydrogenoformans Z-2901|Rep:
           Molybdenum cofactor biosynthesis protein MoaA -
           Carboxydothermus hydrogenoformans (strain Z-2901 / DSM
           6008)
          Length = 321

 Score = 48.4 bits (110), Expect = 5e-05
 Identities = 25/67 (37%), Positives = 31/67 (46%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D   R  NYLRIS+T++CNL C YC P                    +  A    G+ K+
Sbjct: 3   DSFNREINYLRISVTDKCNLNCFYCKPG-NFQEFSPGDILTFEEILEVVRAFLPLGLKKV 61

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 62  RITGGEP 68


>UniRef50_O67929 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Aquifex aeolicus|Rep: Molybdenum cofactor
           biosynthesis protein A - Aquifex aeolicus
          Length = 320

 Score = 48.4 bits (110), Expect = 5e-05
 Identities = 28/70 (40%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCM-PAEGVPXXXXXXXXXXXXXXXIXGALAAAGV 365
           L D   R    LRISLT+RCNLRC +CM P +                       A  GV
Sbjct: 2   LLDKLSRPLKVLRISLTDRCNLRCNFCMPPGKEYNFLPKRQLLTPEEIEEYVKIFAKLGV 61

Query: 366 DKLRXTGGEP 395
           +K+R TGGEP
Sbjct: 62  EKVRLTGGEP 71


>UniRef50_Q6SGI4 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=4; Bacteria|Rep: Molybdenum cofactor biosynthesis
           protein A - uncultured bacterium 560
          Length = 331

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 29/67 (43%)
 Frame = +3

Query: 195 DLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKL 374
           D   R   YLR+S+T+ CN RC YC   +                  I    A  GV K+
Sbjct: 6   DPFNRHITYLRVSVTDHCNYRCHYCRDEDHQTHTTRSEVLSFEEIVKIVRLFAELGVTKV 65

Query: 375 RXTGGEP 395
           R TGGEP
Sbjct: 66  RLTGGEP 72


>UniRef50_Q39NF5 Cluster: Molybdenum cofactor synthesis protein;
           n=10; Proteobacteria|Rep: Molybdenum cofactor synthesis
           protein - Burkholderia sp. (strain 383) (Burkholderia
           cepacia (strain ATCC 17760/ NCIB 9086 / R18194))
          Length = 374

 Score = 46.8 bits (106), Expect = 2e-04
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 4/72 (5%)
 Frame = +3

Query: 192 SDLHGRRHNYLRISLTERCNLRCKYCMPAEG----VPXXXXXXXXXXXXXXXIXGALAAA 359
           +D  GR    LR+S+ ++CN RC YCMP E                      I  A  + 
Sbjct: 34  TDTLGRPLRDLRLSVIDQCNFRCGYCMPRESFGADYAFMPSSERLSFAQLEKIARAFTSL 93

Query: 360 GVDKLRXTGGEP 395
           GV+K+R TGGEP
Sbjct: 94  GVEKIRITGGEP 105


>UniRef50_A4XI56 Cluster: Radical SAM domain protein; n=1;
           Caldicellulosiruptor saccharolyticus DSM 8903|Rep:
           Radical SAM domain protein - Caldicellulosiruptor
           saccharolyticus (strain ATCC 43494 / DSM 8903)
          Length = 308

 Score = 46.4 bits (105), Expect = 2e-04
 Identities = 24/63 (38%), Positives = 29/63 (46%)
 Frame = +3

Query: 207 RRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTG 386
           R+  YLR+S+T+RCN  CKYC   E                  I       G+ KLR TG
Sbjct: 7   RKIEYLRLSVTDRCNFFCKYCRTKEA--CEIENKDLSKDEIFRIISVFKKLGIKKLRFTG 64

Query: 387 GEP 395
           GEP
Sbjct: 65  GEP 67


>UniRef50_Q9X5W3 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=22; Alphaproteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Rhodobacter capsulatus
           (Rhodopseudomonas capsulata)
          Length = 328

 Score = 46.4 bits (105), Expect = 2e-04
 Identities = 30/69 (43%), Positives = 34/69 (49%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR   YLR+S+T+RC+LRC YCM  E V                    L   GV 
Sbjct: 6   LCDGFGRDVRYLRVSVTDRCDLRCSYCM-KEDVTFLPRNQVLSLE-------ELDRLGVR 57

Query: 369 KLRXTGGEP 395
           KLR TGGEP
Sbjct: 58  KLRVTGGEP 66


>UniRef50_A3VUA3 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Parvularcula bermudensis HTCC2503|Rep:
           Molybdenum cofactor biosynthesis protein A -
           Parvularcula bermudensis HTCC2503
          Length = 119

 Score = 45.6 bits (103), Expect = 4e-04
 Identities = 18/32 (56%), Positives = 26/32 (81%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTERCNLRCKYCMPA 278
           A L+D +GR   YLR+S+T+RC+LRC+YC+ A
Sbjct: 10  APLTDGYGRDITYLRLSVTDRCDLRCQYCLAA 41


>UniRef50_UPI00015BD268 Cluster: UPI00015BD268 related cluster; n=1;
           unknown|Rep: UPI00015BD268 UniRef100 entry - unknown
          Length = 327

 Score = 45.2 bits (102), Expect = 5e-04
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +3

Query: 219 YLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           YLRIS+T++CN++C YC P   +                I   +   G+ K+R TGGEP
Sbjct: 14  YLRISITDKCNMKCSYCRPI-NIDYISHKDMLSYEEIRDIVFVMKDFGLKKVRITGGEP 71


>UniRef50_Q72G60 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Thermus thermophilus|Rep: Molybdenum cofactor
           biosynthesis protein A - Thermus thermophilus (strain
           HB27 / ATCC BAA-163 / DSM 7039)
          Length = 341

 Score = 45.2 bits (102), Expect = 5e-04
 Identities = 26/69 (37%), Positives = 32/69 (46%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D +GR    LRIS+T RCNL C YC P  G+                   A +  G+ 
Sbjct: 19  LLDNYGRVIKDLRISVTPRCNLHCLYCHPL-GLEMREPPGTLTVEEVDRFLEAASLLGLS 77

Query: 369 KLRXTGGEP 395
            +R TGGEP
Sbjct: 78  SVRFTGGEP 86


>UniRef50_A0L7R4 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=2; Proteobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Magnetococcus sp. (strain MC-1)
          Length = 326

 Score = 45.2 bits (102), Expect = 5e-04
 Identities = 23/69 (33%), Positives = 32/69 (46%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D   R  +YLR+S++E+CN+RC YC   E                  +    A  G+ 
Sbjct: 3   LVDRFNRTISYLRVSVSEQCNMRCNYCRVPE-QESQLREQWLSFAELSRLLARFAQLGIG 61

Query: 369 KLRXTGGEP 395
           + R TGGEP
Sbjct: 62  RFRLTGGEP 70


>UniRef50_Q8PX29 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=7; Methanomicrobia|Rep: Probable molybdenum
           cofactor biosynthesis protein A - Methanosarcina mazei
           (Methanosarcina frisia)
          Length = 334

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 27/71 (38%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYC--MPAEGVPXXXXXXXXXXXXXXXIXGALAAAG 362
           L D +GR+   LRIS+T+RCNL C YC    AE                  I    A  G
Sbjct: 21  LVDPYGRKVTGLRISITDRCNLSCMYCHNEGAECCTCGPVGNEMSPELICSIIREAAKFG 80

Query: 363 VDKLRXTGGEP 395
           V K++ +GGEP
Sbjct: 81  VRKVKFSGGEP 91


>UniRef50_O28273 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=1; Archaeoglobus fulgidus|Rep: Probable
           molybdenum cofactor biosynthesis protein A -
           Archaeoglobus fulgidus
          Length = 296

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 28/69 (40%), Positives = 34/69 (49%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D +GR    LRI++T++CNLRC YC   EG                 I  A    GV 
Sbjct: 2   LKDEYGRVVTNLRIAVTKKCNLRCFYC-HKEG--ESNPGEEISAERIVEIARAFKELGVR 58

Query: 369 KLRXTGGEP 395
           KL+ TGGEP
Sbjct: 59  KLKITGGEP 67


>UniRef50_Q8YQG6 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=11; Cyanobacteria|Rep: Molybdenum cofactor
           biosynthesis protein A - Anabaena sp. (strain PCC 7120)
          Length = 328

 Score = 42.7 bits (96), Expect = 0.003
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
 Frame = +3

Query: 216 NYLRISLTERCNLRCKYCMP--AEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGG 389
           +YLRISL +RCN RC+YCMP  +E                  +       G  + R TGG
Sbjct: 5   DYLRISLIDRCNFRCQYCMPEGSELNYILKQQLLTDEELLTLVQEVFIPVGFRQFRLTGG 64

Query: 390 EP 395
           EP
Sbjct: 65  EP 66


>UniRef50_Q9K9W9 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=41; Bacillales|Rep: Molybdenum cofactor
           biosynthesis protein A - Bacillus halodurans
          Length = 338

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 5/74 (6%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAE----GVPXXXXXXXXXXXXXXXIXGAL-A 353
           ++D   R    LRIS+T+RCN RC YCMPA+      P               +      
Sbjct: 6   MTDRLNRPFRDLRISVTDRCNFRCHYCMPADIFGPDYPFLKKTEILSFEETNRLVHLFHQ 65

Query: 354 AAGVDKLRXTGGEP 395
            + + K+R TGGEP
Sbjct: 66  TSPIKKIRITGGEP 79


>UniRef50_O57854 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=5; Thermococcaceae|Rep: Probable molybdenum
           cofactor biosynthesis protein A - Pyrococcus horikoshii
          Length = 310

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 27/70 (38%), Positives = 32/70 (45%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR    LRISLT+ CNL C YC   EG                 I    +  G+ 
Sbjct: 2   LIDRFGRPVTNLRISLTKECNLSCFYC-HREG--QLDGERFMTPEEIERIVRVASRLGIK 58

Query: 369 KLRXTGGEPT 398
           K++ TGGEPT
Sbjct: 59  KVKLTGGEPT 68


>UniRef50_Q9EYN8 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=10; Synechococcus|Rep: Molybdenum cofactor
           biosynthesis protein A - Synechococcus sp. (strain
           WH7803)
          Length = 347

 Score = 40.7 bits (91), Expect = 0.010
 Identities = 25/64 (39%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +3

Query: 207 RRHNYLRISLTERCNLRCKYCMP-AEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXT 383
           R    LR+SLT RCNL C YC P +E +P               +       GV  LR T
Sbjct: 13  RPFGVLRLSLTARCNLACPYCCPDSEELP-----GLMRLDQQVRLVRVACGLGVHTLRLT 67

Query: 384 GGEP 395
           GGEP
Sbjct: 68  GGEP 71


>UniRef50_Q8TV60 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=1; Methanopyrus kandleri|Rep: Probable
           molybdenum cofactor biosynthesis protein A -
           Methanopyrus kandleri
          Length = 307

 Score = 39.5 bits (88), Expect = 0.024
 Identities = 25/69 (36%), Positives = 32/69 (46%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D  GR    +RIS+T RCN+ C YC   EG                 +  A A  GV 
Sbjct: 1   MRDALGREVRSVRISVTMRCNMACVYC-HREG--ERPGRSELSAAEWGRLLRACAEIGVR 57

Query: 369 KLRXTGGEP 395
           K++ TGGEP
Sbjct: 58  KVKITGGEP 66


>UniRef50_UPI00015BAF60 Cluster: Radical SAM domain protein; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: Radical SAM domain
           protein - Ignicoccus hospitalis KIN4/I
          Length = 352

 Score = 39.1 bits (87), Expect = 0.031
 Identities = 23/69 (33%), Positives = 33/69 (47%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D +GR    LR+S+TERCN  C +C  +EG                 I  A +  G+ 
Sbjct: 2   IRDAYGRSLATLRVSVTERCNFNCIFC-HSEGA-GRGSFDELSVNDYDMIAEATSRLGLK 59

Query: 369 KLRXTGGEP 395
            ++ TGGEP
Sbjct: 60  YVKFTGGEP 68


>UniRef50_Q11VH2 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Cytophaga hutchinsonii ATCC 33406|Rep:
           Molybdenum cofactor biosynthesis protein A - Cytophaga
           hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 317

 Score = 39.1 bits (87), Expect = 0.031
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGAL-AAAGV 365
           + D  GR+   LR+SLT  CN+ C YC+    +                I   + +  G+
Sbjct: 7   IQDSSGRQFKTLRVSLTAVCNMACVYCVTPGAIHTPSAEKVLTVEEYLSIIKNIHSQVGL 66

Query: 366 DKLRXTGGEP 395
             +R TGGEP
Sbjct: 67  KTIRLTGGEP 76


>UniRef50_O27593 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=5; Methanobacteriaceae|Rep: Probable
           molybdenum cofactor biosynthesis protein A -
           Methanobacterium thermoautotrophicum
          Length = 305

 Score = 39.1 bits (87), Expect = 0.031
 Identities = 23/69 (33%), Positives = 33/69 (47%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D HGR    LR+S+T RCN+ C YC   +G+                +    +  GV 
Sbjct: 3   VQDRHGRPVMSLRLSITGRCNVNCIYC-HRDGM--TSSRGELSAADIEKLCRVASDLGVG 59

Query: 369 KLRXTGGEP 395
           K+R +GGEP
Sbjct: 60  KIRLSGGEP 68


>UniRef50_Q58234 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=6; Methanococcales|Rep: Probable molybdenum
           cofactor biosynthesis protein A - Methanococcus
           jannaschii
          Length = 298

 Score = 38.7 bits (86), Expect = 0.041
 Identities = 24/69 (34%), Positives = 31/69 (44%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D  GR    LRIS+T +CNL+C YC   EG                 I       GV 
Sbjct: 1   MKDKFGREIRSLRISITNKCNLQCFYC-HREG-HDSNNDRYMTPEEIGIIAKTSTKFGVK 58

Query: 369 KLRXTGGEP 395
           K++ +GGEP
Sbjct: 59  KIKISGGEP 67


>UniRef50_A6DTB1 Cluster: Molybdenum cofactor biosynthesis protein
           A; n=1; Lentisphaera araneosa HTCC2155|Rep: Molybdenum
           cofactor biosynthesis protein A - Lentisphaera araneosa
           HTCC2155
          Length = 335

 Score = 37.9 bits (84), Expect = 0.072
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 1/59 (1%)
 Frame = +3

Query: 222 LRISLTERCNLRCKYCMPAE-GVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           LR+S+ + CN RC YCMP +                   +       GV ++R TGGEP
Sbjct: 14  LRLSVIDACNFRCLYCMPPDRDYDFFKKNEMLSVNEAIRLSEIFVQLGVRRIRLTGGEP 72


>UniRef50_A4MJC8 Cluster: Radical SAM domain protein; n=2;
           Geobacter|Rep: Radical SAM domain protein - Geobacter
           bemidjiensis Bem
          Length = 471

 Score = 37.5 bits (83), Expect = 0.096
 Identities = 19/57 (33%), Positives = 28/57 (49%)
 Frame = +3

Query: 228 ISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEPT 398
           + +T+RCNL+C +C    G                 +  A+AAAG   L+ +GGEPT
Sbjct: 96  LEVTDRCNLQCAFCFADAG--PKGTEDPSLERISWLLERAMAAAGACSLQLSGGEPT 150


>UniRef50_Q9HST4 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=6; Halobacteriaceae|Rep: Probable
           molybdenum cofactor biosynthesis protein A -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 357

 Score = 37.5 bits (83), Expect = 0.096
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 5/74 (6%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGV-----PXXXXXXXXXXXXXXXIXGALA 353
           L D  GR  + +R+SLT+RCN  C YC   EG+     P                     
Sbjct: 2   LEDDFGRDVSGVRVSLTDRCNFDCVYC-HNEGLGDTRGPIDPRENELSTDRVVRFLSVAH 60

Query: 354 AAGVDKLRXTGGEP 395
             GVD ++ TGGEP
Sbjct: 61  EFGVDAVKLTGGEP 74


>UniRef50_Q2FNW9 Cluster: Radical SAM; n=3; Euryarchaeota|Rep:
           Radical SAM - Methanospirillum hungatei (strain JF-1 /
           DSM 864)
          Length = 292

 Score = 37.1 bits (82), Expect = 0.13
 Identities = 22/69 (31%), Positives = 30/69 (43%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D +GR  + LRIS+   CNLRC YC                      + G +   G+ 
Sbjct: 3   LHDSYGRPISNLRISVNSGCNLRCVYCHREGETKPETPLSLEDIRAILDVAGNI---GIR 59

Query: 369 KLRXTGGEP 395
            ++ TGGEP
Sbjct: 60  TVKFTGGEP 68


>UniRef50_Q979T0 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=4; Thermoplasmatales|Rep: Probable
           molybdenum cofactor biosynthesis protein A -
           Thermoplasma volcanium
          Length = 326

 Score = 37.1 bits (82), Expect = 0.13
 Identities = 24/70 (34%), Positives = 31/70 (44%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+DL+GR    LRI L   CN  C +C   EG                 +       GV+
Sbjct: 3   LTDLYGRPVLSLRIQLNTTCNFNCFFC-HMEGT--EISGEALKPEEIERVVKIAHKFGVN 59

Query: 369 KLRXTGGEPT 398
           K++ TGGEPT
Sbjct: 60  KIKLTGGEPT 69


>UniRef50_Q8DT69 Cluster: Putative coenzyme PQQ synthesis protein;
           n=1; Streptococcus mutans|Rep: Putative coenzyme PQQ
           synthesis protein - Streptococcus mutans
          Length = 371

 Score = 36.3 bits (80), Expect = 0.22
 Identities = 20/56 (35%), Positives = 24/56 (42%)
 Frame = +3

Query: 228 ISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           + +T RCNL C YC  AE  P               I   L   GV ++  TGGEP
Sbjct: 13  VCVTNRCNLSCSYC-SAEAGPFASKKGEMSVEKLDSIFRELNLMGVPRVGVTGGEP 67


>UniRef50_Q2T4J9 Cluster: Radical SAM domain protein protein; n=1;
           Burkholderia thailandensis E264|Rep: Radical SAM domain
           protein protein - Burkholderia thailandensis (strain
           E264 / ATCC 700388 / DSM 13276 /CIP 106301)
          Length = 516

 Score = 35.9 bits (79), Expect = 0.29
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +3

Query: 219 YLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGE 392
           ++R+ LT+RCNL C +C  A+  P               +    A AG +++  TGGE
Sbjct: 183 FMRLHLTQRCNLTCVHCY-ADSSPYVTSEGEISVDRWSRLIDEFADAGGERVLFTGGE 239


>UniRef50_Q0RLM0 Cluster: Putative uncharacterized protein; n=1;
           Frankia alni ACN14a|Rep: Putative uncharacterized
           protein - Frankia alni (strain ACN14a)
          Length = 284

 Score = 35.9 bits (79), Expect = 0.29
 Identities = 24/63 (38%), Positives = 30/63 (47%)
 Frame = +3

Query: 210 RHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGG 389
           R + L + LT RC L C +C  AE  P               I  A AA+GV +L+  GG
Sbjct: 9   RTDLLWLVLTGRCQLACGHCY-AESGPTGTHGTMTNADWQRVIDDA-AASGVRRLKFIGG 66

Query: 390 EPT 398
           EPT
Sbjct: 67  EPT 69


>UniRef50_Q9YEV3 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=2; Aeropyrum pernix|Rep: Probable
           molybdenum cofactor biosynthesis protein A - Aeropyrum
           pernix
          Length = 355

 Score = 35.9 bits (79), Expect = 0.29
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 5/74 (6%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYC----MPAEGVPXXXXXXXXXXXXXXXIXG-ALA 353
           ++D +GR    LRI++T  CNL C +C        G                 I G A +
Sbjct: 2   VADAYGRPLKDLRIAVTPECNLDCFFCHMEGATESGPMRPGSWSPVLSVEDYDIIGEAAS 61

Query: 354 AAGVDKLRXTGGEP 395
             GVD  + TGGEP
Sbjct: 62  RLGVDSFKLTGGEP 75


>UniRef50_Q97TG5 Cluster: AstB/chuR/nirj-related protein; n=1;
           Clostridium acetobutylicum|Rep: AstB/chuR/nirj-related
           protein - Clostridium acetobutylicum
          Length = 390

 Score = 35.5 bits (78), Expect = 0.39
 Identities = 22/57 (38%), Positives = 30/57 (52%)
 Frame = +3

Query: 99  DLXTIKSCFRAITVPDRLYSDDSRVEAAASLSDLHGRRHNYLRISLTERCNLRCKYC 269
           DL T+K   R I+VP +   ++ R   A  L D+ G       I +T  CNLRCK+C
Sbjct: 13  DLNTLKRTIRNISVPLKERKNNPRY--ATKLPDIVG-------IKITNNCNLRCKHC 60


>UniRef50_A7GI36 Cluster: Radical SAM domain protein; n=1;
           Clostridium botulinum F str. Langeland|Rep: Radical SAM
           domain protein - Clostridium botulinum (strain Langeland
           / NCTC 10281 / Type F)
          Length = 468

 Score = 35.1 bits (77), Expect = 0.51
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 5/80 (6%)
 Frame = +3

Query: 48  MKIRTNNFSSLYRIFECDLXTIKSCFRAITVPDRLYSDDSRVEAAA-SLSD----LHGRR 212
           +K+    +S+L   +  DL  +K     + + ++ Y   +R E    SL+D    +    
Sbjct: 27  LKVPKETYSALEN-YNGDLEALKDDSVILNLKEKGYLSSNRAEEIEHSLTDALESILDNS 85

Query: 213 HNYLRISLTERCNLRCKYCM 272
            N L + +T+ CNLRC YC+
Sbjct: 86  LNTLTLQITQECNLRCSYCV 105


>UniRef50_Q7XW59 Cluster: OSJNBb0096E05.12 protein; n=3; Oryza
           sativa|Rep: OSJNBb0096E05.12 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 148

 Score = 35.1 bits (77), Expect = 0.51
 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 3/37 (8%)
 Frame = +1

Query: 271 CRRKACP---CPVAARCCQWKSCG*XWARWRPPAWTS 372
           CR + CP   C VAA  C+W S      R  PP WTS
Sbjct: 68  CRHRGCPPPACRVAAAVCRWTSTLTRPPRASPPRWTS 104


>UniRef50_A1RXS2 Cluster: Putative molybdenum cofactor biosynthesis
           protein A; n=1; Thermofilum pendens Hrk 5|Rep: Putative
           molybdenum cofactor biosynthesis protein A - Thermofilum
           pendens (strain Hrk 5)
          Length = 348

 Score = 35.1 bits (77), Expect = 0.51
 Identities = 22/69 (31%), Positives = 29/69 (42%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L D  GR    LRI++T +CN  C +C   EG P               +     + GV 
Sbjct: 10  LVDRFGRPLENLRITVTPQCNFNCVFC-HGEGEP--PNNALLSASEIVEVASVAHSLGVG 66

Query: 369 KLRXTGGEP 395
             + TGGEP
Sbjct: 67  TFKLTGGEP 75


>UniRef50_Q9L730 Cluster: SanE; n=1; Streptomyces
           ansochromogenes|Rep: SanE - Streptomyces ansochromogenes
          Length = 189

 Score = 34.3 bits (75), Expect = 0.89
 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
 Frame = +1

Query: 241 SDATCDASTACRRKACPCPVAARCCQWKSCG*XWARWR-PPAWTSCGSPXG 390
           S ATC AS   R     CP    C     CG   ARW  PP   +CG+  G
Sbjct: 102 SSATCSASAPTRSSGSTCPAGPSCA--ACCG---ARWSGPPRAGNCGTATG 147


>UniRef50_Q0YQN7 Cluster: Radical SAM; n=1; Chlorobium ferrooxidans
           DSM 13031|Rep: Radical SAM - Chlorobium ferrooxidans DSM
           13031
          Length = 400

 Score = 34.3 bits (75), Expect = 0.89
 Identities = 18/62 (29%), Positives = 25/62 (40%)
 Frame = +3

Query: 210 RHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGG 389
           R   + I +TERCNL+C YC   +G                 I   +  +    +R  GG
Sbjct: 17  RRFLVHIIMTERCNLKCAYCYQKKGREGGDLDVERALETLFAIIDGIDPSTDTSIRFFGG 76

Query: 390 EP 395
           EP
Sbjct: 77  EP 78


>UniRef50_Q4J8T0 Cluster: Probable molybdenum cofactor biosynthesis
           protein A; n=4; Sulfolobaceae|Rep: Probable molybdenum
           cofactor biosynthesis protein A - Sulfolobus
           acidocaldarius
          Length = 313

 Score = 34.3 bits (75), Expect = 0.89
 Identities = 22/70 (31%), Positives = 30/70 (42%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           + D++GR    LRI+LT  CN  C +C   EG                   G     G+ 
Sbjct: 1   MKDVYGRELEDLRITLTHACNFTCFFC-HMEGENDGDSLLSADQISLVAQIG--MEFGIR 57

Query: 369 KLRXTGGEPT 398
            ++ TGGEPT
Sbjct: 58  TVKLTGGEPT 67


>UniRef50_Q130F0 Cluster: Radical SAM; n=1; Rhodopseudomonas
           palustris BisB5|Rep: Radical SAM - Rhodopseudomonas
           palustris (strain BisB5)
          Length = 359

 Score = 33.5 bits (73), Expect = 1.6
 Identities = 20/59 (33%), Positives = 24/59 (40%)
 Frame = +3

Query: 219 YLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           Y+   LT RCN  C +C    G P               +   LA AGV  L  +GGEP
Sbjct: 16  YVAWELTHRCNAHCVHCYSNSG-PDADLGDQLSLQSGLSLIDQLADAGVLVLAFSGGEP 73


>UniRef50_A4M995 Cluster: Radical SAM domain protein; n=1; Petrotoga
           mobilis SJ95|Rep: Radical SAM domain protein - Petrotoga
           mobilis SJ95
          Length = 481

 Score = 33.5 bits (73), Expect = 1.6
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +3

Query: 222 LRISLTERCNLRCKYCMPAEGVP 290
           L   +TE+CNLRCKYC+ ++  P
Sbjct: 96  LIFEITEQCNLRCKYCIYSDKYP 118


>UniRef50_Q2RWC8 Cluster: Radical SAM; n=1; Rhodospirillum rubrum
           ATCC 11170|Rep: Radical SAM - Rhodospirillum rubrum
           (strain ATCC 11170 / NCIB 8255)
          Length = 354

 Score = 33.1 bits (72), Expect = 2.1
 Identities = 19/59 (32%), Positives = 26/59 (44%)
 Frame = +3

Query: 222 LRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEPT 398
           L + LT RCNLRC++C    G                 + G   A G + +  +GGEPT
Sbjct: 17  LFLELTTRCNLRCRHCYIRAG---EGEARDLPASDVQGLLGEFQAMGGEFVSFSGGEPT 72


>UniRef50_A0UV96 Cluster: Radical SAM; n=1; Clostridium
           cellulolyticum H10|Rep: Radical SAM - Clostridium
           cellulolyticum H10
          Length = 483

 Score = 33.1 bits (72), Expect = 2.1
 Identities = 10/19 (52%), Positives = 16/19 (84%)
 Frame = +3

Query: 216 NYLRISLTERCNLRCKYCM 272
           N + + +T++CNLRCKYC+
Sbjct: 93  NMITLQITKQCNLRCKYCV 111


>UniRef50_Q97LA4 Cluster: Fe-S oxidoreductase; n=1; Clostridium
           acetobutylicum|Rep: Fe-S oxidoreductase - Clostridium
           acetobutylicum
          Length = 518

 Score = 32.7 bits (71), Expect = 2.7
 Identities = 10/17 (58%), Positives = 15/17 (88%)
 Frame = +3

Query: 222 LRISLTERCNLRCKYCM 272
           + + LTE+CNLRC+YC+
Sbjct: 127 ITLELTEKCNLRCRYCI 143


>UniRef50_Q9V0T6 Cluster: MoaA-like intein containing molybdenum
           cofactor biosynthesis moaA homolog; n=4;
           Thermococcaceae|Rep: MoaA-like intein containing
           molybdenum cofactor biosynthesis moaA homolog -
           Pyrococcus abyssi
          Length = 1042

 Score = 32.7 bits (71), Expect = 2.7
 Identities = 13/25 (52%), Positives = 14/25 (56%)
 Frame = +3

Query: 201 HGRRHNYLRISLTERCNLRCKYCMP 275
           H    + L I LT RCNL C YC P
Sbjct: 134 HRSHTSLLNIVLTNRCNLNCWYCFP 158


>UniRef50_O31423 Cluster: Uncharacterized protein ybcP; n=1;
           Bacillus subtilis|Rep: Uncharacterized protein ybcP -
           Bacillus subtilis
          Length = 410

 Score = 32.7 bits (71), Expect = 2.7
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 4/67 (5%)
 Frame = +3

Query: 204 GRRHNYLRIS----LTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDK 371
           G   +YL IS    LT  CNL C +C  + G P               +   LAA GV  
Sbjct: 99  GSLDSYLPISCTLQLTNACNLSCSFCYASSGKP---YPEELSSEQWILVMQKLAAHGVAD 155

Query: 372 LRXTGGE 392
           +  TGGE
Sbjct: 156 ITLTGGE 162


>UniRef50_UPI00015B4D4A Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 1370

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)
 Frame = +1

Query: 151 CTVMTAVWRRRPH*ATYMVVDTTTCEYLSLSDATCDASTACRRKAC--PC--PVAARCCQ 318
           C  + A    +P    Y+V  +++CE L  +D  C A   C    C   C  PV A  CQ
Sbjct: 687 CPSVPACLAIKPGQCPYLVPSSSSCEVLCSTDQECTAGDKCCSTGCGTQCVSPVMATACQ 746


>UniRef50_UPI0000DB7030 Cluster: PREDICTED: similar to CG5639-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG5639-PA
           - Apis mellifera
          Length = 1322

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%)
 Frame = +1

Query: 151 CTVMTAVWRRRPH*ATYMVVDTTTCEYLSLSDATCDASTACRRKAC--PC--PVAARCCQ 318
           C  + A    +P    Y+V  +++CE    +D  C A+  C    C   C  PV A  CQ
Sbjct: 650 CPAVPACLATKPGQCPYLVPSSSSCELQCSNDQECSATEKCCSTGCGTQCVAPVMATACQ 709


>UniRef50_Q2RX62 Cluster: Radical SAM; n=1; Rhodospirillum rubrum
           ATCC 11170|Rep: Radical SAM - Rhodospirillum rubrum
           (strain ATCC 11170 / NCIB 8255)
          Length = 448

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 13/38 (34%), Positives = 22/38 (57%)
 Frame = +3

Query: 156 SDDSRVEAAASLSDLHGRRHNYLRISLTERCNLRCKYC 269
           +D+  +E A  L+     R  YL ++ T +CN++C YC
Sbjct: 75  ADEYALEKARYLAHRDDPRRLYLTLAPTMQCNMKCSYC 112


>UniRef50_Q1PW79 Cluster: Similar to moaA/nifB/ppqE/nirJ protein
           family for cofactor bionsynthesis; n=1; Candidatus
           Kuenenia stuttgartiensis|Rep: Similar to
           moaA/nifB/ppqE/nirJ protein family for cofactor
           bionsynthesis - Candidatus Kuenenia stuttgartiensis
          Length = 340

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%)
 Frame = +3

Query: 195 DLHGRRHNYL-RISLTERCNLRCKYC 269
           DL+G+    +  I +T RCNLRCK+C
Sbjct: 46  DLYGKPKGAIGAIDITNRCNLRCKHC 71


>UniRef50_Q0YPF9 Cluster: Radical SAM; n=1; Chlorobium ferrooxidans
           DSM 13031|Rep: Radical SAM - Chlorobium ferrooxidans DSM
           13031
          Length = 420

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 20/64 (31%), Positives = 30/64 (46%)
 Frame = +3

Query: 99  DLXTIKSCFRAITVPDRLYSDDSRVEAAASLSDLHGRRHNYLRISLTERCNLRCKYCMPA 278
           D   IK  F ++++P   +  + +      LSD    R N L + +  RCNL C+YC  A
Sbjct: 5   DNSDIKEIFFSVSLPPDSF--EQQYLTCQPLSDAP-LRINSLSLDIAGRCNLACRYCAEA 61

Query: 279 EGVP 290
              P
Sbjct: 62  ATQP 65


>UniRef50_A7DFU5 Cluster: Putative uncharacterized protein; n=2;
           Methylobacterium extorquens PA1|Rep: Putative
           uncharacterized protein - Methylobacterium extorquens
           PA1
          Length = 305

 Score = 32.3 bits (70), Expect = 3.6
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = -1

Query: 279 PPACSTCIAGCIAQ*EIFAGSCVDDHVGRLMRPPPP 172
           PPA +  + GC+AQ E    +     V  L RPPPP
Sbjct: 42  PPAAARRVFGCVAQRESIRFTREGSQVRSLSRPPPP 77


>UniRef50_Q6AM41 Cluster: Related to coenzyme PQQ synthesis protein;
           n=3; Deltaproteobacteria|Rep: Related to coenzyme PQQ
           synthesis protein - Desulfotalea psychrophila
          Length = 354

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +3

Query: 222 LRISLTERCNLRCKYCMPAEGVP 290
           L + L+  C+LRC YC  A GVP
Sbjct: 31  LELELSRICDLRCVYCYAASGVP 53


>UniRef50_Q0YL03 Cluster: Radical SAM; n=2; Geobacter|Rep: Radical
           SAM - Geobacter sp. FRC-32
          Length = 316

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = +3

Query: 213 HNYLRISLTERCNLRCKYCM 272
           HNY+   LT  CNL C YC+
Sbjct: 21  HNYVAFFLTLACNLHCDYCL 40


>UniRef50_A4M6K7 Cluster: Radical SAM domain protein precursor; n=1;
           Petrotoga mobilis SJ95|Rep: Radical SAM domain protein
           precursor - Petrotoga mobilis SJ95
          Length = 468

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 18/60 (30%), Positives = 25/60 (41%)
 Frame = +3

Query: 219 YLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEPT 398
           ++ I LT+ CNL CKYC   E +                +   L    +  +  TGGEPT
Sbjct: 127 HMSIELTDGCNLNCKYCYRREDI---RKSTFIDSEKLKVMVEKLNKETLSMVEITGGEPT 183


>UniRef50_A4M1J2 Cluster: Radical SAM domain protein; n=1; Geobacter
           bemidjiensis Bem|Rep: Radical SAM domain protein -
           Geobacter bemidjiensis Bem
          Length = 316

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = +3

Query: 228 ISLTERCNLRCKYCMPAEG 284
           I +T +CNL+CKYC  A G
Sbjct: 65  IDVTSQCNLKCKYCYHANG 83


>UniRef50_A0UUQ4 Cluster: Radical SAM; n=1; Clostridium
           cellulolyticum H10|Rep: Radical SAM - Clostridium
           cellulolyticum H10
          Length = 565

 Score = 31.9 bits (69), Expect = 4.8
 Identities = 18/55 (32%), Positives = 23/55 (41%)
 Frame = +3

Query: 234 LTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEPT 398
           +T RCNL+C YC                      +   L  AG  ++R TGGEPT
Sbjct: 81  ITRRCNLKCVYCY---NNSRKDFSKELEKEQIFRLIDELYEAGTFEIRLTGGEPT 132


>UniRef50_Q2JB13 Cluster: Metal-dependent hydrolase; n=1; Frankia
           sp. CcI3|Rep: Metal-dependent hydrolase - Frankia sp.
           (strain CcI3)
          Length = 589

 Score = 31.5 bits (68), Expect = 6.3
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 268 ACRRKACPCPVAARCCQWKS-CG*XWARWRPPAWTSCGSPXGSR 396
           AC R+ CP     RC  W S CG   +R    +W S GS   SR
Sbjct: 167 ACCRRCCPRSWRPRCTGWTSTCG---SRSSSASWVSTGSAAPSR 207


>UniRef50_A0B8B2 Cluster: Radical SAM domain protein; n=1;
           Methanosaeta thermophila PT|Rep: Radical SAM domain
           protein - Methanosaeta thermophila (strain DSM 6194 /
           PT) (Methanothrixthermophila (strain DSM 6194 / PT))
          Length = 377

 Score = 31.5 bits (68), Expect = 6.3
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)
 Frame = +3

Query: 138 VPDRLYSDDSRVEAAASLSDLHGRRH-NYLRISLTERCNLRCKYC-MPAEG 284
           VP R +    R +  ASL    GRR  + + IS+TE C  RCK+C +P  G
Sbjct: 72  VPSRAFDRFVRSQVLASL----GRRTPDQITISVTEECPNRCKHCALPDTG 118


>UniRef50_Q89FG1 Cluster: Coenzyme PQQ synthesis protein E; n=23;
           Proteobacteria|Rep: Coenzyme PQQ synthesis protein E -
           Bradyrhizobium japonicum
          Length = 380

 Score = 31.5 bits (68), Expect = 6.3
 Identities = 17/57 (29%), Positives = 25/57 (43%)
 Frame = +3

Query: 228 ISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEPT 398
           + +T RC L+C YC  +  V                +   LA  GV ++  +GGEPT
Sbjct: 20  LEITHRCPLQCPYC--SNPVELDRSGKELTTDEWKKVLSELAEIGVLQVHFSGGEPT 74


>UniRef50_Q64N00 Cluster: Putative Fe-S oxidoreductase; n=1;
           Bacteroides fragilis|Rep: Putative Fe-S oxidoreductase -
           Bacteroides fragilis
          Length = 479

 Score = 31.1 bits (67), Expect = 8.3
 Identities = 10/16 (62%), Positives = 14/16 (87%)
 Frame = +3

Query: 222 LRISLTERCNLRCKYC 269
           L I +T++CNL+CKYC
Sbjct: 84  LLIEVTDKCNLKCKYC 99


>UniRef50_Q1K2I5 Cluster: Radical SAM; n=4; Bacteria|Rep: Radical
           SAM - Desulfuromonas acetoxidans DSM 684
          Length = 441

 Score = 31.1 bits (67), Expect = 8.3
 Identities = 19/68 (27%), Positives = 27/68 (39%), Gaps = 2/68 (2%)
 Frame = +3

Query: 201 HGRRHNYLRISLTERCNLRCKYC-MPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD-KL 374
           H      + + LT+RCNLRC  C M A+                  +   +   G    +
Sbjct: 100 HQHHPRLVELELTQRCNLRCPVCFMAADDNQTHVETDLSLADIKKQLVKIMDQCGPQTSI 159

Query: 375 RXTGGEPT 398
           + TGGEPT
Sbjct: 160 QLTGGEPT 167


>UniRef50_A7FR66 Cluster: Radical SAM domain protein; n=2;
           Clostridium botulinum A|Rep: Radical SAM domain protein
           - Clostridium botulinum (strain ATCC 19397 / Type A)
          Length = 722

 Score = 31.1 bits (67), Expect = 8.3
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 168 RVEAAASLSDLHGRRHNYLRISLTERCNLRCKYC 269
           + +  + +S+  G +   +   +TE CNLRCKYC
Sbjct: 8   KYKLGSGMSNWKGGQSYEVTFIVTEDCNLRCKYC 41


>UniRef50_A6LGQ5 Cluster: Putative Fe-S oxidoreductase; n=1;
           Parabacteroides distasonis ATCC 8503|Rep: Putative Fe-S
           oxidoreductase - Parabacteroides distasonis (strain ATCC
           8503 / DSM 20701 / NCTC11152)
          Length = 478

 Score = 31.1 bits (67), Expect = 8.3
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = +3

Query: 216 NYLRISLTERCNLRCKYC 269
           N L I +T+ CNL CKYC
Sbjct: 81  NQLLIEVTDECNLSCKYC 98


>UniRef50_A0RR85 Cluster: Radical SAM domain protein; n=1;
           Campylobacter fetus subsp. fetus 82-40|Rep: Radical SAM
           domain protein - Campylobacter fetus subsp. fetus
           (strain 82-40)
          Length = 310

 Score = 31.1 bits (67), Expect = 8.3
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +3

Query: 213 HNYLRISLTERCNLRCKYCM 272
           +NY+ + LT  CNL+C YC+
Sbjct: 10  YNYIALFLTLSCNLKCPYCI 29


>UniRef50_A0DI99 Cluster: Chromosome undetermined scaffold_51, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_51,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 2233

 Score = 31.1 bits (67), Expect = 8.3
 Identities = 11/21 (52%), Positives = 11/21 (52%)
 Frame = -1

Query: 309 ASCDWTGARLPPACSTCIAGC 247
           A C W GA  PPAC T    C
Sbjct: 884 AQCQWDGAATPPACKTLTFDC 904


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 385,054,537
Number of Sequences: 1657284
Number of extensions: 7466953
Number of successful extensions: 19415
Number of sequences better than 10.0: 134
Number of HSP's better than 10.0 without gapping: 18574
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19336
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16926675320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -