SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovir...   160   4e-38
UniRef50_O10269 Cluster: Serine/threonine-protein kinase 1; n=14...   110   4e-23
UniRef50_P89912 Cluster: Protein kinase; n=3; Nucleopolyhedrovir...    93   1e-17
UniRef50_Q7TLL9 Cluster: Capsid associated protein; n=1; Chorist...    78   3e-13
UniRef50_Q0N495 Cluster: Protein kinase 1; n=2; unclassified Nuc...    77   5e-13
UniRef50_P41719 Cluster: Serine/threonine-protein kinase 1; n=11...    72   2e-11
UniRef50_Q80LU1 Cluster: Protein kinase; n=1; Adoxophyes honmai ...    71   3e-11
UniRef50_Q0ILB6 Cluster: Pk1; n=1; Leucania separata nuclear pol...    71   5e-11
UniRef50_P41720 Cluster: Serine/threonine-protein kinase 1; n=2;...    71   5e-11
UniRef50_Q77SA4 Cluster: Protein kinase 1; n=1; Ecotropis obliqu...    68   2e-10
UniRef50_Q91F41 Cluster: ORF3 PK-1; n=3; Granulovirus|Rep: ORF3 ...    67   4e-10
UniRef50_Q91GB9 Cluster: ORF1629; n=2; Epiphyas postvittana NPV|...    64   5e-09
UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N...    64   5e-09
UniRef50_O10270 Cluster: 61 kDa protein homolog; n=1; Orgyia pse...    60   6e-08
UniRef50_A0DZ43 Cluster: Chromosome undetermined scaffold_7, who...    58   2e-07
UniRef50_Q6QXC2 Cluster: ORF3; n=7; Granulovirus|Rep: ORF3 - Agr...    58   3e-07
UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle...    58   3e-07
UniRef50_Q54SJ5 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_A0DYF2 Cluster: Chromosome undetermined scaffold_7, who...    56   8e-07
UniRef50_Q23JM1 Cluster: Protein kinase domain containing protei...    56   1e-06
UniRef50_Q172E2 Cluster: Testis-specific serine/threonine kinase...    56   1e-06
UniRef50_A0E202 Cluster: Chromosome undetermined scaffold_74, wh...    55   2e-06
UniRef50_Q229U9 Cluster: Protein kinase domain containing protei...    54   6e-06
UniRef50_A5E4V7 Cluster: Putative uncharacterized protein; n=1; ...    54   6e-06
UniRef50_UPI000150A708 Cluster: Protein kinase domain containing...    53   7e-06
UniRef50_A2FDI8 Cluster: CAMK family protein kinase; n=1; Tricho...    53   7e-06
UniRef50_A0CPP6 Cluster: Chromosome undetermined scaffold_23, wh...    53   7e-06
UniRef50_A0C8T5 Cluster: Chromosome undetermined scaffold_159, w...    53   1e-05
UniRef50_A5IY01 Cluster: Serine/threonine-protein kinase; n=1; M...    52   1e-05
UniRef50_Q5CHL8 Cluster: Putative uncharacterized protein; n=2; ...    52   1e-05
UniRef50_A7TL28 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_UPI00006CF367 Cluster: Protein kinase domain containing...    52   2e-05
UniRef50_UPI000023D36F Cluster: hypothetical protein FG08701.1; ...    52   2e-05
UniRef50_A5X6X5 Cluster: Titin a; n=10; Euteleostomi|Rep: Titin ...    52   2e-05
UniRef50_Q7R0B9 Cluster: GLP_608_36888_34957; n=1; Giardia lambl...    52   2e-05
UniRef50_A5K473 Cluster: Protein kinase domain containing protei...    52   2e-05
UniRef50_A2ETF3 Cluster: CAMK family protein kinase; n=1; Tricho...    52   2e-05
UniRef50_A0E864 Cluster: Chromosome undetermined scaffold_82, wh...    52   2e-05
UniRef50_UPI000049A104 Cluster: protein kinase; n=1; Entamoeba h...    52   2e-05
UniRef50_Q22C11 Cluster: Protein kinase domain containing protei...    52   2e-05
UniRef50_A0DFJ5 Cluster: Chromosome undetermined scaffold_49, wh...    52   2e-05
UniRef50_A0CNU2 Cluster: Chromosome undetermined scaffold_22, wh...    52   2e-05
UniRef50_A7EIW0 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_A0BZI1 Cluster: Chromosome undetermined scaffold_139, w...    51   3e-05
UniRef50_A6LUR9 Cluster: Protein kinase; n=1; Clostridium beijer...    51   4e-05
UniRef50_A0UZ77 Cluster: Serine/threonine protein kinase; n=1; C...    51   4e-05
UniRef50_A2FBN5 Cluster: AGC family protein kinase; n=1; Trichom...    51   4e-05
UniRef50_A2EJX1 Cluster: CAMK family protein kinase; n=1; Tricho...    51   4e-05
UniRef50_A2EIG6 Cluster: CAMK family protein kinase; n=1; Tricho...    51   4e-05
UniRef50_A0DXN2 Cluster: Chromosome undetermined scaffold_69, wh...    51   4e-05
UniRef50_UPI000155C283 Cluster: PREDICTED: similar to calmodulin...    50   5e-05
UniRef50_UPI000150A7D8 Cluster: Protein kinase domain containing...    50   5e-05
UniRef50_Q7RKS7 Cluster: Protein kinase domain, putative; n=1; P...    50   5e-05
UniRef50_A2DBY9 Cluster: CAMK family protein kinase; n=2; Tricho...    50   5e-05
UniRef50_A0BEW1 Cluster: Chromosome undetermined scaffold_103, w...    50   5e-05
UniRef50_P38991 Cluster: Spindle assembly checkpoint kinase; n=5...    50   5e-05
UniRef50_UPI00006CB302 Cluster: Protein kinase domain containing...    50   7e-05
UniRef50_UPI0000D8B5E1 Cluster: Unc-51 like kinase 2 (C. elegans...    50   7e-05
UniRef50_Q7UFG3 Cluster: Probable serine/threonine-protein kinas...    50   7e-05
UniRef50_A7S1C2 Cluster: Predicted protein; n=1; Nematostella ve...    50   7e-05
UniRef50_A2FCK2 Cluster: CAMK family protein kinase; n=1; Tricho...    50   7e-05
UniRef50_A0E004 Cluster: Chromosome undetermined scaffold_70, wh...    50   7e-05
UniRef50_A0CVZ3 Cluster: Chromosome undetermined scaffold_3, who...    50   7e-05
UniRef50_A0BIN8 Cluster: Chromosome undetermined scaffold_11, wh...    50   7e-05
UniRef50_Q4X028 Cluster: Protein kinase, putative; n=6; Trichoco...    50   7e-05
UniRef50_Q8IYT8 Cluster: Serine/threonine-protein kinase ULK2; n...    50   7e-05
UniRef50_UPI0000F1F5BA Cluster: PREDICTED: similar to novel kina...    50   9e-05
UniRef50_Q2SDA3 Cluster: Serine/threonine protein kinase; n=1; H...    50   9e-05
UniRef50_Q21DN0 Cluster: Protein kinase; n=1; Saccharophagus deg...    50   9e-05
UniRef50_A0E4D4 Cluster: Chromosome undetermined scaffold_78, wh...    50   9e-05
UniRef50_A0D2H1 Cluster: Chromosome undetermined scaffold_35, wh...    50   9e-05
UniRef50_A0BR89 Cluster: Chromosome undetermined scaffold_122, w...    50   9e-05
UniRef50_A7TRN0 Cluster: Putative uncharacterized protein; n=1; ...    50   9e-05
UniRef50_UPI00015562C7 Cluster: PREDICTED: similar to MLCK prote...    49   1e-04
UniRef50_Q5EUF6 Cluster: Cyclin-dependent kinase-activating kina...    49   1e-04
UniRef50_Q7R9H7 Cluster: Serine/threonine-protein kinase; n=3; P...    49   1e-04
UniRef50_Q6BFD3 Cluster: Calcium-dependent protein kinase, putat...    49   1e-04
UniRef50_Q552E9 Cluster: Protein serine/threonine kinase; n=4; D...    49   1e-04
UniRef50_Q22CZ0 Cluster: Protein kinase domain containing protei...    49   1e-04
UniRef50_A0EHT5 Cluster: Chromosome undetermined scaffold_98, wh...    49   1e-04
UniRef50_A0DWU2 Cluster: Chromosome undetermined scaffold_67, wh...    49   1e-04
UniRef50_A0DU37 Cluster: Chromosome undetermined scaffold_64, wh...    49   1e-04
UniRef50_A0DN99 Cluster: Chromosome undetermined scaffold_57, wh...    49   1e-04
UniRef50_A0CJ09 Cluster: Chromosome undetermined scaffold_19, wh...    49   1e-04
UniRef50_A5E3E1 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_UPI000155CFAD Cluster: PREDICTED: hypothetical protein;...    49   2e-04
UniRef50_UPI00006CB13C Cluster: Protein kinase domain containing...    49   2e-04
UniRef50_A3DCY1 Cluster: Serine/threonine protein kinase; n=1; C...    49   2e-04
UniRef50_A2G7H1 Cluster: CAMK family protein kinase; n=1; Tricho...    49   2e-04
UniRef50_A2E7E2 Cluster: CAMK family protein kinase; n=1; Tricho...    49   2e-04
UniRef50_A2DM39 Cluster: CAMK family protein kinase; n=1; Tricho...    49   2e-04
UniRef50_A0DMG4 Cluster: Chromosome undetermined scaffold_56, wh...    49   2e-04
UniRef50_Q3ACF7 Cluster: Putative serine/threonine protein kinas...    48   2e-04
UniRef50_Q4QGB0 Cluster: Mitogen-activated protein kinase kinase...    48   2e-04
UniRef50_A2G1W7 Cluster: CAMK family protein kinase; n=1; Tricho...    48   2e-04
UniRef50_A2ENB4 Cluster: CAMK family protein kinase; n=1; Tricho...    48   2e-04
UniRef50_A0DN84 Cluster: Chromosome undetermined scaffold_57, wh...    48   2e-04
UniRef50_A0DGC5 Cluster: Chromosome undetermined scaffold_5, who...    48   2e-04
UniRef50_A0CBG0 Cluster: Chromosome undetermined scaffold_164, w...    48   2e-04
UniRef50_Q6BJ62 Cluster: Similar to CA1375|IPF7158 Candida albic...    48   2e-04
UniRef50_Q5AG71 Cluster: Potential serine/threonine-protein kina...    48   2e-04
UniRef50_Q8YMI4 Cluster: Serine/threonine kinase; n=1; Nostoc sp...    48   3e-04
UniRef50_Q4C0I8 Cluster: Protein kinase; n=1; Crocosphaera watso...    48   3e-04
UniRef50_Q9XTC6 Cluster: MOM-4; n=2; Caenorhabditis|Rep: MOM-4 -...    48   3e-04
UniRef50_Q8IL57 Cluster: Ser/Thr protein kinase, putative; n=1; ...    48   3e-04
UniRef50_A2F460 Cluster: AGC family protein kinase; n=1; Trichom...    48   3e-04
UniRef50_A0D467 Cluster: Chromosome undetermined scaffold_37, wh...    48   3e-04
UniRef50_A0C9K2 Cluster: Chromosome undetermined scaffold_16, wh...    48   3e-04
UniRef50_A0BG89 Cluster: Chromosome undetermined scaffold_105, w...    48   3e-04
UniRef50_A3LUT3 Cluster: Aspartic proteinase; n=3; Saccharomycet...    48   3e-04
UniRef50_O15865 Cluster: Calcium-dependent protein kinase 2; n=2...    48   3e-04
UniRef50_UPI0000499ACB Cluster: protein kinase; n=1; Entamoeba h...    48   4e-04
UniRef50_Q2AG11 Cluster: Protein kinase:PASTA:Serine/threonine p...    48   4e-04
UniRef50_A6DJV1 Cluster: Serine/threonine kinase; n=1; Lentispha...    48   4e-04
UniRef50_A6C619 Cluster: Putative serine/threonine-protein kinas...    48   4e-04
UniRef50_Q16I19 Cluster: Serine/threonine protein kinase lats; n...    48   4e-04
UniRef50_A4HG26 Cluster: Protein kinase, putative; n=3; Leishman...    48   4e-04
UniRef50_A0CXZ8 Cluster: Chromosome undetermined scaffold_30, wh...    48   4e-04
UniRef50_A0CRB4 Cluster: Chromosome undetermined scaffold_25, wh...    48   4e-04
UniRef50_A0CDF8 Cluster: Chromosome undetermined scaffold_17, wh...    48   4e-04
UniRef50_A0BTJ6 Cluster: Chromosome undetermined scaffold_127, w...    48   4e-04
UniRef50_A5DI47 Cluster: Putative uncharacterized protein; n=1; ...    48   4e-04
UniRef50_A3LNN2 Cluster: Predicted protein; n=4; Saccharomycetal...    48   4e-04
UniRef50_UPI0000E80D72 Cluster: PREDICTED: similar to myosin lig...    47   5e-04
UniRef50_UPI0000ECB019 Cluster: UPI0000ECB019 related cluster; n...    47   5e-04
UniRef50_Q4S904 Cluster: Chromosome 7 SCAF14703, whole genome sh...    47   5e-04
UniRef50_Q4RSJ0 Cluster: Chromosome 13 SCAF15000, whole genome s...    47   5e-04
UniRef50_Q5FJH8 Cluster: Serine-threonine protein kinase; n=5; L...    47   5e-04
UniRef50_Q0LGG5 Cluster: Protein kinase; n=1; Herpetosiphon aura...    47   5e-04
UniRef50_A3ZUK3 Cluster: Probable protein kinase yloP-putative s...    47   5e-04
UniRef50_Q5CTY5 Cluster: Calcium/calmodulin dependent protein ki...    47   5e-04
UniRef50_Q235N6 Cluster: Protein kinase domain containing protei...    47   5e-04
UniRef50_Q22N79 Cluster: Protein kinase domain containing protei...    47   5e-04
UniRef50_A3FQM1 Cluster: Putative uncharacterized protein; n=2; ...    47   5e-04
UniRef50_A0C5Z9 Cluster: Chromosome undetermined scaffold_151, w...    47   5e-04
UniRef50_Q2KFW9 Cluster: Putative uncharacterized protein; n=2; ...    47   5e-04
UniRef50_UPI0000E801CD Cluster: PREDICTED: hypothetical protein;...    47   6e-04
UniRef50_UPI00006CC887 Cluster: Protein kinase domain containing...    47   6e-04
UniRef50_UPI00006CA70E Cluster: Protein kinase domain containing...    47   6e-04
UniRef50_UPI00002495CF Cluster: PREDICTED: similar to NUAK famil...    47   6e-04
UniRef50_Q5EUI0 Cluster: Putative uncharacterized protein; n=1; ...    47   6e-04
UniRef50_Q182R7 Cluster: Serine/threonine-protein kinase and pho...    47   6e-04
UniRef50_Q0LH42 Cluster: Protein kinase; n=1; Herpetosiphon aura...    47   6e-04
UniRef50_A0NJT1 Cluster: Ser/Thr protein kinase; n=2; Oenococcus...    47   6e-04
UniRef50_Q86GD6 Cluster: Projectin; n=1; Procambarus clarkii|Rep...    47   6e-04
UniRef50_Q22DW7 Cluster: Protein kinase domain containing protei...    47   6e-04
UniRef50_A2FNQ5 Cluster: AGC family protein kinase; n=1; Trichom...    47   6e-04
UniRef50_A2EXP9 Cluster: STE family protein kinase; n=6; Trichom...    47   6e-04
UniRef50_A0DX23 Cluster: Chromosome undetermined scaffold_68, wh...    47   6e-04
UniRef50_A0BN47 Cluster: Chromosome undetermined scaffold_118, w...    47   6e-04
UniRef50_Q2UCX8 Cluster: Serine/threonine protein kinase Chk2 an...    47   6e-04
UniRef50_P11730 Cluster: Calcium/calmodulin-dependent protein ki...    47   6e-04
UniRef50_Q13555 Cluster: Calcium/calmodulin-dependent protein ki...    47   6e-04
UniRef50_UPI00006CF2DC Cluster: Protein kinase domain containing...    46   9e-04
UniRef50_UPI00006CDA40 Cluster: Protein kinase domain containing...    46   9e-04
UniRef50_Q0AXM0 Cluster: Serine/threonine protein kinase; n=1; S...    46   9e-04
UniRef50_Q038H6 Cluster: Serine/threonine protein kinase with be...    46   9e-04
UniRef50_Q65ZH3 Cluster: Putative uncharacterized protein; n=4; ...    46   9e-04
UniRef50_Q4Q1Y6 Cluster: Protein kinase, putative; n=3; Leishman...    46   9e-04
UniRef50_Q23T79 Cluster: Protein kinase domain containing protei...    46   9e-04
UniRef50_Q19962 Cluster: Putative uncharacterized protein; n=3; ...    46   9e-04
UniRef50_A2EZI0 Cluster: CAMK family protein kinase; n=1; Tricho...    46   9e-04
UniRef50_A2DHM8 Cluster: CAMK family protein kinase; n=1; Tricho...    46   9e-04
UniRef50_A0BRM8 Cluster: Chromosome undetermined scaffold_123, w...    46   9e-04
UniRef50_A0BPA1 Cluster: Chromosome undetermined scaffold_12, wh...    46   9e-04
UniRef50_A0BFB3 Cluster: Chromosome undetermined scaffold_103, w...    46   9e-04
UniRef50_Q2UL03 Cluster: Serine/threonine protein kinase; n=2; P...    46   9e-04
UniRef50_Q96GX5 Cluster: Microtubule-associated serine/threonine...    46   9e-04
UniRef50_Q7RAH3 Cluster: Calcium-dependent protein kinase 1; n=2...    46   9e-04
UniRef50_UPI00006CD328 Cluster: Protein kinase domain containing...    46   0.001
UniRef50_Q4RFA4 Cluster: Chromosome 8 SCAF15119, whole genome sh...    46   0.001
UniRef50_Q8G5T5 Cluster: Putative uncharacterized protein; n=3; ...    46   0.001
UniRef50_Q1EW82 Cluster: Protein kinase:PASTA:Serine/threonine p...    46   0.001
UniRef50_A4J588 Cluster: Protein kinase; n=2; Peptococcaceae|Rep...    46   0.001
UniRef50_Q23ML0 Cluster: Protein kinase domain containing protei...    46   0.001
UniRef50_Q23FR5 Cluster: Protein kinase domain containing protei...    46   0.001
UniRef50_Q22X58 Cluster: Protein kinase domain containing protei...    46   0.001
UniRef50_Q179M6 Cluster: Myosin light chain kinase; n=1; Aedes a...    46   0.001
UniRef50_A5DIL0 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q8WZ42 Cluster: Titin; n=65; Eukaryota|Rep: Titin - Hom...    46   0.001
UniRef50_UPI0000E47761 Cluster: PREDICTED: similar to serine/thr...    46   0.001
UniRef50_UPI00006CF805 Cluster: Protein kinase domain containing...    46   0.001
UniRef50_UPI00004990CF Cluster: protein kinase; n=1; Entamoeba h...    46   0.001
UniRef50_UPI000069E463 Cluster: Microtubule-associated serine/th...    46   0.001
UniRef50_Q8EGX7 Cluster: Protein kinase, putative; n=1; Shewanel...    46   0.001
UniRef50_Q8DGU1 Cluster: Serine/threonine protein kinase; n=1; S...    46   0.001
UniRef50_Q4CAD2 Cluster: Protein kinase; n=1; Crocosphaera watso...    46   0.001
UniRef50_Q8MVX2 Cluster: Putative serine/threonine protein kinas...    46   0.001
UniRef50_Q7QSM7 Cluster: GLP_618_5648_4455; n=1; Giardia lamblia...    46   0.001
UniRef50_Q388G0 Cluster: Protein kinase, putative; n=1; Trypanos...    46   0.001
UniRef50_A3FPQ1 Cluster: Calcium-dependent protein kinase 7; n=2...    46   0.001
UniRef50_A2GE35 Cluster: CAMK family protein kinase; n=1; Tricho...    46   0.001
UniRef50_A2EXT9 Cluster: CAMK family protein kinase; n=1; Tricho...    46   0.001
UniRef50_A2ERA7 Cluster: CAMK family protein kinase; n=1; Tricho...    46   0.001
UniRef50_A2DTF0 Cluster: CAMK family protein kinase; n=1; Tricho...    46   0.001
UniRef50_A0CJD7 Cluster: Chromosome undetermined scaffold_2, who...    46   0.001
UniRef50_A0CC44 Cluster: Chromosome undetermined scaffold_166, w...    46   0.001
UniRef50_A0C060 Cluster: Chromosome undetermined scaffold_14, wh...    46   0.001
UniRef50_Q5UNT4 Cluster: Putative serine/threonine-protein kinas...    46   0.001
UniRef50_O34507 Cluster: Serine/threonine-protein kinase prkC; n...    46   0.001
UniRef50_O60285 Cluster: NUAK family SNF1-like kinase 1; n=16; E...    46   0.001
UniRef50_Q9UQB9 Cluster: Serine/threonine-protein kinase 13; n=8...    46   0.001
UniRef50_UPI00015B60DA Cluster: PREDICTED: similar to calcium/ca...    45   0.002
UniRef50_UPI00006CC8F2 Cluster: Protein kinase domain containing...    45   0.002
UniRef50_UPI00006CB12C Cluster: Protein kinase domain containing...    45   0.002
UniRef50_Q4SXH2 Cluster: Chromosome undetermined SCAF12413, whol...    45   0.002
UniRef50_Q4RWR4 Cluster: Chromosome 15 SCAF14981, whole genome s...    45   0.002
UniRef50_Q03W19 Cluster: Serine/threonine protein kinase with be...    45   0.002
UniRef50_A7P4N8 Cluster: Chromosome chr4 scaffold_6, whole genom...    45   0.002
UniRef50_Q9TXI1 Cluster: Putative uncharacterized protein F23C8....    45   0.002
UniRef50_Q761X1 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q5CHJ7 Cluster: Calcium-dependent protein kinase; n=4; ...    45   0.002
UniRef50_Q21017 Cluster: Protein kinase protein 29; n=2; Caenorh...    45   0.002
UniRef50_A2DV83 Cluster: AGC family protein kinase; n=1; Trichom...    45   0.002
UniRef50_A2DPA3 Cluster: CAMK family protein kinase; n=1; Tricho...    45   0.002
UniRef50_A0D448 Cluster: Chromosome undetermined scaffold_37, wh...    45   0.002
UniRef50_A0C3Q6 Cluster: Chromosome undetermined scaffold_147, w...    45   0.002
UniRef50_A0BCB2 Cluster: Chromosome undetermined scaffold_10, wh...    45   0.002
UniRef50_Q6FM66 Cluster: Candida glabrata strain CBS138 chromoso...    45   0.002
UniRef50_Q6CPN3 Cluster: Similar to sgd|S0002874 Saccharomyces c...    45   0.002
UniRef50_A3LVN1 Cluster: Predicted protein; n=1; Pichia stipitis...    45   0.002
UniRef50_Q9NRP7 Cluster: Serine/threonine-protein kinase 36; n=2...    45   0.002
UniRef50_Q9NJU9 Cluster: Calcium-dependent protein kinase 3; n=6...    45   0.002
UniRef50_UPI0000E46D98 Cluster: PREDICTED: similar to doublecort...    45   0.003
UniRef50_Q9K9Z0 Cluster: Serine/threonine protein kinase; n=1; B...    45   0.003
UniRef50_Q92AI8 Cluster: Lin1934 protein; n=13; Bacillales|Rep: ...    45   0.003
UniRef50_Q5SHY6 Cluster: Serine/threonine protein kinase; n=2; T...    45   0.003
UniRef50_Q1IN33 Cluster: Serine/threonine protein kinase; n=1; A...    45   0.003
UniRef50_Q0PIH7 Cluster: Ser/Thr protein kinase; n=1; Heliobacil...    45   0.003
UniRef50_Q8S9G0 Cluster: SNF1-related protein kinase; n=2; BEP c...    45   0.003
UniRef50_Q8IDV5 Cluster: Calcium-dependent protein kinase; n=7; ...    45   0.003
UniRef50_A3FQ66 Cluster: Protein kinase domain, putative; n=2; C...    45   0.003
UniRef50_A2GPR1 Cluster: AGC family protein kinase; n=3; Trichom...    45   0.003
UniRef50_A0EFS0 Cluster: Chromosome undetermined scaffold_94, wh...    45   0.003
UniRef50_A0CJM5 Cluster: Chromosome undetermined scaffold_2, who...    45   0.003
UniRef50_A0CEB3 Cluster: Chromosome undetermined scaffold_170, w...    45   0.003
UniRef50_A0CDL4 Cluster: Chromosome undetermined scaffold_17, wh...    45   0.003
UniRef50_Q8SR98 Cluster: SNF1-RELATED PROTEIN KINASE; n=1; Encep...    45   0.003
UniRef50_Q5KCH7 Cluster: Calmodulin-dependent protein kinase I, ...    45   0.003
UniRef50_Q1DV10 Cluster: Putative uncharacterized protein; n=2; ...    45   0.003
UniRef50_A7TFG1 Cluster: Putative uncharacterized protein; n=1; ...    45   0.003
UniRef50_A7E3Z6 Cluster: Putative uncharacterized protein; n=1; ...    45   0.003
UniRef50_A5DU07 Cluster: Putative uncharacterized protein; n=1; ...    45   0.003
UniRef50_A3LWU1 Cluster: Serine/threonine protein kinase; n=1; P...    45   0.003
UniRef50_A3LWS0 Cluster: Predicted protein; n=2; Saccharomycetac...    45   0.003
UniRef50_A3LNW8 Cluster: Predicted protein; n=5; Saccharomycetal...    45   0.003
UniRef50_Q8ZYE4 Cluster: Serine/threonine protein kinase, putati...    45   0.003
UniRef50_P50528 Cluster: Serine/threonine-protein kinase plo1; n...    45   0.003
UniRef50_Q16816 Cluster: Phosphorylase b kinase gamma catalytic ...    45   0.003
UniRef50_Q9H093 Cluster: NUAK family SNF1-like kinase 2; n=31; E...    45   0.003
UniRef50_Q8IY84 Cluster: Serine/threonine-protein kinase NIM1; n...    45   0.003
UniRef50_P51956 Cluster: Serine/threonine-protein kinase Nek3; n...    45   0.003
UniRef50_O75582 Cluster: Ribosomal protein S6 kinase alpha-5; n=...    45   0.003
UniRef50_Q38997 Cluster: SNF1-related protein kinase catalytic s...    45   0.003
UniRef50_UPI00006CC9DF Cluster: Protein kinase domain containing...    44   0.003
UniRef50_Q4SMN8 Cluster: Chromosome undetermined SCAF14546, whol...    44   0.003
UniRef50_Q4RNM0 Cluster: Chromosome 21 SCAF15012, whole genome s...    44   0.003
UniRef50_Q08X05 Cluster: Serine/threonine-protein kinase Pkn3; n...    44   0.003
UniRef50_Q9XF67 Cluster: 3-phosphoinositide-dependent protein ki...    44   0.003
UniRef50_Q7RGT1 Cluster: Plasmodium falciparum CDPK2 protein-rel...    44   0.003
UniRef50_Q585U8 Cluster: Protein kinase, putative; n=3; Trypanos...    44   0.003
UniRef50_Q54XL6 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q235V0 Cluster: Protein kinase domain containing protei...    44   0.003
UniRef50_Q22C77 Cluster: Protein kinase domain containing protei...    44   0.003
UniRef50_Q19KC5 Cluster: P21-activated kinase MAX-2; n=4; Caenor...    44   0.003
UniRef50_A7AMV1 Cluster: Protein kinase domain containing protei...    44   0.003
UniRef50_A2EEC8 Cluster: CAMK family protein kinase; n=4; Tricho...    44   0.003
UniRef50_A2DWN5 Cluster: CMGC family protein kinase; n=3; Tricho...    44   0.003
UniRef50_A2DP41 Cluster: AGC family protein kinase; n=1; Trichom...    44   0.003
UniRef50_A0E7U8 Cluster: Chromosome undetermined scaffold_81, wh...    44   0.003
UniRef50_Q55U80 Cluster: Putative uncharacterized protein; n=3; ...    44   0.003
UniRef50_Q0UU82 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_P50530 Cluster: Serine/threonine-protein kinase sck1; n...    44   0.003
UniRef50_UPI000150A707 Cluster: Protein kinase domain containing...    44   0.005
UniRef50_UPI0000F211F9 Cluster: PREDICTED: hypothetical protein;...    44   0.005
UniRef50_UPI0000DB6ED3 Cluster: PREDICTED: similar to CG17528-PC...    44   0.005
UniRef50_UPI00006CB1DB Cluster: Protein kinase domain containing...    44   0.005
UniRef50_UPI000049857F Cluster: protein kinase; n=1; Entamoeba h...    44   0.005
UniRef50_UPI000065CA7D Cluster: Homolog of Homo sapiens "BR seri...    44   0.005
UniRef50_Q4SAD5 Cluster: Chromosome 13 SCAF14688, whole genome s...    44   0.005
UniRef50_Q4RVL2 Cluster: Chromosome 15 SCAF14992, whole genome s...    44   0.005
UniRef50_Q4RPX2 Cluster: Chromosome 12 SCAF15007, whole genome s...    44   0.005
UniRef50_Q2JKH0 Cluster: Serine/threonine protein kinase; n=2; S...    44   0.005
UniRef50_A7H9C5 Cluster: Protein kinase precursor; n=2; Anaeromy...    44   0.005
UniRef50_A3Y8M5 Cluster: Cyclic nucleotide-binding:Protein kinas...    44   0.005
UniRef50_Q9VGP9 Cluster: CG6715-PA; n=7; Sophophora|Rep: CG6715-...    44   0.005
UniRef50_Q7R1C7 Cluster: GLP_306_41805_40438; n=1; Giardia lambl...    44   0.005
UniRef50_Q5CLQ1 Cluster: Protein kinase domain; n=2; Cryptospori...    44   0.005
UniRef50_Q54PB4 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q4UF19 Cluster: Serine/threonine protein kinase, putati...    44   0.005
UniRef50_Q4E2T3 Cluster: Protein kinase, putative; n=1; Trypanos...    44   0.005
UniRef50_Q17E44 Cluster: Map/microtubule affinity-regulating kin...    44   0.005
UniRef50_A2GCT3 Cluster: CAMK family protein kinase; n=1; Tricho...    44   0.005
UniRef50_A2EZG8 Cluster: AGC family protein kinase; n=1; Trichom...    44   0.005
UniRef50_A2DJD0 Cluster: STE family protein kinase; n=1; Trichom...    44   0.005
UniRef50_A0E012 Cluster: Chromosome undetermined scaffold_71, wh...    44   0.005
UniRef50_A0CYE6 Cluster: Chromosome undetermined scaffold_31, wh...    44   0.005
UniRef50_A0CIV9 Cluster: Chromosome undetermined scaffold_19, wh...    44   0.005
UniRef50_A0CDD7 Cluster: Chromosome undetermined scaffold_17, wh...    44   0.005
UniRef50_A0C8U0 Cluster: Chromosome undetermined scaffold_159, w...    44   0.005
UniRef50_A0C5A6 Cluster: Chromosome undetermined scaffold_15, wh...    44   0.005
UniRef50_A0BUI0 Cluster: Chromosome undetermined scaffold_129, w...    44   0.005
UniRef50_A0BJR0 Cluster: Chromosome undetermined scaffold_110, w...    44   0.005
UniRef50_Q2HAF0 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q1HGK2 Cluster: SNF1; n=3; Pezizomycotina|Rep: SNF1 - M...    44   0.005
UniRef50_Q0UGQ2 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_A5DTJ8 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_A3LPP5 Cluster: Serine-threonine protein kinase; n=1; P...    44   0.005
UniRef50_A1C9Y9 Cluster: Serine/threonine protein kinase, putati...    44   0.005
UniRef50_P43565 Cluster: Serine/threonine-protein kinase RIM15; ...    44   0.005
UniRef50_Q3UIZ8 Cluster: Putative myosin light chain kinase 3; n...    44   0.005
UniRef50_P24719 Cluster: Meiosis-specific serine/threonine-prote...    44   0.005
UniRef50_Q8IWQ3 Cluster: BR serine/threonine-protein kinase 2; n...    44   0.005
UniRef50_UPI00015B57D1 Cluster: PREDICTED: similar to GA11375-PA...    44   0.006
UniRef50_UPI0000F1D9B4 Cluster: PREDICTED: hypothetical protein;...    44   0.006
UniRef50_UPI0000DB717F Cluster: PREDICTED: similar to tricornere...    44   0.006
UniRef50_UPI0000D5755E Cluster: PREDICTED: similar to ribosomal ...    44   0.006
UniRef50_UPI0000D5670B Cluster: PREDICTED: similar to Putative s...    44   0.006
UniRef50_UPI00006CFA8B Cluster: Protein kinase domain containing...    44   0.006
UniRef50_Q4RYN4 Cluster: Chromosome 16 SCAF14974, whole genome s...    44   0.006
UniRef50_Q98PN7 Cluster: SERINE/THREONINE-PROTEIN KINASE PKNB; n...    44   0.006
UniRef50_Q820A8 Cluster: Serine/threonine protein kinase; n=2; E...    44   0.006
UniRef50_Q6H074 Cluster: Putative serine/threonine kinase; n=2; ...    44   0.006
UniRef50_Q5EUF2 Cluster: Cyclin-dependent kinase-activating kina...    44   0.006
UniRef50_A0Q110 Cluster: Serine/threonine protein kinase; n=1; C...    44   0.006
UniRef50_Q7XTL8 Cluster: OSJNBa0070M12.8 protein; n=2; Oryza sat...    44   0.006
UniRef50_A5BPZ0 Cluster: Putative uncharacterized protein; n=1; ...    44   0.006
UniRef50_Q552C7 Cluster: Protein tyrosine kinase; n=5; Dictyoste...    44   0.006
UniRef50_Q4Q5Q9 Cluster: Protein kinase, putative; n=3; Leishman...    44   0.006
UniRef50_Q4E096 Cluster: Protein kinase, putative; n=2; Trypanos...    44   0.006
UniRef50_Q23WW0 Cluster: Protein kinase domain containing protei...    44   0.006
UniRef50_Q22NG5 Cluster: Protein kinase domain containing protei...    44   0.006
UniRef50_Q22BC6 Cluster: Protein kinase domain containing protei...    44   0.006
UniRef50_Q21360 Cluster: Putative uncharacterized protein; n=6; ...    44   0.006
UniRef50_A5K3L6 Cluster: Serine/threonine-protein kinase, putati...    44   0.006
UniRef50_A2F3K9 Cluster: STE family protein kinase; n=2; Trichom...    44   0.006
UniRef50_A2F2G4 Cluster: CAMK family protein kinase; n=1; Tricho...    44   0.006
UniRef50_A2EB76 Cluster: CAMK family protein kinase; n=1; Tricho...    44   0.006
UniRef50_A0E7F6 Cluster: Chromosome undetermined scaffold_81, wh...    44   0.006
UniRef50_A0DTB4 Cluster: Chromosome undetermined scaffold_62, wh...    44   0.006
UniRef50_A0CYA5 Cluster: Chromosome undetermined scaffold_31, wh...    44   0.006
UniRef50_Q9HGS0 Cluster: CAMP-dependent protein kinase catalytic...    44   0.006
UniRef50_Q59PW2 Cluster: Likely protein kinase; n=2; Candida alb...    44   0.006
UniRef50_Q86YV6 Cluster: Uncharacterized serine/threonine-protei...    44   0.006
UniRef50_P15735 Cluster: Phosphorylase b kinase gamma catalytic ...    44   0.006
UniRef50_P25389 Cluster: Probable serine/threonine-protein kinas...    44   0.006
UniRef50_Q6RET6 Cluster: Calcium and calcium/calmodulin-dependen...    44   0.006
UniRef50_O88445 Cluster: Serine/threonine-protein kinase 13; n=7...    44   0.006
UniRef50_UPI0001554A4C Cluster: PREDICTED: hypothetical protein;...    43   0.008
UniRef50_UPI0000F20AB2 Cluster: PREDICTED: hypothetical protein;...    43   0.008
UniRef50_UPI0000D55AB7 Cluster: PREDICTED: similar to CG7719-PA;...    43   0.008
UniRef50_UPI0000D556BE Cluster: PREDICTED: similar to CG7186-PA;...    43   0.008
UniRef50_UPI00005A4286 Cluster: PREDICTED: similar to doublecort...    43   0.008
UniRef50_UPI0000548690 Cluster: PREDICTED: hypothetical protein;...    43   0.008
UniRef50_A2BFU1 Cluster: Novel protein; n=6; Euteleostomi|Rep: N...    43   0.008
UniRef50_A6C4Q0 Cluster: Serine/threonine kinase; n=1; Planctomy...    43   0.008
UniRef50_A0H593 Cluster: Protein kinase; n=1; Chloroflexus aggre...    43   0.008
UniRef50_Q9SEZ7 Cluster: CBL-interacting protein kinase 16; n=10...    43   0.008
UniRef50_Q8GZX1 Cluster: Putative Ste20-related protein kinase; ...    43   0.008
UniRef50_Q9VA38 Cluster: CG12072-PA; n=5; Sophophora|Rep: CG1207...    43   0.008
UniRef50_Q9NF64 Cluster: Putative uncharacterized protein; n=1; ...    43   0.008
UniRef50_Q8SWT6 Cluster: RE56868p; n=4; Drosophila melanogaster|...    43   0.008
UniRef50_Q8IID5 Cluster: Putative uncharacterized protein; n=4; ...    43   0.008
UniRef50_Q7QBH3 Cluster: ENSANGP00000014786; n=3; Culicidae|Rep:...    43   0.008
UniRef50_Q0KI87 Cluster: CG11870-PA, isoform A; n=3; Drosophila ...    43   0.008
UniRef50_A5K4N8 Cluster: Calcium-dependent protein kinase 3, put...    43   0.008
UniRef50_A4VDB2 Cluster: Serine/threonine protein kinase; n=1; T...    43   0.008
UniRef50_A4KWE2 Cluster: Aurora kinase; n=2; Giardia intestinali...    43   0.008
UniRef50_A2EZ63 Cluster: AGC family protein kinase; n=2; Trichom...    43   0.008
UniRef50_A2EF14 Cluster: CAMK family protein kinase; n=3; Tricho...    43   0.008
UniRef50_A2DV71 Cluster: CAMK family protein kinase; n=1; Tricho...    43   0.008
UniRef50_A0EBS2 Cluster: Chromosome undetermined scaffold_88, wh...    43   0.008
UniRef50_A0E5H9 Cluster: Chromosome undetermined scaffold_8, who...    43   0.008
UniRef50_A0DQ97 Cluster: Chromosome undetermined scaffold_6, who...    43   0.008
UniRef50_A0DGH6 Cluster: Chromosome undetermined scaffold_5, who...    43   0.008
UniRef50_A0CWP3 Cluster: Chromosome undetermined scaffold_3, who...    43   0.008
UniRef50_A0CWE5 Cluster: Chromosome undetermined scaffold_3, who...    43   0.008
UniRef50_A0CPM9 Cluster: Chromosome undetermined scaffold_23, wh...    43   0.008
UniRef50_A0BS82 Cluster: Chromosome undetermined scaffold_124, w...    43   0.008
UniRef50_Q6ZNI2 Cluster: CDNA FLJ16039 fis, clone ADRGL2001554, ...    43   0.008
UniRef50_Q7SCT1 Cluster: Putative uncharacterized protein NCU090...    43   0.008
UniRef50_Q6FQL1 Cluster: Candida glabrata strain CBS138 chromoso...    43   0.008
UniRef50_Q4WCS9 Cluster: Serine/threonine protein kinase (Kcc4),...    43   0.008
UniRef50_Q4P7I5 Cluster: Putative uncharacterized protein; n=1; ...    43   0.008
UniRef50_Q0ULL3 Cluster: Putative uncharacterized protein; n=1; ...    43   0.008
UniRef50_A6RB29 Cluster: Putative uncharacterized protein; n=1; ...    43   0.008
UniRef50_O94324 Cluster: Serine/threonine-protein kinase ppk31; ...    43   0.008
UniRef50_Q9CEF5 Cluster: Probable serine/threonine-protein kinas...    43   0.008
UniRef50_Q18846 Cluster: Putative ribosomal protein S6 kinase al...    43   0.008
UniRef50_Q09170 Cluster: Serine/threonine-protein kinase cds1; n...    43   0.008
UniRef50_UPI0000DB76CC Cluster: PREDICTED: similar to serine/thr...    43   0.011
UniRef50_UPI0000D56F77 Cluster: PREDICTED: similar to CG11870-PA...    43   0.011
UniRef50_UPI00006CAB34 Cluster: Protein kinase domain containing...    43   0.011
UniRef50_Q4SL09 Cluster: Chromosome 17 SCAF14563, whole genome s...    43   0.011
UniRef50_Q1HH95 Cluster: 1629-capsid; n=2; Antheraea pernyi nucl...    43   0.011
UniRef50_Q8YPQ1 Cluster: Serine/threonine kinase; n=3; Nostocace...    43   0.011
UniRef50_Q88WL0 Cluster: Serine/threonine protein kinase; n=3; L...    43   0.011
UniRef50_Q2SQN9 Cluster: Serine/threonine protein kinase; n=1; H...    43   0.011
UniRef50_Q2JP36 Cluster: Protein kinase; n=2; Synechococcus|Rep:...    43   0.011
UniRef50_Q08ZF7 Cluster: Serine/threonine-protein kinase Pkn1; n...    43   0.011
UniRef50_A4XL76 Cluster: Protein kinase; n=1; Caldicellulosirupt...    43   0.011
UniRef50_A0YPI4 Cluster: Serine/threonine kinase; n=1; Lyngbya s...    43   0.011
UniRef50_Q9XWQ5 Cluster: Putative uncharacterized protein; n=2; ...    43   0.011
UniRef50_Q86IX1 Cluster: Similar to Oryza sativa (Rice). 36I5.3;...    43   0.011
UniRef50_Q24FU4 Cluster: Protein kinase domain containing protei...    43   0.011
UniRef50_Q23GB0 Cluster: Protein kinase domain containing protei...    43   0.011
UniRef50_Q17M45 Cluster: Br serine/threonine-protein kinase; n=2...    43   0.011
UniRef50_A7SZV3 Cluster: Predicted protein; n=1; Nematostella ve...    43   0.011
UniRef50_A2F029 Cluster: CAMK family protein kinase; n=3; Tricho...    43   0.011
UniRef50_A2EV88 Cluster: CAMK family protein kinase; n=1; Tricho...    43   0.011
UniRef50_A2EBR0 Cluster: CAMK family protein kinase; n=1; Tricho...    43   0.011
UniRef50_A2DY61 Cluster: CAMK family protein kinase; n=1; Tricho...    43   0.011
UniRef50_A2D8G0 Cluster: CMGC family protein kinase; n=1; Tricho...    43   0.011
UniRef50_A0EIN6 Cluster: Chromosome undetermined scaffold_99, wh...    43   0.011
UniRef50_A0CQ56 Cluster: Chromosome undetermined scaffold_24, wh...    43   0.011
UniRef50_A0CP93 Cluster: Chromosome undetermined scaffold_23, wh...    43   0.011
UniRef50_A0C9J6 Cluster: Chromosome undetermined scaffold_16, wh...    43   0.011
UniRef50_A0C1X6 Cluster: Chromosome undetermined scaffold_143, w...    43   0.011
UniRef50_A0BTX5 Cluster: Chromosome undetermined scaffold_128, w...    43   0.011
UniRef50_A0BP84 Cluster: Chromosome undetermined scaffold_12, wh...    43   0.011
UniRef50_A0BET2 Cluster: Chromosome undetermined scaffold_102, w...    43   0.011
UniRef50_Q75DQ1 Cluster: ABL034Wp; n=1; Eremothecium gossypii|Re...    43   0.011
UniRef50_Q5K9K6 Cluster: Serine/threonine-protein kinase, putati...    43   0.011
UniRef50_O75385 Cluster: Serine/threonine-protein kinase ULK1; n...    43   0.011
UniRef50_Q8R9T6 Cluster: Probable serine/threonine-protein kinas...    43   0.011
UniRef50_Q96L34 Cluster: MAP/microtubule affinity-regulating kin...    43   0.011
UniRef50_P53233 Cluster: Probable serine/threonine-protein kinas...    43   0.011
UniRef50_Q9M9V8 Cluster: Calcium-dependent protein kinase 10; n=...    43   0.011
UniRef50_UPI00015B5491 Cluster: PREDICTED: similar to br serine/...    42   0.014
UniRef50_UPI000150A956 Cluster: Protein kinase domain containing...    42   0.014
UniRef50_UPI0000F2C213 Cluster: PREDICTED: hypothetical protein;...    42   0.014
UniRef50_UPI0000D57583 Cluster: PREDICTED: similar to Serine/thr...    42   0.014
UniRef50_UPI0000D56DEC Cluster: PREDICTED: similar to CG10967-PA...    42   0.014
UniRef50_UPI00006CD585 Cluster: Protein kinase domain containing...    42   0.014
UniRef50_UPI0000499847 Cluster: protein kinase; n=1; Entamoeba h...    42   0.014
UniRef50_UPI0000498718 Cluster: protein kinase; n=1; Entamoeba h...    42   0.014
UniRef50_Q90ZY5 Cluster: Protein kinase Chk2; n=4; Danio rerio|R...    42   0.014
UniRef50_Q7UVF2 Cluster: Serine/threonine protein kinase; n=1; P...    42   0.014
UniRef50_Q112K6 Cluster: Serine/threonine protein kinase; n=2; T...    42   0.014
UniRef50_Q9MA11 Cluster: F20B17.7; n=2; core eudicotyledons|Rep:...    42   0.014
UniRef50_Q00RV4 Cluster: Protein Kinase; n=2; Ostreococcus|Rep: ...    42   0.014
UniRef50_Q584V3 Cluster: Protein kinase, putative; n=1; Trypanos...    42   0.014
UniRef50_Q240Z1 Cluster: Protein kinase domain containing protei...    42   0.014
UniRef50_Q240P0 Cluster: Protein kinase domain containing protei...    42   0.014
UniRef50_Q23FS9 Cluster: Protein kinase domain containing protei...    42   0.014
UniRef50_Q22UZ4 Cluster: Protein kinase domain containing protei...    42   0.014
UniRef50_Q22MG5 Cluster: Protein kinase domain containing protei...    42   0.014
UniRef50_Q1JTH8 Cluster: Calcium-dependent protein kinase, putat...    42   0.014
UniRef50_O18645 Cluster: CG3051-PA, isoform A; n=9; Coelomata|Re...    42   0.014
UniRef50_A3FQ16 Cluster: Calmodulin-domain protein kinase 1, put...    42   0.014
UniRef50_A2E1Q5 Cluster: CAMK family protein kinase; n=1; Tricho...    42   0.014
UniRef50_A2DTE9 Cluster: CK1 family protein kinase; n=1; Trichom...    42   0.014
UniRef50_A2DH03 Cluster: CAMK family protein kinase; n=1; Tricho...    42   0.014
UniRef50_A0ECK3 Cluster: Chromosome undetermined scaffold_9, who...    42   0.014
UniRef50_A0EBP9 Cluster: Chromosome undetermined scaffold_88, wh...    42   0.014
UniRef50_A0E1Z0 Cluster: Chromosome undetermined scaffold_74, wh...    42   0.014
UniRef50_A0DZS0 Cluster: Chromosome undetermined scaffold_70, wh...    42   0.014
UniRef50_A0CWQ7 Cluster: Chromosome undetermined scaffold_3, who...    42   0.014
UniRef50_A0CW38 Cluster: Chromosome undetermined scaffold_3, who...    42   0.014
UniRef50_A0CJZ5 Cluster: Chromosome undetermined scaffold_2, who...    42   0.014
UniRef50_A0CDT9 Cluster: Chromosome undetermined scaffold_17, wh...    42   0.014
UniRef50_A0BJ35 Cluster: Chromosome undetermined scaffold_11, wh...    42   0.014
UniRef50_Q95VS7 Cluster: Checkpoint protein kinase; n=1; Antonos...    42   0.014
UniRef50_Q753H7 Cluster: AFR335Cp; n=1; Eremothecium gossypii|Re...    42   0.014
UniRef50_Q6FUU2 Cluster: Candida glabrata strain CBS138 chromoso...    42   0.014
UniRef50_Q6FM39 Cluster: Similar to tr|Q03785 Saccharomyces cere...    42   0.014
UniRef50_Q6FLY2 Cluster: Candida glabrata strain CBS138 chromoso...    42   0.014
UniRef50_A5DRG0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.014
UniRef50_Q6L2T2 Cluster: Serine/threonine protein kinase; n=1; P...    42   0.014
UniRef50_Q03785 Cluster: Serine/threonine-protein kinase VHS1; n...    42   0.014
UniRef50_P75524 Cluster: Putative serine/threonine-protein kinas...    42   0.014
UniRef50_UPI00006CD327 Cluster: Protein kinase domain containing...    42   0.018
UniRef50_UPI00006CC10B Cluster: Protein kinase domain containing...    42   0.018
UniRef50_UPI0000499E04 Cluster: protein kinase; n=1; Entamoeba h...    42   0.018
UniRef50_UPI000065EE71 Cluster: MAP/microtubule affinity-regulat...    42   0.018
UniRef50_Q6ZM37 Cluster: Novel protein; n=2; Danio rerio|Rep: No...    42   0.018
UniRef50_Q4RTQ1 Cluster: Chromosome 2 SCAF14997, whole genome sh...    42   0.018
UniRef50_Q6F1P5 Cluster: Probable serine/threonine protein kinas...    42   0.018
UniRef50_Q3AC24 Cluster: Putative serine/threonine protein kinas...    42   0.018
UniRef50_Q3DZ09 Cluster: Protein kinase:TPR repeat:Tetratricopep...    42   0.018
UniRef50_Q026F8 Cluster: Serine/threonine protein kinase; n=1; S...    42   0.018
UniRef50_A4F748 Cluster: Serine/threonine kinase; n=1; Saccharop...    42   0.018
UniRef50_Q9LE81 Cluster: IRE; n=5; Magnoliophyta|Rep: IRE - Arab...    42   0.018
UniRef50_Q84QE0 Cluster: Avr9/Cf-9 rapidly elicited protein 216;...    42   0.018
UniRef50_A3CJJ7 Cluster: Putative uncharacterized protein; n=1; ...    42   0.018
UniRef50_Q9VUV4 Cluster: CG6114-PA; n=2; Drosophila melanogaster...    42   0.018
UniRef50_Q9VCL7 Cluster: CG10177-PA; n=2; Drosophila melanogaste...    42   0.018
UniRef50_Q57WI0 Cluster: Protein kinase, putative; n=1; Trypanos...    42   0.018
UniRef50_Q54XJ4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.018
UniRef50_Q24C26 Cluster: Protein kinase domain containing protei...    42   0.018
UniRef50_A7API5 Cluster: Protein kinase domain containing protei...    42   0.018
UniRef50_A4I4Q9 Cluster: Serine/threonine protein kinase, putati...    42   0.018
UniRef50_A2FCZ8 Cluster: CAMK family protein kinase; n=1; Tricho...    42   0.018
UniRef50_A2DIQ7 Cluster: STE family protein kinase; n=1; Trichom...    42   0.018
UniRef50_A0DYR9 Cluster: Chromosome undetermined scaffold_7, who...    42   0.018
UniRef50_A0DTT4 Cluster: Chromosome undetermined scaffold_63, wh...    42   0.018
UniRef50_A0C6L7 Cluster: Chromosome undetermined scaffold_152, w...    42   0.018
UniRef50_A0BNU2 Cluster: Chromosome undetermined scaffold_119, w...    42   0.018
UniRef50_A0BMD5 Cluster: Chromosome undetermined scaffold_116, w...    42   0.018
UniRef50_Q757U5 Cluster: AEL083Wp; n=2; Saccharomycetales|Rep: A...    42   0.018

>UniRef50_Q03209 Cluster: 61 kDa protein; n=6;
           Nucleopolyhedrovirus|Rep: 61 kDa protein - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 543

 Score =  160 bits (388), Expect = 4e-38
 Identities = 78/87 (89%), Positives = 82/87 (94%)
 Frame = +3

Query: 501 F*TVDTAEAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNAVV 680
           F  VDTAEAQIIK++IYDNTV+LNRDV LNILK ANDVFDNKAYMYVDDSEVSR+YNAVV
Sbjct: 27  FERVDTAEAQIIKNNIYDNTVVLNRDVLLNILKLANDVFDNKAYMYVDDSEVSRHYNAVV 86

Query: 681 KMKRLVINVRDPSLRQSLYNTIAYIER 761
           KMKRLVI VRDPSLRQSLYNTIAYIER
Sbjct: 87  KMKRLVIGVRDPSLRQSLYNTIAYIER 113



 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 27/28 (96%), Positives = 28/28 (100%)
 Frame = +1

Query: 424 MTNRKYESVQSYLFNNRNNKIDAHQFFE 507
           MTNR+YESVQSYLFNNRNNKIDAHQFFE
Sbjct: 1   MTNRRYESVQSYLFNNRNNKIDAHQFFE 28



 Score = 33.9 bits (74), Expect = 4.9
 Identities = 15/16 (93%), Positives = 16/16 (100%)
 Frame = +2

Query: 761 MLNIGTVNDSEITMLI 808
           +LNIGTVNDSEITMLI
Sbjct: 114 LLNIGTVNDSEITMLI 129


>UniRef50_O10269 Cluster: Serine/threonine-protein kinase 1; n=14;
           Nucleopolyhedrovirus|Rep: Serine/threonine-protein
           kinase 1 - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 274

 Score =  110 bits (265), Expect = 4e-23
 Identities = 49/85 (57%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           +F+ DEI VH LM+DHP+F+ +YF +       IVMDY+ CPDLFETLQ +G L + LV 
Sbjct: 52  SFSADEINVHDLMSDHPSFVDMYFCYSSPTAWAIVMDYVPCPDLFETLQTQGALDNALVV 111

Query: 73  NIIRQLCEALNDLHK-HNFIHNDIK 2
           NI+RQLC+ALNDLH    +IHND+K
Sbjct: 112 NIVRQLCDALNDLHNATGYIHNDVK 136



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -1

Query: 396 LQTLVQFYENCKNVKTRYKIINGRFGKISILSHKP-TSKLYLQKTISA 256
           LQ+L +F  +C  +    K++NGRFGK+ +L H+P TSKL+L+KTI+A
Sbjct: 5   LQSLSRFVADCAVLAP--KVVNGRFGKMDVLHHRPTTSKLFLRKTIAA 50


>UniRef50_P89912 Cluster: Protein kinase; n=3;
           Nucleopolyhedrovirus|Rep: Protein kinase - Spodoptera
           littoralis nuclear polyhedrosis virus (SlNPV)
          Length = 278

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 40/84 (47%), Positives = 55/84 (65%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           NF+  E+ VH LM DH NFIK+Y+        V++MDY++  DLFE L++ G  S +  +
Sbjct: 56  NFDAIELTVHHLMRDHSNFIKLYYAFNTPKIHVLIMDYVEDGDLFEILKMDGPFSERKTA 115

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           N++ QL  ALN LHKH  IHND+K
Sbjct: 116 NVVSQLVFALNSLHKHRIIHNDVK 139



 Score = 41.1 bits (92), Expect = 0.032
 Identities = 14/27 (51%), Positives = 24/27 (88%)
 Frame = -1

Query: 342 KIINGRFGKISILSHKPTSKLYLQKTI 262
           ++I+G++GK+S++ H PT KL+L+KTI
Sbjct: 26  RLIDGKYGKVSVIRHTPTDKLFLKKTI 52


>UniRef50_Q7TLL9 Cluster: Capsid associated protein; n=1;
           Choristoneura fumiferana MNPV|Rep: Capsid associated
           protein - Choristoneura fumiferana nuclear polyhedrosis
           virus (CfMNPV)
          Length = 631

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 36/79 (45%), Positives = 57/79 (72%)
 Frame = +3

Query: 522 EAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNAVVKMKRLVI 701
           EA  IK  + D TV LNR   L++LK A +++ + AYM+VD +E SR++  + +M++L+I
Sbjct: 34  EAHNIKLGLADRTVRLNRTTVLDLLKLAENIYADTAYMHVDQAEASRHFVTLTRMRQLLI 93

Query: 702 NVRDPSLRQSLYNTIAYIE 758
           NV++P++RQSL N +A IE
Sbjct: 94  NVQEPNVRQSLNNILARIE 112



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +1

Query: 424 MTNRKYESVQSYLFNNRNNKIDAHQFF 504
           M  R+Y+SV+SYL  N++N ID + FF
Sbjct: 1   MMERQYQSVRSYLIGNQHNNIDVNFFF 27


>UniRef50_Q0N495 Cluster: Protein kinase 1; n=2; unclassified
           Nucleopolyhedrovirus|Rep: Protein kinase 1 - Clanis
           bilineata nucleopolyhedrosis virus
          Length = 264

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 36/79 (45%), Positives = 53/79 (67%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI VHQLMN H NFIK++++   +   +++MDYI   DLF+ L+ +  +    V  I+R+
Sbjct: 57  EIFVHQLMNKHKNFIKLFYSFNTLRGHLLIMDYIKGGDLFDLLRKEDFIPLSEVKFILRE 116

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EAL  LHK++ IHNDIK
Sbjct: 117 VIEALMALHKNHIIHNDIK 135



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = -1

Query: 399 TLQTLVQFYENCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTIS 259
           T  + +Q ++     +   K+ING+FGK+ + +H PT K +L K IS
Sbjct: 3   TFLSEIQHFDEDTTPRNDIKLINGKFGKVYVRNHTPTQKDFLFKQIS 49


>UniRef50_P41719 Cluster: Serine/threonine-protein kinase 1; n=11;
           Nucleopolyhedrovirus|Rep: Serine/threonine-protein
           kinase 1 - Heliothis zea nuclear polyhedrosis virus
           (HzSNPV) (Helicoverpa zeasingle nucleocapsid nuclear
           polyhedrosis virus)
          Length = 267

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 32/76 (42%), Positives = 51/76 (67%)
 Frame = -3

Query: 229 VHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCE 50
           VHQLM D+  FIK+Y++   + +Q++++DY+   DLF+ L+   ++S     +I+ QL E
Sbjct: 61  VHQLMKDNRYFIKLYYSLTTLKSQILILDYVAGGDLFDFLKKHKKVSEAETRSIVGQLTE 120

Query: 49  ALNDLHKHNFIHNDIK 2
           ALN LH +  IHND+K
Sbjct: 121 ALNALHSYKIIHNDLK 136



 Score = 41.1 bits (92), Expect = 0.032
 Identities = 13/41 (31%), Positives = 31/41 (75%)
 Frame = -1

Query: 381 QFYENCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTIS 259
           QF+   K ++   ++++G+FGK+ ++ H+PT KL+++K+++
Sbjct: 11  QFFAEIK-IQNNVRLVDGKFGKMCVIKHEPTGKLFVKKSVA 50


>UniRef50_Q80LU1 Cluster: Protein kinase; n=1; Adoxophyes honmai
           NPV|Rep: Protein kinase - Adoxophyes honmai
           nucleopolyhedrovirus
          Length = 269

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           ++N  E  VH++M  +  F+K+Y+        +++MDY+   DLF  L+ +  L    V 
Sbjct: 52  DYNSIEPMVHRIMEKNKYFLKLYYLCETPRRNILIMDYVPDGDLFNLLRKEDHLGEDEVI 111

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
            IIRQ+CEAL  LHKH  IHNDIK
Sbjct: 112 FIIRQVCEALAALHKHLIIHNDIK 135



 Score = 40.7 bits (91), Expect = 0.042
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = -1

Query: 357 VKTRYKIINGRFGKISILSHKPTSKLYLQKTI 262
           +K    I +G+FGKI++L HKPT KL+L K I
Sbjct: 17  IKMNINISDGKFGKITVLQHKPTMKLFLCKEI 48


>UniRef50_Q0ILB6 Cluster: Pk1; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: Pk1 - Leucania separata nuclear
           polyhedrosis virus (LsNPV)
          Length = 270

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 32/84 (38%), Positives = 48/84 (57%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           N+   E  VH LM ++  F+ +++    +    +++DYI   DLFE ++  G LS     
Sbjct: 53  NYRPIEPMVHHLMKNNQYFVNLFYAVSTLKGTTLILDYIPEGDLFEYVKTNGSLSEAETR 112

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           +I+RQ   ALN LH +N IHNDIK
Sbjct: 113 SIVRQTASALNSLHAYNIIHNDIK 136



 Score = 38.3 bits (85), Expect = 0.23
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 2/41 (4%)
 Frame = -1

Query: 378 FYENCKNVKTR--YKIINGRFGKISILSHKPTSKLYLQKTI 262
           F   C N+K     K+I+G+FGK+ ++ H PT+KL ++K I
Sbjct: 9   FTNFCTNLKLYDDVKLISGKFGKVCVVKHTPTNKLLVRKII 49


>UniRef50_P41720 Cluster: Serine/threonine-protein kinase 1; n=2;
           Nucleopolyhedrovirus|Rep: Serine/threonine-protein
           kinase 1 - Lymantria dispar multicapsid nuclear
           polyhedrosis virus (LdMNPV)
          Length = 274

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 33/84 (39%), Positives = 51/84 (60%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           +FN  E  VH LM  +  F++++++   +   ++VMDYI   DLF+ +Q +  L    +S
Sbjct: 52  HFNAIEPFVHHLMKFNKYFLRLFYSLHSLREHLLVMDYIPDGDLFDLMQTEPRLREPEIS 111

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
            I  QL +AL  LHKHN +HND+K
Sbjct: 112 LIAYQLIDALQALHKHNVVHNDVK 135



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = -1

Query: 378 FYENCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTI 262
           F++ C + +T   ++NG+FGK+S+  H PT K +  K I
Sbjct: 11  FHKEC-SARTALHLVNGKFGKVSVWKHGPTQKSFFYKRI 48


>UniRef50_Q77SA4 Cluster: Protein kinase 1; n=1; Ecotropis obliqua
           NPV|Rep: Protein kinase 1 - Ecotropis obliqua NPV
          Length = 263

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/83 (36%), Positives = 52/83 (62%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           FN  E  VH LM  + +F+ +Y++  ++   +++MDY+   DLF+  Q K +++     +
Sbjct: 51  FNAIEPYVHYLMKGNKHFVNLYYSFNWLRGHLLIMDYVKEGDLFDFCQ-KRKVTEIECKH 109

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I++Q+ EALN LH +  +HNDIK
Sbjct: 110 IVKQIVEALNALHMYKLVHNDIK 132



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
 Frame = -1

Query: 381 QFYENCKNV--KTRYKIINGRFGKISILSHKPTSKLYLQKTI 262
           +F + CK+   +  +K+I+G+FG +S+  HKPT K ++ K I
Sbjct: 5   EFNDFCKHFVREKSFKVIDGKFGSVSLYKHKPTQKNFIVKYI 46


>UniRef50_Q91F41 Cluster: ORF3 PK-1; n=3; Granulovirus|Rep: ORF3
           PK-1 - Cydia pomonella granulosis virus (CpGV) (Cydia
           pomonellagranulovirus)
          Length = 279

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 37/91 (40%), Positives = 55/91 (60%), Gaps = 6/91 (6%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINN--QVIVMDYIDCPDLFETLQIKG----E 95
           + FN  E  VH LM ++PNFIK++ N  F +N   +++MDY+   DLF+ +++       
Sbjct: 54  STFNSLEFDVHILMRNNPNFIKLH-NFVFNDNGESLLIMDYVSDGDLFDFVKMNDTRELR 112

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L+      II  L  ALNDLHK+N +HND+K
Sbjct: 113 LNEAACKKIIITLVTALNDLHKNNIVHNDVK 143


>UniRef50_Q91GB9 Cluster: ORF1629; n=2; Epiphyas postvittana
           NPV|Rep: ORF1629 - Epiphyas postvittana
           nucleopolyhedrovirus (EppoMNPV)
          Length = 562

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 27/79 (34%), Positives = 53/79 (67%)
 Frame = +3

Query: 522 EAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNAVVKMKRLVI 701
           EA  +K ++   TV LNR   L++LK A +++++ AYM+VD  +  R+Y  +++M++++I
Sbjct: 33  EAHNVKQNLIGGTVRLNRTAVLDLLKLAENIYNDTAYMHVDTVDNLRHYTTLMRMRQMLI 92

Query: 702 NVRDPSLRQSLYNTIAYIE 758
           +V D  +R +L N ++ +E
Sbjct: 93  SVTDQHVRLTLANIVSRVE 111



 Score = 33.1 bits (72), Expect = 8.5
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 430 NRKYESVQSYLFNNRNNKIDAHQF 501
           +R+Y+SV+SYL  N NN  DA+ F
Sbjct: 2   DRQYQSVKSYLIKNANNAFDANAF 25


>UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3;
           Nucleopolyhedrovirus|Rep: Viral capsid associated
           protein - Anticarsia gemmatalis nuclear polyhedrosis
           virus (AgMNPV)
          Length = 643

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 30/88 (34%), Positives = 55/88 (62%)
 Frame = +3

Query: 495 SIF*TVDTAEAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNA 674
           + F  V   EA  +K +++  TV LNR   L++LK A +++ + AYM V+  E SR++  
Sbjct: 24  AFFQLVAGPEAHNLKRNLFGRTVKLNRAALLDLLKLAENIYTDTAYMQVNTIESSRHFAT 83

Query: 675 VVKMKRLVINVRDPSLRQSLYNTIAYIE 758
           +++M+ L++NV+D  +R  L + +A +E
Sbjct: 84  LMRMRNLLLNVQDEHIRNVLASIVARVE 111



 Score = 36.3 bits (80), Expect = 0.91
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +1

Query: 430 NRKYESVQSYLFNNRNNKIDAHQFFE 507
           +R+Y+SV+SYL NN +N IDA  FF+
Sbjct: 2   DRQYQSVKSYLNNNAHNAIDADAFFQ 27


>UniRef50_O10270 Cluster: 61 kDa protein homolog; n=1; Orgyia
           pseudotsugata MNPV|Rep: 61 kDa protein homolog - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 474

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query: 522 EAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEV-SRYYNAVVKMKRLV 698
           EA  +  ++ D  V LNR   L++LK A D++ + AYM  D  E  SR++  + +M+ L+
Sbjct: 34  EAHSVGRNVGDRAVRLNRQAVLDLLKLAEDIYADTAYMQADQPEASSRHFATLNRMRLLL 93

Query: 699 INVRDPSLRQSLYNTIAYIE 758
           I V+DP  R++L + +A IE
Sbjct: 94  IGVQDPDARRNLNSVLARIE 113



 Score = 33.5 bits (73), Expect = 6.4
 Identities = 14/28 (50%), Positives = 20/28 (71%)
 Frame = +1

Query: 424 MTNRKYESVQSYLFNNRNNKIDAHQFFE 507
           M  R+Y+SV+SYL NN++N I A  F +
Sbjct: 1   MMERQYQSVRSYLINNQHNAIAAGPFLQ 28


>UniRef50_A0DZ43 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 475

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 28/70 (40%), Positives = 40/70 (57%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +KIY      ++  IV +Y+   +L E L  K EL  Q ++N I+Q+ EALN  H
Sbjct: 89  DHPNIVKIYELFQDSSHFYIVYEYLSGGELLELLNKKKELKEQQIANYIKQVLEALNHCH 148

Query: 31  KHNFIHNDIK 2
               +H D+K
Sbjct: 149 TCGIVHKDVK 158


>UniRef50_Q6QXC2 Cluster: ORF3; n=7; Granulovirus|Rep: ORF3 -
           Agrotis segetum granulosis virus (AsGV) (Agrotis
           segetumgranulovirus)
          Length = 384

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 36/116 (31%), Positives = 60/116 (51%), Gaps = 3/116 (2%)
 Frame = -3

Query: 340 NNQRAFWQNIYFIAQAH*QIVFAENNFGAN-FNVDEIKVHQLMNDHPNFIKIYFNHGFIN 164
           N+    ++NIY + +     ++ +       FN  E+ VH +M  + +FI ++    F+ 
Sbjct: 127 NSDDESYENIYLLKKKDTNQMYVQKTASRKKFNFLELYVHDIMRGNSHFISLH-TAVFLP 185

Query: 163 NQVI-VMDYIDCPDLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + +  VMDYI   DL++ ++  + +        II QL  ALN+LHK   IHNDIK
Sbjct: 186 DSIFWVMDYIKDGDLYDLVKNSRYKFDETKCRKIILQLVNALNELHKKKIIHNDIK 241


>UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea
           nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea
           nuclear polyhedrosis virus (HcNPV)
          Length = 539

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 27/79 (34%), Positives = 52/79 (65%)
 Frame = +3

Query: 522 EAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNAVVKMKRLVI 701
           EA  +K  + D T+ L+R   LN+LK A +++ + AYM+VD  + SR+   + +M++L+I
Sbjct: 34  EAHDLKRCLNDLTIRLDRTAVLNLLKLAENIYTDVAYMHVDRVDASRHSATLGRMRQLMI 93

Query: 702 NVRDPSLRQSLYNTIAYIE 758
            V+D ++R++L + +  +E
Sbjct: 94  TVQDLNVRRNLNDILTRLE 112


>UniRef50_Q54SJ5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 312

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 25/79 (31%), Positives = 46/79 (58%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + + DHPN +K+Y  +    +  +V++ +   +LF+ +  +GE S Q  S I+RQ
Sbjct: 82  EIEIMKKVGDHPNILKLYEVYETTKHLHLVLELVTGGELFDKIVQRGEYSEQDASKIVRQ 141

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH +   H D+K
Sbjct: 142 IVSAVGHLHANGIAHRDLK 160


>UniRef50_A0DYF2 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 378

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL--QIKGELSHQLVSNI 68
           +EIK+   M DHPN +K+Y      +  V++++Y    +LF+ L  Q K + + Q VS  
Sbjct: 150 NEIKLQGYM-DHPNILKLYGYFQEWSKVVLILEYATDGELFKLLKKQPKKKFTEQTVSGY 208

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           IRQ+ E +  +H  N IH DIK
Sbjct: 209 IRQIIEGIGYMHSKNIIHRDIK 230


>UniRef50_Q23JM1 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 600

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           Q V +E+NF       EI++ Q +N HPN +K+++     NN  + ++Y    DL + L+
Sbjct: 47  QKVASESNF-IKLLRREIEILQKIN-HPNIVKLHYATRTTNNLYMFLEYCADGDLKKLLE 104

Query: 106 IKG-ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            +G +L         RQ+CE   +L+K+N IH DIK
Sbjct: 105 KRGGKLPESEAVQYFRQICEGFKELYKNNIIHRDIK 140


>UniRef50_Q172E2 Cluster: Testis-specific serine/threonine kinase
           22c; n=2; Culicidae|Rep: Testis-specific
           serine/threonine kinase 22c - Aedes aegypti (Yellowfever
           mosquito)
          Length = 305

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 29/79 (36%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK   +   HPN + +Y    F     I MDY  C DL + +Q  G+LS      + RQ
Sbjct: 91  EIKT-MIALSHPNIVSVYSVFEFGPYVCIFMDYCRCGDLLQRIQSHGKLSESKARLLFRQ 149

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  +H   F H DIK
Sbjct: 150 LASAVQHMHSRGFCHRDIK 168


>UniRef50_A0E202 Cluster: Chromosome undetermined scaffold_74, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_74,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 587

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 30/94 (31%), Positives = 54/94 (57%)
 Frame = -3

Query: 283 IVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI 104
           + +AE N G    ++EIK+ + + DHPN IK++  H   N+  + ++ ++   L+E L+ 
Sbjct: 197 VAYAEEN-GKEGLMNEIKLMRQL-DHPNIIKLHEVHETSNSLYVCLELLEGGQLYEQLKK 254

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           K   S++ +  II+ L E L  +H  + +H DIK
Sbjct: 255 KVIFSNKEILTIIKGLLEGLKHVHSKDIMHRDIK 288


>UniRef50_Q229U9 Cluster: Protein kinase domain containing protein;
           n=4; Oligohymenophorea|Rep: Protein kinase domain
           containing protein - Tetrahymena thermophila SB210
          Length = 493

 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 25/81 (30%), Positives = 46/81 (56%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++E+++ +L+ DHP+ +KIY  +   NN  I+++     +LF  +  KG  S +  S I+
Sbjct: 93  INEVEILRLL-DHPHILKIYEQYQDNNNYYIILEMCTGGELFAKIIEKGSFSEKEASYIM 151

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q+  A+   H H  +H D+K
Sbjct: 152 NQIVSAVFYAHNHKIVHRDLK 172


>UniRef50_A5E4V7 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1164

 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 21/82 (25%), Positives = 48/82 (58%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           N++++ +H+L   HP  +++Y+     ++   V+D+ +  +L   ++  G LS Q++   
Sbjct: 149 NIEKLTLHRLGQQHPGIVQLYYTFQDESSLFFVLDFAEYGELLSIIRKFGSLSEQVLKFY 208

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           + Q+ +A++ +H  N IH D+K
Sbjct: 209 MCQIIDAVSFIHLKNIIHRDLK 230


>UniRef50_UPI000150A708 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 456

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EIK+ + MN HPN  K+Y  H F + Q +  V++Y +   LF  L+   + S +L     
Sbjct: 120 EIKIQKRMN-HPNICKLY--HYFEDKQYVYLVLEYAEQGSLFHNLRKVKKFSEELAFRFF 176

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q C  ++ LHK++ IH D+K
Sbjct: 177 YQTCLGIDHLHKNSIIHRDLK 197


>UniRef50_A2FDI8 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 407

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 34/103 (33%), Positives = 51/103 (49%)
 Frame = -3

Query: 310 YFIAQAH*QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDC 131
           Y I   + Q+V A+NN        EI++   M DHP  IK++       N  +V+D    
Sbjct: 34  YAIKVINRQLV-AQNNMDKQLR-REIEIMSQM-DHPGLIKLHAVMHSTENIFLVLDLATG 90

Query: 130 PDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            +LF  L   G L  +      +QL +AL+ +HKHN +H D+K
Sbjct: 91  GELFSKLADNGPLPEKKARKYFQQLIDALDYMHKHNAVHRDLK 133


>UniRef50_A0CPP6 Cluster: Chromosome undetermined scaffold_23, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_23,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 458

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           ++EIK+ Q + DHPN +K+Y  +   N   ++ DY +  DL+E L    E+    ++ I+
Sbjct: 55  LNEIKILQQL-DHPNILKLYEFYEDNNEYCLITDYWEGGDLYEYLCKHDEIDEYDMAQIM 113

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL   L+ +H    +H DIK
Sbjct: 114 KQLFSILHYIHSKKIVHRDIK 134


>UniRef50_A0C8T5 Cluster: Chromosome undetermined scaffold_159,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_159,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 418

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIV-MDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           +H N +K Y  +   N QVIV M+Y++  DL +  Q KG+L  +      RQ+C+A+   
Sbjct: 149 NHKNIVKFYNCYPLSNMQVIVVMEYLEGGDLSKYTQAKGQLCEEEARMYFRQICDAMMYC 208

Query: 34  HKHNFIHNDIK 2
           H    IH D+K
Sbjct: 209 HNRKLIHRDLK 219


>UniRef50_A5IY01 Cluster: Serine/threonine-protein kinase; n=1;
           Mycoplasma agalactiae|Rep: Serine/threonine-protein
           kinase - Mycoplasma agalactiae
          Length = 331

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 22/55 (40%), Positives = 35/55 (63%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + Q +VM+Y++   L E ++  G L+     N +RQ+CEA+ +LH +N IH DIK
Sbjct: 88  DEQYLVMEYVEGKSLRELIKKNGVLNPHSSINYVRQICEAMQELHSNNIIHRDIK 142


>UniRef50_Q5CHL8 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium hominis
          Length = 1180

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 33/148 (22%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = -3

Query: 430 SSWPPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVFAENNFGAN 251
           S+  P PP    +  GT    +Q             W  +Y + +    I+ A       
Sbjct: 33  SNQTPKPPIKRDSFVGTSYLPIQNHYKLGEKVGEGSWGAVYIVEERCSGILRAAKKIPKQ 92

Query: 250 FNVDEIKVHQLMN-----DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSH 86
           F+ +  +  Q M      DHPN  K++ +    N+  ++M+     +LF+ L   G  S 
Sbjct: 93  FSGEIFRFRQEMQLLSILDHPNIAKLFESFEDYNSIYLIMELCTGGELFDRLSHVGRFSE 152

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +++I+Q+  A++  H    +H D+K
Sbjct: 153 RVTAHLIKQMLSAISYCHSKGIVHRDLK 180


>UniRef50_A7TL28 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 376

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 5/89 (5%)
 Frame = -3

Query: 253 NFNVD-----EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELS 89
           NFNV      EI +   +N H N  K+Y       N  +VM+Y+   +L++ L+  G ++
Sbjct: 156 NFNVQKQFKREIDIQYHLN-HKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMN 214

Query: 88  HQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
               SN + Q+ +ALN +HK   IH D+K
Sbjct: 215 DITASNYVYQMTDALNYMHKRKIIHRDLK 243


>UniRef50_UPI00006CF367 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 529

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/70 (37%), Positives = 38/70 (54%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IK+Y  +   N   +V + +   +LF+T+   G  S +  + II QL  AL  +H
Sbjct: 137 DHPNIIKLYEVYESDNYIYLVQNVLKGGELFDTIIKNGNFSEKNAAKIIHQLLSALEYIH 196

Query: 31  KHNFIHNDIK 2
             N +H DIK
Sbjct: 197 AKNIMHRDIK 206


>UniRef50_UPI000023D36F Cluster: hypothetical protein FG08701.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG08701.1 - Gibberella zeae PH-1
          Length = 1112

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/79 (31%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +L+ +HP+ +KIY      +   ++++YID  DLF  + +KG LS ++     RQ
Sbjct: 187 EVAILKLI-EHPHIMKIYDIWENRSEVYLILEYIDQGDLFTFINMKGRLSEEVSVYFFRQ 245

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H  N  H D+K
Sbjct: 246 IISAISYCHSFNICHRDLK 264


>UniRef50_A5X6X5 Cluster: Titin a; n=10; Euteleostomi|Rep: Titin a -
             Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 32757

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = -3

Query: 208   HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
             H NF+ ++ +   +   V++ +++   D+FE L I  +L+ Q +   +RQ+C AL  LH 
Sbjct: 30937 HKNFLYLHESFDSLEEYVLIYEFLSGMDIFERLGINFDLTEQEIVQYLRQVCGALKFLHS 30996

Query: 28    HNFIHNDIK 2
              N+ H DI+
Sbjct: 30997 KNYCHFDIR 31005


>UniRef50_Q7R0B9 Cluster: GLP_608_36888_34957; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_608_36888_34957 - Giardia lamblia
           ATCC 50803
          Length = 643

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ +L+N HPN IK+Y       +  IV +Y++  +LF+ +  KG LS +     + Q
Sbjct: 86  EIQILKLLN-HPNVIKLYEIVDTPRHVYIVQEYMNNGELFDYIVAKGRLSEKEACRFLCQ 144

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   L+ LH    +H D+K
Sbjct: 145 LLNGLHFLHSRRIVHRDLK 163


>UniRef50_A5K473 Cluster: Protein kinase domain containing protein;
           n=2; Plasmodium|Rep: Protein kinase domain containing
           protein - Plasmodium vivax
          Length = 1278

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           M  H N +KIY  +    N  ++M+ +   +LF  L  K ++   +   I+ Q+ +A+N 
Sbjct: 322 MKQHKNLMKIYDIYDDDKNFYMIMEKLHGKELFSFLVYKKQVKESVCKYILSQIFQAVNY 381

Query: 37  LHKHNFIHNDIK 2
           LH HN IH DIK
Sbjct: 382 LHHHNIIHRDIK 393


>UniRef50_A2ETF3 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 394

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/80 (32%), Positives = 45/80 (56%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           DEI++ Q ++ HPN ++IY       N  I+M++    +LF+ +  KG+L+      I+ 
Sbjct: 61  DEIRIQQQLH-HPNVVQIYDLLKDEKNFYIMMEFCQGGELFQYIVDKGKLTEDEAKQILD 119

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+ E +  +HK   +H DIK
Sbjct: 120 QILEGIKYIHKMGVVHRDIK 139


>UniRef50_A0E864 Cluster: Chromosome undetermined scaffold_82, whole
           genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_82,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 659

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -3

Query: 232 KVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++H L N DHP+ +K+Y  +   NN  ++ +Y+   +LFE ++     + +  S +IRQ+
Sbjct: 272 EMHILKNLDHPHIVKLYELYQDQNNYYMITEYLSGGELFERIKKMQVFTEKRASELIRQI 331

Query: 55  CEALNDLHKHNFIHNDIK 2
             A+N  H    +H D+K
Sbjct: 332 LLAINYCHDQKIVHRDLK 349


>UniRef50_UPI000049A104 Cluster: protein kinase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 411

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 28/79 (35%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V   +N HPN +K Y +   I N+ IVM++ID  DLF  +     L  + +  I+ +
Sbjct: 179 ECEVMSKLN-HPNIVKYYQSFSGIFNKYIVMEFIDGYDLFHIVFTNNLLKEEFIKKIMFE 237

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  LH    IH D+K
Sbjct: 238 ILTALLYLHSIGIIHRDLK 256


>UniRef50_Q22C11 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 331

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = -3

Query: 283 IVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQ 107
           + F +N         E+ + Q +NDHPN +K+  ++   NN+  +VM+YID  DL + ++
Sbjct: 47  LFFNQNKRSKQIVEREVSIMQDLNDHPNIVKL-IDYQISNNKCSLVMEYIDY-DLKQFIE 104

Query: 106 IK-GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            +   LSH  +  I  QL   L+ +H    IH D+K
Sbjct: 105 SQVYPLSHSKIKRIAFQLLTGLSFIHSKGIIHRDLK 140


>UniRef50_A0DFJ5 Cluster: Chromosome undetermined scaffold_49, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_49,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 564

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 29/80 (36%), Positives = 46/80 (57%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EIK+  L  D+PN +++Y      NN  IV +Y +   L E L+ +  +  + V +I+ 
Sbjct: 64  NEIKI-LLQIDNPNLLRVYEISQSANNTYIVSEYCEGASLEELLK-QEPMKTEKVIDILT 121

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ L  LH+ N IH DIK
Sbjct: 122 QICKGLLGLHQKNIIHRDIK 141


>UniRef50_A0CNU2 Cluster: Chromosome undetermined scaffold_22, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_22,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 529

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/79 (30%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + +  HPN +++Y  +   NN  +V +Y + PDL + L  K  +       +I+Q
Sbjct: 69  EIEIMKKLK-HPNIVELYEVYSTSNNTYLVEEYCNGPDLRQYLSEKRVIEEDQAIKMIKQ 127

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L ++  +NFIH D+K
Sbjct: 128 IANGLKEIVNNNFIHRDLK 146


>UniRef50_A7EIW0 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1254

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +L+  HPN +KIY          +V++Y+D  +LF  +   G LS ++     RQ
Sbjct: 191 EVAIMKLIQ-HPNIMKIYDIWENRTEIYLVLEYVDNGELFAQIANNGRLSEEVAMKYFRQ 249

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  AL   H +N  H D+K
Sbjct: 250 LLSALGYCHSYNICHRDLK 268


>UniRef50_A0BZI1 Cluster: Chromosome undetermined scaffold_139,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_139,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 407

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/79 (34%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +N HPN IK+        N  +V++Y +   LF+ ++ +  LS    S+ + Q
Sbjct: 118 EIKIQRKLN-HPNIIKLDSYFEDKTNVYLVLEYAEGGSLFKQIKKQRHLSEDEASHYLYQ 176

Query: 58  LCEALNDLHKHNFIHNDIK 2
            C  ++ LHK   IH DIK
Sbjct: 177 TCLGIDYLHKQKIIHRDIK 195


>UniRef50_A6LUR9 Cluster: Protein kinase; n=1; Clostridium
           beijerinckii NCIMB 8052|Rep: Protein kinase -
           Clostridium beijerinckii NCIMB 8052
          Length = 495

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 29/69 (42%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + IY      N   IVM+YI+   L + L+    LS     NI  Q+ EAL   HK
Sbjct: 67  HPNIVNIYDIGSENNINFIVMEYINGKTLKQVLRDNVRLSPDTTLNISLQMAEALIYAHK 126

Query: 28  HNFIHNDIK 2
           +N IH DIK
Sbjct: 127 NNIIHRDIK 135


>UniRef50_A0UZ77 Cluster: Serine/threonine protein kinase; n=1;
           Clostridium cellulolyticum H10|Rep: Serine/threonine
           protein kinase - Clostridium cellulolyticum H10
          Length = 627

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 30/90 (33%), Positives = 44/90 (48%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           ++ F   F ++   V  L   HPN + IY      +   IVM+YID   L + L   G L
Sbjct: 48  DDEFVKRFKIEAQAVASL--SHPNVVSIYDVGHQDDIHYIVMEYIDGMTLKDYLNKHGAL 105

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + +    I  Q+C A+   HK+N +H DIK
Sbjct: 106 NWKHAVEITIQICSAIEHAHKNNIVHRDIK 135


>UniRef50_A2FBN5 Cluster: AGC family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 696

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKH 26
           P  +  Y++   +NN  + M+Y+   DL+  L+  G L        I+Q+ EAL  LH+H
Sbjct: 334 PYVVSFYYSITGVNNLYLFMEYLPGGDLYSLLEQVGALDESSARFYIKQIIEALQFLHEH 393

Query: 25  NFIHNDIK 2
             IH D+K
Sbjct: 394 GIIHRDLK 401


>UniRef50_A2EJX1 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 334

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIY---FNHGFINNQVIVMDYIDCPDLFETLQIK 101
           + N    +   E+++H  + DHPN +KI+   +   FI    I+M+Y    D+FE +Q  
Sbjct: 60  DTNENMKYLESELRLHSEL-DHPNIVKIFDVLYEEEFI---AIIMEYCSNGDMFEHIQCH 115

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              +      I  QL +ALN +HK    H DIK
Sbjct: 116 TMFTFTEQLEIANQLIDALNYMHKKGIYHRDIK 148


>UniRef50_A2EIG6 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 322

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EI++H+++  HP  +++Y       N  ++M+Y+D   L + +   G  +    +NI  
Sbjct: 58  NEIEIHKVLR-HPFIVQLYDVIETPENFYLIMEYVDGCSLIDDVNTNGLYTESEAANIFA 116

Query: 61  QLCEALNDLH-KHNFIHNDIK 2
           Q+  AL  LH KHN IH D+K
Sbjct: 117 QIIIALEYLHSKHNLIHRDLK 137


>UniRef50_A0DXN2 Cluster: Chromosome undetermined scaffold_69, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_69,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 890

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVI-VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           H N +KI   +   N QV+ +M+++   DL E LQ KG LS Q    I RQ+ EA+   H
Sbjct: 157 HNNIVKILNCYTLPNMQVVLIMEFLQGGDLVEYLQEKGGLSEQEARIIFRQIAEAIRYCH 216

Query: 31  KHNFIHNDIK 2
               IH D+K
Sbjct: 217 DKRLIHRDLK 226


>UniRef50_UPI000155C283 Cluster: PREDICTED: similar to
           calmodulin-domain protein kinase, putative; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           calmodulin-domain protein kinase, putative -
           Ornithorhynchus anatinus
          Length = 267

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 3/96 (3%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEI-KVHQLMN--DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL 110
           V A+N+     N D I K   L+   DHPN +KIY       N  +V +  +  +LF+ +
Sbjct: 88  VIAKNSVKRKSNYDSILKEVSLLKTLDHPNIMKIYEFLDDAKNFYLVTELYNGGELFDEI 147

Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             +   S    + +I+QL   ++ +HKH+ +H DIK
Sbjct: 148 VNRKRFSEMDAAAVIKQLLSGISYMHKHDVVHRDIK 183


>UniRef50_UPI000150A7D8 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 1225

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV--IVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           E++VH L+  HPN I+  ++  F  N+   IV+DY    +L+  L  K   S +      
Sbjct: 80  EVRVHSLLK-HPNIIE--YHDSFQENEFVFIVLDYASNGNLYSLLYKKRSFSEKEAYKYF 136

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q CEA+  LH  N +H D+K
Sbjct: 137 SQTCEAIKYLHSINIVHRDLK 157


>UniRef50_Q7RKS7 Cluster: Protein kinase domain, putative; n=1;
           Plasmodium yoelii yoelii|Rep: Protein kinase domain,
           putative - Plasmodium yoelii yoelii
          Length = 519

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 24/72 (33%), Positives = 40/72 (55%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++ H N +KIY  +    N  ++M+ +   +LF  L  K ++   +   I+ Q+ +A+N 
Sbjct: 219 ISQHKNLMKIYDIYDDGKNFYLIMEKLRGKELFSFLIYKKQIKENVCKYILMQILQAVNY 278

Query: 37  LHKHNFIHNDIK 2
           LH HN IH DIK
Sbjct: 279 LHYHNIIHRDIK 290


>UniRef50_A2DBY9 Cluster: CAMK family protein kinase; n=2;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 488

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 25/79 (31%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ DHP+ +K+   +  + +  I+++Y    +LF+ L  +G  S ++ + + RQ
Sbjct: 60  EISIMRLL-DHPHLLKLVDVYESVRHLYIILEYAAHGELFDFLVERGSFSVEMATYLFRQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   L  LH H   H DIK
Sbjct: 119 LIYGLEFLHIHQICHRDIK 137


>UniRef50_A0BEW1 Cluster: Chromosome undetermined scaffold_103,
           whole genome shotgun sequence; n=8; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_103,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 583

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 27/105 (25%), Positives = 53/105 (50%)
 Frame = -3

Query: 316 NIYFIAQAH*QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYI 137
           N  +  +A  +    + + G    ++E+KV + +N HPN +K++  H   N+   V+D +
Sbjct: 161 NTQYAIKAFSKSFMQQQHKGIESLLNEMKVMRKLN-HPNIVKLHEVHETANSVYFVVDIV 219

Query: 136 DCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              +L + ++  G L  + +  +   L  ALN +H+ N  H D+K
Sbjct: 220 AGGELLQRVRETGFLPAETLQRLAYNLLSALNHMHQFNIAHRDLK 264


>UniRef50_P38991 Cluster: Spindle assembly checkpoint kinase; n=5;
           Saccharomycetales|Rep: Spindle assembly checkpoint
           kinase - Saccharomyces cerevisiae (Baker's yeast)
          Length = 367

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 25/79 (31%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   +N HPN  K Y          ++M+Y+   ++++ L++ G  +  L S+ I Q
Sbjct: 152 EVEIQTSLN-HPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQ 210

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+ +HK N IH DIK
Sbjct: 211 IANALDYMHKKNIIHRDIK 229


>UniRef50_UPI00006CB302 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 842

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           N  + E+K+ + M  HPN +K   ++   N  +I+M+Y +  DL + ++ K     Q+  
Sbjct: 56  NNAIQELKLLREMK-HPNIVKFIESYKEKNKVIIIMEYCEYGDLSQLIKQKSAKGEQIEE 114

Query: 73  NIIR----QLCEALNDLHKHNFIHNDIK 2
           +II     Q+C AL+ +H    IH DIK
Sbjct: 115 SIILQWFIQICSALSFIHSKKVIHRDIK 142


>UniRef50_UPI0000D8B5E1 Cluster: Unc-51 like kinase 2 (C. elegans);
           n=4; Eutheria|Rep: Unc-51 like kinase 2 (C. elegans) -
           Mus musculus
          Length = 1062

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +  H N + +Y      N+  +VM+Y +  DL + LQ KG LS   +   + Q
Sbjct: 56  EIKILKELQ-HENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQ 114

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH    IH D+K
Sbjct: 115 IAAAMRILHSKGIIHRDLK 133


>UniRef50_Q7UFG3 Cluster: Probable serine/threonine-protein kinase
           pknH; n=1; Pirellula sp.|Rep: Probable
           serine/threonine-protein kinase pknH - Rhodopirellula
           baltica
          Length = 364

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVI-VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN I  YF  G  + Q+  VM+ +D   + + L+  G L+  +V ++ RQ+C AL   H
Sbjct: 78  HPNIIG-YFGGGSEDGQLFYVMERVDGGTIKDLLETNGALAWPVVVDVARQVCSALQCAH 136

Query: 31  KHNFIHNDIK 2
            H  IH D+K
Sbjct: 137 NHGVIHRDLK 146


>UniRef50_A7S1C2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 502

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 22/80 (27%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           DEI + +    HPN ++++ ++       +VM+ I   DLF+ +    + +  +  +  R
Sbjct: 291 DEIAIMRRCR-HPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFR 349

Query: 61  QLCEALNDLHKHNFIHNDIK 2
            +C+AL  LHK   +H D+K
Sbjct: 350 DMCKALAYLHKRKIVHRDLK 369


>UniRef50_A2FCK2 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 339

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ +++ DHP  +  Y          IVM+Y+    LFE +   G+LS Q+ +NI  Q
Sbjct: 61  EIQIMKML-DHPLTVDFYDAFSDDERTYIVMEYLPRGSLFEYILQNGKLSEQISNNIFTQ 119

Query: 58  LCEALNDLHKH-NFIHNDIK 2
           L  A++ LH   + +H DIK
Sbjct: 120 LISAIDYLHNELHIVHRDIK 139


>UniRef50_A0E004 Cluster: Chromosome undetermined scaffold_70, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_70,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 599

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 22/70 (31%), Positives = 39/70 (55%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K++  +   NN  +V +Y+   +L E ++I    +  + +N IRQ+  A    H
Sbjct: 216 DHPNILKLFELYQDTNNYYLVTEYLSGGELLERIKIMTCFTENVAANYIRQILLATLYCH 275

Query: 31  KHNFIHNDIK 2
           + N +H D+K
Sbjct: 276 EKNIVHRDLK 285


>UniRef50_A0CVZ3 Cluster: Chromosome undetermined scaffold_3, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_3,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 428

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 27/79 (34%), Positives = 47/79 (59%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + +N H   +K+Y ++  INN  IV +Y +  D+   ++ KG+++  LV   + Q
Sbjct: 61  EIEILEQLN-HQYIVKMYAHYETINNFYIVSEYCET-DILSIIKQKGKINEDLVIMYVLQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EAL  L++   IH DIK
Sbjct: 119 IAEALLYLNQKQIIHRDIK 137


>UniRef50_A0BIN8 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 524

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 25/93 (26%), Positives = 52/93 (55%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK 101
           V+ E N G    ++EI++ +++ DHPN +K+Y  +   N+  + ++ ++   L+   + K
Sbjct: 174 VYKEEN-GKEGLINEIQIMRIL-DHPNLMKLYEVYETKNSIYMCLELLEGDQLYGLFKTK 231

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              + Q + +I++ L E LN +H    +H D+K
Sbjct: 232 RSFTAQQIHSIMKGLLEGLNYMHNKGIMHRDLK 264


>UniRef50_Q4X028 Cluster: Protein kinase, putative; n=6;
           Trichocomaceae|Rep: Protein kinase, putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 1028

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = -3

Query: 223 QLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCE 50
           ++M D  HPN ++   +H       I+M+Y+   +L   L I G++   +V  + RQL  
Sbjct: 290 KIMKDLKHPNIVQYIDHHEHDRWIYIIMEYVPGGELSTYLSIHGKIPEDMVKTLARQLLH 349

Query: 49  ALNDLHKHNFIHNDIK 2
           AL  LHK    H DIK
Sbjct: 350 ALQYLHKRRITHRDIK 365


>UniRef50_Q8IYT8 Cluster: Serine/threonine-protein kinase ULK2;
           n=17; Euteleostomi|Rep: Serine/threonine-protein kinase
           ULK2 - Homo sapiens (Human)
          Length = 1036

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +  H N + +Y      N+  +VM+Y +  DL + LQ KG LS   +   + Q
Sbjct: 56  EIKILKELQ-HENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQ 114

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH    IH D+K
Sbjct: 115 IAAAMRILHSKGIIHRDLK 133


>UniRef50_UPI0000F1F5BA Cluster: PREDICTED: similar to novel kinase
           domain containing protein; n=2; Danio rerio|Rep:
           PREDICTED: similar to novel kinase domain containing
           protein - Danio rerio
          Length = 704

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 26/77 (33%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = -3

Query: 223 QLMN--DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLC 53
           Q+MN  DH N I++Y  +   N+ ++V++Y+D  +LF+ +  +  +L+       IRQ+C
Sbjct: 467 QVMNQLDHANLIQLYAAYESRNDIILVLEYVDGGELFDRIIDENYKLTELDTVMFIRQIC 526

Query: 52  EALNDLHKHNFIHNDIK 2
           E L  +HK   +H D+K
Sbjct: 527 EGLRYMHKMYILHLDLK 543


>UniRef50_Q2SDA3 Cluster: Serine/threonine protein kinase; n=1;
           Hahella chejuensis KCTC 2396|Rep: Serine/threonine
           protein kinase - Hahella chejuensis (strain KCTC 2396)
          Length = 734

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 29/81 (35%), Positives = 45/81 (55%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + E ++   +N HPN I+IY    F +   I M++++   L E ++  G L+    + II
Sbjct: 63  IQEAQITAKLN-HPNIIQIYDIAPFEDTFFISMEFMEGGSLTERIR-SGRLTRDESTRII 120

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            QL EA+N  HK  +IH DIK
Sbjct: 121 LQLAEAMNYAHKLGYIHRDIK 141


>UniRef50_Q21DN0 Cluster: Protein kinase; n=1; Saccharophagus
           degradans 2-40|Rep: Protein kinase - Saccharophagus
           degradans (strain 2-40 / ATCC 43961 / DSM 17024)
          Length = 700

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 26/90 (28%), Positives = 49/90 (54%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           + + G N+  +EI++ + +  H N ++I+    + N   I M++I   DL + L+IKG  
Sbjct: 469 DQHTGINYK-EEIRLARQIT-HRNILRIFDFGAWKNYYYITMEFISGYDLSDLLRIKGAF 526

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              +   + +Q+C A+N  H+   IH D+K
Sbjct: 527 ESNVGVVMAKQICSAMNAAHEQGIIHRDLK 556


>UniRef50_A0E4D4 Cluster: Chromosome undetermined scaffold_78, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_78,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 362

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALN 41
           DH N +KI   F+    N + ++M+Y D  +L   L Q  G LS  +   +++QL  ALN
Sbjct: 66  DHQNIVKIIEMFHDASQNREYLIMEYCDSQNLKSFLYQSGGVLSENVAKIVLQQLLTALN 125

Query: 40  DLHKHNFIHNDIK 2
           +L K  ++H DIK
Sbjct: 126 ELIKKEYLHRDIK 138


>UniRef50_A0D2H1 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 674

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 21/70 (30%), Positives = 43/70 (61%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH N +K+Y      +  +++M+Y     L+  ++ K + + +  + I++QLC+AL ++H
Sbjct: 302 DHQNIMKLYEVIQEKDKLILIMEYCAGGTLYSYVKQKVKFNDKHYAYILKQLCDALYEMH 361

Query: 31  KHNFIHNDIK 2
           + NF+H D+K
Sbjct: 362 RLNFVHRDLK 371


>UniRef50_A0BR89 Cluster: Chromosome undetermined scaffold_122,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_122,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1232

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 26/79 (32%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+H+ + DHP+ +K+Y +     N  +V++Y+   +LF  L+ +  L  Q       Q
Sbjct: 67  EIKLHRKL-DHPHIVKLYHSLEDDTNVYLVLEYVPMGNLFVYLRKRKNLEEQEAFVYFLQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
              A++ LHK   IH D+K
Sbjct: 126 TALAIDYLHKKGIIHRDLK 144


>UniRef50_A7TRN0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 1552

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 27/92 (29%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = -3

Query: 271 ENNFGAN-FNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG 98
           EN+ G N + ++ EI + +L++ HPN + +Y      N   +V++Y+D  +LF+ L  KG
Sbjct: 172 ENSGGGNPYGIEREIVIMKLLS-HPNVMALYEVWENNNELYLVLEYVDGGELFDYLVSKG 230

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +L+     +  +Q+   ++  H  N  H D+K
Sbjct: 231 KLTESEAVHYFKQIINGISYCHSFNICHRDLK 262


>UniRef50_UPI00015562C7 Cluster: PREDICTED: similar to MLCK protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           similar to MLCK protein, partial - Ornithorhynchus
           anatinus
          Length = 729

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNII 65
           +EI +   ++ H N I++Y      NN  +VM+Y+D  +LF+ +   K  L+   V    
Sbjct: 469 NEINIMNQLS-HVNLIQLYDAFESKNNFTLVMEYVDGGELFDRITDEKYHLTELDVILFT 527

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+CE ++ LH+H  +H D+K
Sbjct: 528 RQICEGIHYLHQHYILHLDLK 548


>UniRef50_Q5EUF6 Cluster: Cyclin-dependent kinase-activating kinase;
           n=1; Prosthecobacter dejongeii|Rep: Cyclin-dependent
           kinase-activating kinase - Prosthecobacter dejongeii
          Length = 242

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HP+ + IY F      +  IVM+Y++   L + ++ K  LS      +I Q+CEAL   H
Sbjct: 7   HPHIVAIYDFGRNASGHLFIVMEYVEGTSLLDLMK-KQPLSLSKTLEVITQVCEALQFAH 65

Query: 31  KHNFIHNDIK 2
            H  IH DIK
Sbjct: 66  DHGVIHRDIK 75


>UniRef50_Q7R9H7 Cluster: Serine/threonine-protein kinase; n=3;
           Plasmodium (Vinckeia)|Rep: Serine/threonine-protein
           kinase - Plasmodium yoelii yoelii
          Length = 996

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+H+ + DH +  + Y  H   NN  ++++Y+   DL   +     ++  +   I+ Q
Sbjct: 549 EIKIHKKI-DHNHICRFYEVHENKNNIYMILEYLGNGDLLTYICKNSNINENIGKRILYQ 607

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LHK N +H D+K
Sbjct: 608 LISAIEYLHKINIVHRDLK 626


>UniRef50_Q6BFD3 Cluster: Calcium-dependent protein kinase,
           putative; n=4; Paramecium tetraurelia|Rep:
           Calcium-dependent protein kinase, putative - Paramecium
           tetraurelia
          Length = 539

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN I++Y  +  +     VM+Y    +LFE +  KG  S +  S +++QL  A++ +H
Sbjct: 90  DHPNIIRVYETYEDMRYYHFVMEYCRGGELFERIVRKGVFSERKCSILMKQLFSAVHYMH 149

Query: 31  KHNFIHNDIK 2
           +    H D+K
Sbjct: 150 QQGVTHRDLK 159


>UniRef50_Q552E9 Cluster: Protein serine/threonine kinase; n=4;
            Dictyostelium discoideum|Rep: Protein serine/threonine
            kinase - Dictyostelium discoideum AX4
          Length = 1367

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244  VDEIKVHQLM---NDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
            +D +KV + +     +P  +K+Y++        +VM+Y+   D F  LQ+ G +   +  
Sbjct: 852  LDHVKVERNILAYTSNPFVVKMYYSFQTKEYYYLVMEYLQGGDCFSLLQMLGSMDENMAK 911

Query: 73   NIIRQLCEALNDLHKHNFIHNDIK 2
             II +   AL  LH H  +H D+K
Sbjct: 912  MIIAETVLALEYLHSHGIVHRDVK 935


>UniRef50_Q22CZ0 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 492

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 23/80 (28%), Positives = 43/80 (53%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EI++   + DHPN I++Y  +    N  +V++Y +  +LF+ +  +G  + Q    + R
Sbjct: 74  NEIEIMSTL-DHPNIIRLYETYEDQKNIYLVIEYCEGGELFDRIAERGYYTEQDAVALFR 132

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+N  H     H D+K
Sbjct: 133 QIMSAINYCHSRKICHRDLK 152


>UniRef50_A0EHT5 Cluster: Chromosome undetermined scaffold_98, whole
           genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_98,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 583

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/93 (27%), Positives = 54/93 (58%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK 101
           V+AE N G    ++EI + + + DHPN +K+Y  +   N+  + ++ +    L++ ++ K
Sbjct: 190 VYAEEN-GKEGLINEITIMREL-DHPNIMKLYEVYESQNSLYMGLELLQGGQLYDIIKKK 247

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             L+++ + +I++ L E L  +H  N +H D+K
Sbjct: 248 VILNNKQIQSIMKGLLEGLAHMHSKNIMHRDLK 280


>UniRef50_A0DWU2 Cluster: Chromosome undetermined scaffold_67, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_67,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 455

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + +N HPN  +++      +   ++++Y +   LF+ L+ +G+L+        +Q
Sbjct: 135 EIRIQRKLN-HPNITQLFHYFEDKDKVYLILEYAEHGSLFQLLKRRGKLNENEALKFFKQ 193

Query: 58  LCEALNDLHKHNFIHNDIK 2
            C  ++ LH+ N IH D+K
Sbjct: 194 TCLGIDYLHQQNIIHRDLK 212


>UniRef50_A0DU37 Cluster: Chromosome undetermined scaffold_64, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_64,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 501

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/70 (37%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +KI   +       I+ DY    +LF  +Q K   S    + IIRQL  ALN  H
Sbjct: 120 DHPNILKINEYYSDDRFHYIITDYYSGGELFSKIQEKKTFSEAQAARIIRQLLYALNYCH 179

Query: 31  KHNFIHNDIK 2
            H   H +I+
Sbjct: 180 IHGIAHREIR 189


>UniRef50_A0DN99 Cluster: Chromosome undetermined scaffold_57, whole
           genome shotgun sequence; n=5; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_57, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 506

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IKIY  +    N  IV +     +LF+ +Q +   S +  +  ++Q+  A+N LH
Sbjct: 98  DHPNIIKIYEFYQDHKNIYIVTELCTGGELFDKIQDQQAFSERKAAETMKQVLSAVNYLH 157

Query: 31  KHNFIHNDIK 2
           K   +H D+K
Sbjct: 158 KSKIVHRDLK 167


>UniRef50_A0CJ09 Cluster: Chromosome undetermined scaffold_19, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_19,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 495

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/79 (34%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIKVH L   HPN + +Y +     N  +V++Y +  +L+  +Q +  L  +       Q
Sbjct: 73  EIKVH-LKCHHPNIVNLYDSFIEHGNVYMVLEYAENGNLYNYVQRRKRLDEKEACKYFIQ 131

Query: 58  LCEALNDLHKHNFIHNDIK 2
            C+AL  LH+ N  H DIK
Sbjct: 132 TCKALQYLHEINVFHRDIK 150


>UniRef50_A5E3E1 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1625

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/79 (31%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L++ HPN + +Y      N+  ++++YI+  +LF+ L  KG L      N  +Q
Sbjct: 159 EIIIMKLIS-HPNIMGLYDVWENKNDLYLILEYIEGGELFDYLIKKGRLHESEAVNYFKQ 217

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +N LH+ N  H D+K
Sbjct: 218 IINGINYLHQFNICHRDLK 236


>UniRef50_UPI000155CFAD Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 722

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 23/74 (31%), Positives = 38/74 (51%)
 Frame = -3

Query: 223 QLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEAL 44
           Q M  HPN +++Y      N+  +VM+     DL + +  K +L  + V    RQ+  A+
Sbjct: 118 QQMIKHPNIVQLYETLETENSYYMVMELCLGGDLLDRIYNKQKLEEEEVKKFTRQIVSAV 177

Query: 43  NDLHKHNFIHNDIK 2
             LH+H  +H D+K
Sbjct: 178 EHLHRHGIVHRDLK 191


>UniRef50_UPI00006CB13C Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 529

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/70 (35%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IK Y  +        VM+Y    DLFE +  KG L     + I+++L  A+  +H
Sbjct: 96  DHPNIIKFYETYHDKMYIHFVMEYCPGGDLFEYVANKGPLEEFEAAQIMKKLFSAVAHIH 155

Query: 31  KHNFIHNDIK 2
             N +H D+K
Sbjct: 156 SKNIVHRDLK 165


>UniRef50_A3DCY1 Cluster: Serine/threonine protein kinase; n=1;
           Clostridium thermocellum ATCC 27405|Rep:
           Serine/threonine protein kinase - Clostridium
           thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 703

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINN-QVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN + IY + G  N+   IVM+Y++   L E L   G L  +   NI  Q+C+A+   H
Sbjct: 67  HPNIVSIY-DVGQENDIHYIVMEYVNGQTLKEYLDENGALYWKDAVNIAIQICQAIEHAH 125

Query: 31  KHNFIHNDIK 2
           K++ +H DIK
Sbjct: 126 KNHVVHRDIK 135


>UniRef50_A2G7H1 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 480

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EIK+H+ +N H N +K+Y       NQ I++++    +L +  + KG  S   V   + 
Sbjct: 69  NEIKLHRSLN-HSNIVKLYNTFCDAQNQYIILEHCKGGNLKDKFKQKGRFSESDVKLFLH 127

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q   AL+ +H    +H DIK
Sbjct: 128 QALSALDYIHTCGIVHRDIK 147


>UniRef50_A2E7E2 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 311

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 27/79 (34%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ Q   + P  +  Y  +      VIVM+Y++  +LF+ +  KG  + Q  +NII+Q
Sbjct: 55  EIKI-QKQFESPYIVTFYDMYETKKEIVIVMEYVNGGELFDHIVQKGSFTEQEAANIIQQ 113

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LH+   IH D+K
Sbjct: 114 VLIGLKVLHEKKVIHRDLK 132


>UniRef50_A2DM39 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 476

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 29/88 (32%), Positives = 45/88 (51%)
 Frame = -3

Query: 265 NFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSH 86
           NF A  +  EI++   M DH N +K Y +    NN  I+M+     ++   L  KG LS 
Sbjct: 63  NFKAK-HFAEIEIQSKM-DHKNIVKSYDHFKDENNTYILMELCLKGNVKNYLSRKGALSE 120

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +  + II+ +C  +   H H+ IH D+K
Sbjct: 121 KEAAKIIKSVCSGVKYCHDHHIIHRDLK 148


>UniRef50_A0DMG4 Cluster: Chromosome undetermined scaffold_56, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_56,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 517

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 22/70 (31%), Positives = 39/70 (55%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN I+++  +  +N+   VM+Y    +L + +   G  + ++   I+RQL  A+  LH
Sbjct: 88  DHPNIIRVFEEYEDLNHFYFVMEYCRGGELLQQIIKHGAQTERMTQIIMRQLFSAVGYLH 147

Query: 31  KHNFIHNDIK 2
           +   IH D+K
Sbjct: 148 ERGIIHRDLK 157


>UniRef50_Q3ACF7 Cluster: Putative serine/threonine protein kinase;
           n=1; Carboxydothermus hydrogenoformans Z-2901|Rep:
           Putative serine/threonine protein kinase -
           Carboxydothermus hydrogenoformans (strain Z-2901 / DSM
           6008)
          Length = 764

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDL 35
           +H N +K+Y    F +   ++++ +    L E L+ KG  LS +   NI+ Q+ +AL+ +
Sbjct: 271 NHENIVKLYDTFYFDDKIYLIIELVQGKTLVEYLEEKGGMLSVKKAVNIMIQIAKALSYI 330

Query: 34  HKHNFIHNDIK 2
           H+HN IH D+K
Sbjct: 331 HQHNIIHRDLK 341


>UniRef50_Q4QGB0 Cluster: Mitogen-activated protein kinase kinase 2;
           n=7; Trypanosomatidae|Rep: Mitogen-activated protein
           kinase kinase 2 - Leishmania major
          Length = 1090

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/79 (32%), Positives = 48/79 (60%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I ++ +    ++ V+VM+Y    +L++ L+ + +L  + V  I +Q
Sbjct: 55  EIEILTKLN-HPHIIMLFDSFETDSDFVVVMEYAQ-GELYDILEDEKQLPEKEVQKIAKQ 112

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +ALN LH +  IH D+K
Sbjct: 113 LIQALNYLHSNRIIHRDMK 131


>UniRef50_A2G1W7 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 301

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           N   DEIK   LMN DHPN IKIY      N  V++++Y    DL   ++    L   L 
Sbjct: 56  NSYYDEIK--SLMNLDHPNIIKIYDTFHDENYFVVILEYCSGGDLDNFIRTNKSLRPSLQ 113

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
            +I+ Q+  +L   H     H+DIK
Sbjct: 114 ISIVDQMITSLAFCHSREIAHHDIK 138


>UniRef50_A2ENB4 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 315

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP-DLFETLQIKGELSHQLVS 74
           FN  E++  + + DH N + +Y    F     ++ +Y  CP DL+  L+ KG LS  L+ 
Sbjct: 50  FNRAEVECLKAI-DHVNIMNLYKYFYFDGCVYLLTEY--CPFDLYHLLKEKGSLSEDLLQ 106

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
               Q+  ++   H HN  HNDIK
Sbjct: 107 KYCLQIVSSIKACHDHNIAHNDIK 130


>UniRef50_A0DN84 Cluster: Chromosome undetermined scaffold_57, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_57,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 394

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNII 65
           EIK+  L+N HPN +K+Y      +  V+V++Y     + + L+   E     +L S+ I
Sbjct: 169 EIKIQYLLN-HPNIVKLYTFFQNADEIVLVLEYCPNGQIHKILKGLPECCFPEKLASSYI 227

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+  AL  LH++  IH D+K
Sbjct: 228 RQILSALIYLHRNGIIHRDLK 248


>UniRef50_A0DGC5 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=13; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_5, whole genome shotgun
           sequence - Paramecium tetraurelia
          Length = 582

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/70 (28%), Positives = 39/70 (55%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHP+ +K++  +   NN  +V +Y+   +LF+ ++     S  + ++ IRQ+  A    H
Sbjct: 199 DHPHIVKLFELYQDENNYYLVTEYLSGGELFDRIKKMSSFSESIAADYIRQILLATLYCH 258

Query: 31  KHNFIHNDIK 2
           + N +H D+K
Sbjct: 259 EQNIVHRDLK 268


>UniRef50_A0CBG0 Cluster: Chromosome undetermined scaffold_164,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_164,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 405

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 3/85 (3%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQI-KGELSHQLV 77
           N +E++  +L+  HP+   + FN  +I+  N  + MDY+    L++  ++   +L   ++
Sbjct: 156 NPEELQALKLIQKHPHPNVLGFNSYYIDDLNCYLAMDYLSQGTLYDLQKMYNNKLPMHII 215

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             I++Q+ E LN LH+   IH DIK
Sbjct: 216 QEIMQQILEGLNHLHQLKIIHRDIK 240


>UniRef50_Q6BJ62 Cluster: Similar to CA1375|IPF7158 Candida albicans
           IPF7158 putative serine/threonine kinase; n=1;
           Debaryomyces hansenii|Rep: Similar to CA1375|IPF7158
           Candida albicans IPF7158 putative serine/threonine
           kinase - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 885

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/82 (23%), Positives = 45/82 (54%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           N+++  +H+L   HP  +++Y+     ++   V+D+ +  +L   ++  G LS  ++   
Sbjct: 71  NIEKTTLHRLGQQHPGIVQLYYTFQDESSLFFVLDFAEYGELLSIIRKFGSLSESVLKFY 130

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           + Q+ +A++ +H    IH D+K
Sbjct: 131 MSQILDAVSFIHLKGVIHRDLK 152


>UniRef50_Q5AG71 Cluster: Potential serine/threonine-protein kinase
           Hsl1; n=1; Candida albicans|Rep: Potential
           serine/threonine-protein kinase Hsl1 - Candida albicans
           (Yeast)
          Length = 1462

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L++ HPN + +Y      N+  ++++YI+  +LF+ L  +G+L      N  +Q
Sbjct: 126 EIIIMKLIS-HPNIMGLYDVWENKNDLYLILEYIEGGELFDYLIKRGKLQEYEAINYFKQ 184

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +N LH+ N  H D+K
Sbjct: 185 IINGINYLHQFNICHRDLK 203


>UniRef50_Q8YMI4 Cluster: Serine/threonine kinase; n=1; Nostoc sp.
           PCC 7120|Rep: Serine/threonine kinase - Anabaena sp.
           (strain PCC 7120)
          Length = 452

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           DHP+ +K++     G +    +VM+YID   LFE +Q KG+LS       + Q+ +AL  
Sbjct: 76  DHPHILKVHEVIQEGELFG--VVMEYIDGVTLFEYVQDKGQLSETEALLYVNQIGQALEL 133

Query: 37  LHKHNFIHNDIK 2
           +H+   +H DIK
Sbjct: 134 IHQKQHLHRDIK 145


>UniRef50_Q4C0I8 Cluster: Protein kinase; n=1; Crocosphaera watsonii
           WH 8501|Rep: Protein kinase - Crocosphaera watsonii
          Length = 552

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKH 26
           P  + +Y    F N + I+M+YI+  +L   ++ +GE+S       I Q+ EAL  +H  
Sbjct: 124 PFIVSVYQVTEFDNKEAIIMEYIEGTNLQSIIEERGEISINEALKYILQIGEALKTVHGQ 183

Query: 25  NFIHNDIK 2
           N +H DIK
Sbjct: 184 NLLHRDIK 191


>UniRef50_Q9XTC6 Cluster: MOM-4; n=2; Caenorhabditis|Rep: MOM-4 -
           Caenorhabditis elegans
          Length = 536

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL--VS 74
           + E KV   + +HPN IKIY       N Q +VM+Y+DC  + + L  +  +++ +  V+
Sbjct: 95  IREAKVMWDLRNHPNIIKIYGLYKSPRNGQGVVMEYMDCGSMADLLYDRTHINYTIDHVA 154

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
           + + QL  A++  H ++ +H D+K
Sbjct: 155 SWMFQLSSAVDFFHSNSQVHRDLK 178


>UniRef50_Q8IL57 Cluster: Ser/Thr protein kinase, putative; n=1;
           Plasmodium falciparum 3D7|Rep: Ser/Thr protein kinase,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 2247

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVI-VMDYIDCPDLFETLQIKGELSHQLVSNII 65
           DEIK+  +MN HPN +K   N     +++I +M+Y D  DL   ++ K  L         
Sbjct: 167 DEIKISCMMN-HPNVVKT-LNILETKDKIIQIMEYCDAGDLISYVRNKLYLDEVSAQYFF 224

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ E L  +HK+N  H D+K
Sbjct: 225 RKIVEGLKYMHKNNIAHRDLK 245


>UniRef50_A2F460 Cluster: AGC family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 400

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 24/68 (35%), Positives = 36/68 (52%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKH 26
           P  +K+Y      +N   V+DY +  DL E +   G L+ +  + +  QL EA++ LH  
Sbjct: 68  PFVVKLYGTFKDASNLYFVLDYAEHGDLAEAVNDLGSLNTKATTYVCAQLLEAISTLHAK 127

Query: 25  NFIHNDIK 2
           N IH DIK
Sbjct: 128 NIIHRDIK 135


>UniRef50_A0D467 Cluster: Chromosome undetermined scaffold_37, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_37,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 835

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/69 (37%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +K   ++       IVMDY++  +L E    K  LS Q + +II+QL   L  LH 
Sbjct: 95  HPNLVKYITSYETFEKLYIVMDYVEGSNLTELS--KSNLSEQKIRSIIKQLLIVLTYLHN 152

Query: 28  HNFIHNDIK 2
            +  H DIK
Sbjct: 153 KDITHRDIK 161


>UniRef50_A0C9K2 Cluster: Chromosome undetermined scaffold_16, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_16,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 759

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/80 (32%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EI+V  L+ DHPN +KIY      NN+ ++ +Y +  DL E L    + +      + +
Sbjct: 64  NEIQVLSLI-DHPNLMKIYDTFETKNNRYLICEYCNERDLAEILD-STQFTETQTLEVFQ 121

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+ + +  LH    IH DIK
Sbjct: 122 QIAQGIKALHDKKIIHRDIK 141


>UniRef50_A0BG89 Cluster: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 409

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           H N +K++    F   +  +I+M+Y+D   L + ++ KG +S Q     I+Q+ EAL   
Sbjct: 144 HRNIVKVFQTLYFSKTKECIIIMEYLDGGSLLQLIRNKGTVSEQEAKIYIKQIVEALLFC 203

Query: 34  HKHNFIHNDIK 2
           H   F+H D+K
Sbjct: 204 HSKTFVHRDLK 214


>UniRef50_A3LUT3 Cluster: Aspartic proteinase; n=3;
           Saccharomycetales|Rep: Aspartic proteinase - Pichia
           stipitis (Yeast)
          Length = 861

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 20/82 (24%), Positives = 43/82 (52%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           N+++I +H+L   HP  +++Y+      +   V+D+ +  +L   ++  G LS  +    
Sbjct: 79  NIEKITLHRLGQQHPGIVQLYYTFQDEKSLFFVLDFAEYGELLSIIRKFGSLSEAVSKFY 138

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           + Q+ +A+  +H    IH D+K
Sbjct: 139 MCQIVDAVKFIHSKGVIHRDLK 160


>UniRef50_O15865 Cluster: Calcium-dependent protein kinase 2; n=2;
           Plasmodium falciparum|Rep: Calcium-dependent protein
           kinase 2 - Plasmodium falciparum (isolate K1 / Thailand)
          Length = 513

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 22/79 (27%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + + DHPN +K+Y  +   N   ++M+     +LF+++   G  + +  + I++Q
Sbjct: 117 EIEIMKKL-DHPNIVKLYETYENDNYIYLIMELCSGRELFDSIIENGSFTEKNAATIMKQ 175

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N +H D+K
Sbjct: 176 IFSAIFYLHSLNIVHRDLK 194


>UniRef50_UPI0000499ACB Cluster: protein kinase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 296

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/52 (40%), Positives = 35/52 (67%)
 Frame = -3

Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +++MDY++  +LFE L+ +G LS +    I+ Q+CEA++ LH+    H DIK
Sbjct: 92  LMIMDYVEGGELFEVLKTEGILSLRQNITILTQICEAVSYLHERCICHRDIK 143


>UniRef50_Q2AG11 Cluster: Protein kinase:PASTA:Serine/threonine
           protein kinase, active site; n=1; Halothermothrix orenii
           H 168|Rep: Protein kinase:PASTA:Serine/threonine protein
           kinase, active site - Halothermothrix orenii H 168
          Length = 638

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINN-QVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN + I F+ G  N+   +VM+ +   +L E +Q +G LS Q   +I  Q+C AL+  H
Sbjct: 67  HPNVVNI-FDIGQDNDYHYLVMENVKGRNLKEIIQERGRLSIQEALDIANQICAALSVAH 125

Query: 31  KHNFIHNDIK 2
           ++N +H DIK
Sbjct: 126 ENNVVHCDIK 135


>UniRef50_A6DJV1 Cluster: Serine/threonine kinase; n=1; Lentisphaera
           araneosa HTCC2155|Rep: Serine/threonine kinase -
           Lentisphaera araneosa HTCC2155
          Length = 681

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           HPN I IY ++G     +    M+Y++  DL E +   G ++ + V + ++Q+C +L++ 
Sbjct: 422 HPNTICIY-DYGKTREGLFYYAMEYLEGSDLQEVITKTGPIAPERVIHFVKQICASLHEA 480

Query: 34  HKHNFIHNDIK 2
           H  N IH DIK
Sbjct: 481 HTMNLIHRDIK 491


>UniRef50_A6C619 Cluster: Putative serine/threonine-protein kinase;
           n=1; Planctomyces maris DSM 8797|Rep: Putative
           serine/threonine-protein kinase - Planctomyces maris DSM
           8797
          Length = 718

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 25/70 (35%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K            +VM+Y+   DL   L+ +  LS      I+RQ    L  +H
Sbjct: 191 DHPNIVKATDAGEVDETCFLVMEYLSGHDLKTILKSENRLSITSACYIVRQAANGLQYIH 250

Query: 31  KHNFIHNDIK 2
            HN IH DIK
Sbjct: 251 NHNLIHRDIK 260


>UniRef50_Q16I19 Cluster: Serine/threonine protein kinase lats; n=4;
           Endopterygota|Rep: Serine/threonine protein kinase lats
           - Aedes aegypti (Yellowfever mosquito)
          Length = 973

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++    +N   VMDYI   DL   L  KG     L    I +L  A+  +H
Sbjct: 637 DNEWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKKGIFEEDLARFYIAELTVAIESVH 696

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 697 KMGFIHRDIK 706


>UniRef50_A4HG26 Cluster: Protein kinase, putative; n=3;
           Leishmania|Rep: Protein kinase, putative - Leishmania
           braziliensis
          Length = 299

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = -3

Query: 205 PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKH 26
           P  ++++  +       IVM+Y++C  L++ L  +G L+      + R L   L  LH H
Sbjct: 66  PQLVRVFDVYAEAERVSIVMEYMECGSLYQRLTTRGPLAEAEARAVTRHLLTGLALLHAH 125

Query: 25  NFIHNDIK 2
           N +H DIK
Sbjct: 126 NVMHRDIK 133


>UniRef50_A0CXZ8 Cluster: Chromosome undetermined scaffold_30, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_30,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 343

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 41/136 (30%), Positives = 69/136 (50%), Gaps = 6/136 (4%)
 Frame = -3

Query: 391 NAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQA---H*QIVFAENNFGANFNVDEIKVHQ 221
           N GT  R ++ R     NNQRA   + +FI+++   H  I   E   G   N+       
Sbjct: 53  NEGTFGRVIKVRDVQS-NNQRALKVSYFFISRSLKTHFTIYEKEYQAGQFLNL-----FP 106

Query: 220 LMNDHP---NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCE 50
            + DHP   + +K+Y        Q I+M+ +  P L+E+L IK   + Q + +I++QL  
Sbjct: 107 KLIDHPGRHHILKVYDFFYHKQCQCILMEALG-PSLYESL-IKKRFTQQQIKSIMQQLLN 164

Query: 49  ALNDLHKHNFIHNDIK 2
           A++ +H+  ++H DIK
Sbjct: 165 AIDYMHELQYLHTDIK 180


>UniRef50_A0CRB4 Cluster: Chromosome undetermined scaffold_25, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_25,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 453

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINN--QVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           H N +KIY N  F+ N   V +M+Y++  +L + LQ KG        +  +QL  A++  
Sbjct: 154 HDNIVKIY-NAFFLQNLQTVYIMEYLEGGELLQYLQTKGRFEESEARHYFKQLVSAISYC 212

Query: 34  HKHNFIHNDIK 2
           H+   IH D+K
Sbjct: 213 HQKKIIHRDLK 223


>UniRef50_A0CDF8 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 385

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 25/79 (31%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+VH+   + PN +++Y +    ++  IV++Y++  +LF  +Q    +S Q       Q
Sbjct: 70  EIRVHKKCKN-PNIVQLYDSFYENDSIFIVIEYLENGNLFTHIQKNPPMSEQEACKYFVQ 128

Query: 58  LCEALNDLHKHNFIHNDIK 2
            C AL  +H++N  H DIK
Sbjct: 129 TCLALQYMHQNNIFHRDIK 147


>UniRef50_A0BTJ6 Cluster: Chromosome undetermined scaffold_127,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_127,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 362

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 30/86 (34%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKI---YFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL 80
           FN +E+K  Q +  HP+ IK+   Y N+    +  I+ +YI+   L + L+   ++S + 
Sbjct: 152 FN-NELKALQNLK-HPHIIKLKEFYLNYA---DCYIITNYIEGESLAKFLRYNKKISSKE 206

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           + NI++Q  EAL+ +H++ FIH DIK
Sbjct: 207 IINILKQSFEALSYIHENGFIHRDIK 232


>UniRef50_A5DI47 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 786

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 20/82 (24%), Positives = 44/82 (53%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           N+++  +H+L   HP  +++Y+     ++   V+D+ +  +L   ++  G LS  ++   
Sbjct: 61  NIEKTTLHRLGQQHPGIVQLYYTFQDESSLFFVLDFAEYGELLSIIRKFGSLSEAVLKFY 120

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           + QL +A+  +H    IH D+K
Sbjct: 121 MCQLLDAVKFIHLKGVIHRDLK 142


>UniRef50_A3LNN2 Cluster: Predicted protein; n=4;
           Saccharomycetales|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 512

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 10/95 (10%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMN-----DHPNFIKIYFNHGFINNQ-----VIVMDYIDCPDLFETLQ 107
           +N++ +E K+ Q MN     DHPN ++   ++    NQ      +V++ ++  +LF+ + 
Sbjct: 203 SNWSQEEAKLQQEMNLLLSIDHPNIVRFISHYIEPINQHSVATYLVLEKMNSGELFQRII 262

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            KG+L         +QL   L+ LH++N IH DIK
Sbjct: 263 NKGKLRENETKAFFKQLLSGLSYLHENNIIHRDIK 297


>UniRef50_UPI0000E80D72 Cluster: PREDICTED: similar to myosin light
           chain kinase (MLCK); n=1; Gallus gallus|Rep: PREDICTED:
           similar to myosin light chain kinase (MLCK) - Gallus
           gallus
          Length = 921

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 24/81 (29%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII- 65
           +EI +   +N H N I++Y      NN  ++M+Y+D  +LF+ +  +     +L + +  
Sbjct: 657 NEINIMNQLN-HVNLIQLYDAFEAKNNVTLIMEYLDGGELFDRITDENYNLTELDAILFT 715

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+CE ++ LH+H  +H D+K
Sbjct: 716 KQICEGVHYLHQHYILHLDLK 736


>UniRef50_UPI0000ECB019 Cluster: UPI0000ECB019 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECB019 UniRef100 entry -
           Gallus gallus
          Length = 789

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 24/81 (29%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII- 65
           +EI +   +N H N I++Y      NN  ++M+Y+D  +LF+ +  +     +L + +  
Sbjct: 525 NEINIMNQLN-HVNLIQLYDAFEAKNNVTLIMEYLDGGELFDRITDENYNLTELDAILFT 583

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+CE ++ LH+H  +H D+K
Sbjct: 584 KQICEGVHYLHQHYILHLDLK 604


>UniRef50_Q4S904 Cluster: Chromosome 7 SCAF14703, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 7
           SCAF14703, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 731

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 25/69 (36%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I+++ +       VIV +Y +   L++ L+  G+LS   V  I  QL  AL  LH 
Sbjct: 60  HPNIIQLFDSFETKTEVVIVTEYAE-GQLYQVLEDDGKLSETQVREIACQLASALYYLHS 118

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 119 HRILHRDMK 127


>UniRef50_Q4RSJ0 Cluster: Chromosome 13 SCAF15000, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 13
           SCAF15000, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 642

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           HP+ I IY    F N    VIVM+Y    +L++ +  +  LS +   +  RQ+  A++  
Sbjct: 79  HPHIISIYEGEVFENKDKIVIVMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHHC 138

Query: 34  HKHNFIHNDIK 2
           HK+  +H D+K
Sbjct: 139 HKNGVVHRDLK 149


>UniRef50_Q5FJH8 Cluster: Serine-threonine protein kinase; n=5;
           Lactobacillus|Rep: Serine-threonine protein kinase -
           Lactobacillus acidophilus
          Length = 674

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIY---FNHGFINNQVIVMDYIDCPDLFETLQIK 101
           E+   A F  + +   +L   HPN + +     +HG      +VM+Y+D PDL + ++  
Sbjct: 50  ESQTQARFQREALATSEL--SHPNIVSVLDVGTDHGL---PYMVMEYVDGPDLKDYIREN 104

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             L  + V  I+ Q+  A+   HKHN IH D+K
Sbjct: 105 SPLDLREVIQIMDQILSAVALAHKHNVIHRDLK 137


>UniRef50_Q0LGG5 Cluster: Protein kinase; n=1; Herpetosiphon
           aurantiacus ATCC 23779|Rep: Protein kinase -
           Herpetosiphon aurantiacus ATCC 23779
          Length = 746

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 28/73 (38%), Positives = 35/73 (47%), Gaps = 4/73 (5%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL----QIKGELSHQLVSNIIRQLCEALN 41
           H N ++IY+     N    VM+YID  DL + L         L H  V +I R L  AL+
Sbjct: 70  HENIVQIYYADDTDNLYYFVMEYIDGVDLSKVLAQYTSTNSLLPHSAVMHIARSLASALD 129

Query: 40  DLHKHNFIHNDIK 2
             HK   IH DIK
Sbjct: 130 YAHKKGVIHRDIK 142



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/94 (26%), Positives = 50/94 (53%), Gaps = 4/94 (4%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKG- 98
           + ++   FN +   + QL  +HPN +++Y          +VM+YI+  +L + + Q++  
Sbjct: 359 DQSYAERFNREAQAIAQL--EHPNIVRLYHYGDSYGLLYMVMEYIEGDNLHKVIEQVRTS 416

Query: 97  --ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             E + + +  +IR++C AL+  H    IH D+K
Sbjct: 417 AQEWTPRTLCRMIREVCAALDYAHSKGVIHRDVK 450


>UniRef50_A3ZUK3 Cluster: Probable protein kinase yloP-putative
           serine/threonine protein kinase; n=1; Blastopirellula
           marina DSM 3645|Rep: Probable protein kinase
           yloP-putative serine/threonine protein kinase -
           Blastopirellula marina DSM 3645
          Length = 565

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 26/90 (28%), Positives = 45/90 (50%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           ++++   F+++     QL  DHPN ++ +      +   IVM+Y+   DL   ++ KG L
Sbjct: 115 DSSYLGRFHLEAQAAAQL--DHPNIVRAFDVDNEGDTHYIVMEYVPGCDLQILVREKGPL 172

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             +  +  + Q  EAL   H+   IH DIK
Sbjct: 173 EIETAAEYVAQAAEALEHAHQRGLIHRDIK 202


>UniRef50_Q5CTY5 Cluster: Calcium/calmodulin dependent protein
           kinase with a kinas domain and 4 calmodulin-like EF
           hands; n=3; Cryptosporidium|Rep: Calcium/calmodulin
           dependent protein kinase with a kinas domain and 4
           calmodulin-like EF hands - Cryptosporidium parvum Iowa
           II
          Length = 718

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 19/70 (27%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K+Y  +    N  +VM+     +LF+ +  +G       +N+++Q+   +   H
Sbjct: 254 DHPNIVKLYETYQDKENIYLVMELCSGGELFDRIISQGSFDEIYAANLMKQVLSTICYCH 313

Query: 31  KHNFIHNDIK 2
            H  +H D+K
Sbjct: 314 DHGIVHRDLK 323


>UniRef50_Q235N6 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 541

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 47/83 (56%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           ++++EI++ + + DHP+ +KIY  +   NN  +V++ +   +LF+ +     L  +    
Sbjct: 96  YSLNEIELLRSL-DHPHILKIYEFYEDKNNFYVVLELLKGGELFDKISEGNMLKEKQAQE 154

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I+RQ+  A+   H  N +H D+K
Sbjct: 155 IMRQILSAIIYAHSQNVMHRDLK 177


>UniRef50_Q22N79 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 562

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 25/90 (27%), Positives = 45/90 (50%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           EN    N    EI++ + +   P  I++Y  +   N  +++M+Y +  DL + LQ  G +
Sbjct: 50  ENPTLDNLFAQEIQLQRQLKS-PYIIQLYKVYSVDNYYMLMMEYCEGGDLEKYLQKNGPI 108

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             Q     + Q+   L ++H H+ IH D+K
Sbjct: 109 PEQKAIGFLMQVLAGLREIHSHSIIHRDLK 138


>UniRef50_A3FQM1 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 622

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ---IKG-ELSHQLVSNIIRQLCEAL 44
           DHPN IKI+  +    +  I+M+     +LFE +     KG  LS + V++I+RQ+  AL
Sbjct: 234 DHPNIIKIFEVYEDKEHMYIIMENCGGGELFERIHEAVSKGFRLSERYVAHIMRQIMAAL 293

Query: 43  NDLHKHNFIHNDIK 2
              H  N +H D+K
Sbjct: 294 AYFHSRNIVHKDLK 307


>UniRef50_A0C5Z9 Cluster: Chromosome undetermined scaffold_151,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_151,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 510

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 6/91 (6%)
 Frame = -3

Query: 256 ANFNVDEIKV----HQLMN--DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE 95
           +NFN  ++ V     QL+N  +H N +++ F+    +   I+MD I    L E  Q+  +
Sbjct: 57  SNFNTLQLDVLRKEAQLLNQLNHQNIVRVTFSKETKSKLFIMMDLITGVTL-EQFQLN-K 114

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L  Q V NI++QL +A+  LH  + IH DIK
Sbjct: 115 LDDQTVHNIVKQLLQAIKYLHSKDIIHRDIK 145


>UniRef50_Q2KFW9 Cluster: Putative uncharacterized protein; n=2;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea 70-15
          Length = 1208

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 21/79 (26%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +L+ +HPN +K+Y      N   ++++Y++  DLF+ +   G +  +    + RQ
Sbjct: 184 EVAILKLI-EHPNIVKLYDIWENSNEIYLILEYVERGDLFDFISKHGPMPEEEAIFVFRQ 242

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL   H +   H D+K
Sbjct: 243 IMSALEYCHSYGICHRDLK 261


>UniRef50_UPI0000E801CD Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 591

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/79 (30%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++HQ++  HPN +++Y      N+  +VM+     DL + +  K  L+ + V    RQ
Sbjct: 67  EPRIHQMIK-HPNVVQLYETLETDNSYYMVMELCLGGDLLDRICDKQRLAEREVRRYTRQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH H  +H D+K
Sbjct: 126 ILSAVGYLHCHGIVHRDLK 144


>UniRef50_UPI00006CC887 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 735

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 30/88 (34%), Positives = 42/88 (47%), Gaps = 4/88 (4%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDH----PNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSH 86
           NF   E    + +ND      N IKIY NH   N   I M+Y     L + LQ K +LSH
Sbjct: 53  NFLTQEANCIKKLNDENPNIKNIIKIYSNHQRGNCIYIAMEYCPLGSLEKILQQKQKLSH 112

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             +    +Q+  AL   H+   +H+D+K
Sbjct: 113 YEILIFAKQMISALIYAHRLGLVHSDLK 140


>UniRef50_UPI00006CA70E Cluster: Protein kinase domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
            kinase domain containing protein - Tetrahymena
            thermophila SB210
          Length = 1350

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 23/80 (28%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238  EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIR 62
            EIK+ + + DHPN +K+Y      +N  ++ ++ +  +LF+ +Q   E L+ + +++I++
Sbjct: 929  EIKILKKL-DHPNILKLYEFLEDSDNYYLITEFCEGKELFDVIQDNCENLTEKDIASIVQ 987

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+ ++L   H +  +H DIK
Sbjct: 988  QILQSLAYAHSNKIMHRDIK 1007


>UniRef50_UPI00002495CF Cluster: PREDICTED: similar to NUAK family,
           SNF1-like kinase, 1; n=1; Danio rerio|Rep: PREDICTED:
           similar to NUAK family, SNF1-like kinase, 1 - Danio
           rerio
          Length = 452

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I++Y         V+VM+Y    +L+E +Q K  LS     +  RQ+  A++  H+
Sbjct: 91  HPNIIRLYEVFESRERIVMVMEYASGGELYEYIQDKQRLSEDEARHFFRQITSAVHYCHQ 150

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 151 NGVVHRDLK 159


>UniRef50_Q5EUI0 Cluster: Putative uncharacterized protein; n=1;
           Gemmata sp. Wa1-1|Rep: Putative uncharacterized protein
           - Gemmata sp. Wa1-1
          Length = 659

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           HP+ +++   HG IN  N  I M+YID   L   L  +G+L  + V +  +QL EAL   
Sbjct: 70  HPHIVRL-IAHGKINKSNPYIAMEYIDGEALDRVLSRRGKLGWEEVVSYGKQLAEALQYA 128

Query: 34  HKHNFIHNDIK 2
           H    IH D+K
Sbjct: 129 HNKGIIHRDLK 139


>UniRef50_Q182R7 Cluster: Serine/threonine-protein kinase and
           phosphatase; n=2; Clostridium difficile|Rep:
           Serine/threonine-protein kinase and phosphatase -
           Clostridium difficile (strain 630)
          Length = 669

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +Y          IVM+++D  +L E +Q +G L      +I +Q+  AL+  HK
Sbjct: 67  HPNIVNVYDVGEDGKVHYIVMEFVDGKNLKEIIQDEGILDEYTALDITKQIAMALSAAHK 126

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 127 KGIIHRDIK 135


>UniRef50_Q0LH42 Cluster: Protein kinase; n=1; Herpetosiphon
           aurantiacus ATCC 23779|Rep: Protein kinase -
           Herpetosiphon aurantiacus ATCC 23779
          Length = 602

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/69 (31%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y      +   IVM+Y+   DL E + ++  L       I+RQ+ EAL   H 
Sbjct: 69  HPNIVRVYDIGAEGDLHYIVMEYVQGTDLKEIISLQAPLPVPRTLAIVRQVAEALQAAHD 128

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 129 SGLVHRDVK 137


>UniRef50_A0NJT1 Cluster: Ser/Thr protein kinase; n=2; Oenococcus
           oeni|Rep: Ser/Thr protein kinase - Oenococcus oeni ATCC
           BAA-1163
          Length = 615

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +K+     F   Q + M+Y+D  DL + +     + +  V NI+ Q+  A++  H 
Sbjct: 69  HPNIVKVLDAGSFDGVQYLTMEYVDGMDLKKYISQYYPVPYAQVVNIMEQVLSAVSMAHN 128

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 129 HGIVHRDLK 137


>UniRef50_Q86GD6 Cluster: Projectin; n=1; Procambarus clarkii|Rep:
            Projectin - Procambarus clarkii (Red swamp crayfish)
          Length = 8625

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDLH 32
            HP  I ++      +  V++ +++   +LFE +  +G  +S   V N +RQ+CE +  +H
Sbjct: 7738 HPKLINLHDAFEDDDEMVLIFEFLSGGELFERITAEGYVMSEAEVINYMRQICEGVKHMH 7797

Query: 31   KHNFIHNDIK 2
            + N IH D+K
Sbjct: 7798 EKNIIHLDVK 7807


>UniRef50_Q22DW7 Cluster: Protein kinase domain containing protein;
            n=2; Alveolata|Rep: Protein kinase domain containing
            protein - Tetrahymena thermophila SB210
          Length = 1647

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 238  EIKVHQLMNDHPNFIKIYFNHGFINNQ---VIVMDYIDCPDLFETLQIKG--ELSHQLVS 74
            EIK+   +N HPN +K+   HGF ++     ++++     D+++ ++ +   + + +  +
Sbjct: 1420 EIKIQTYLN-HPNVLKM---HGFFDDSQKIYLILELASHGDIYKEIKREANKKFTEEKAA 1475

Query: 73   NIIRQLCEALNDLHKHNFIHNDIK 2
            N IRQ+CE L  LH    IH DIK
Sbjct: 1476 NYIRQVCEGLIYLHSQGIIHRDIK 1499


>UniRef50_A2FNQ5 Cluster: AGC family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 696

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/73 (32%), Positives = 39/73 (53%)
 Frame = -3

Query: 220 LMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           L N +P  ++IY++    +N  +VMD++   DL+  LQ  G L        I Q+ +AL+
Sbjct: 357 LKNSNPYIVEIYYSIIGKHNLYLVMDFVPGGDLYSLLQNIGTLDEDSSRIYIAQIVQALD 416

Query: 40  DLHKHNFIHNDIK 2
            LH    +H D+K
Sbjct: 417 FLHGKGILHRDLK 429


>UniRef50_A2EXP9 Cluster: STE family protein kinase; n=6;
           Trichomonas vaginalis G3|Rep: STE family protein kinase
           - Trichomonas vaginalis G3
          Length = 449

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           DE ++   M+ HPN IK Y  H   N   I+M+ +D   L   +    ++    ++   R
Sbjct: 214 DETRLMATMS-HPNIIKFYSAHLIENTLWILMELMDGGSL-TNVATYCDVQEPHIAYFAR 271

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           ++ +AL+ +HKHN IH DIK
Sbjct: 272 EVLQALDYMHKHNKIHRDIK 291


>UniRef50_A0DX23 Cluster: Chromosome undetermined scaffold_68, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_68,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 593

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/80 (30%), Positives = 44/80 (55%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +E+ +H  ++ H N + +       +N  ++M+  D  D+++ ++ KG+ + Q +    +
Sbjct: 76  NEVVIHSELH-HKNIVNLIDVFEDADNSYLIMELCD-QDIYQLIK-KGQFNEQQIRFYGK 132

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL E L  LH HN IH DIK
Sbjct: 133 QLAEGLQYLHSHNIIHRDIK 152


>UniRef50_A0BN47 Cluster: Chromosome undetermined scaffold_118,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_118,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 274

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 26/79 (32%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + + DHP+ +K+  +H    N  I+ + +   D F  ++ +  L  + V  I+ +
Sbjct: 47  EIKILKSL-DHPHILKMIDHHP--ENDYIIFEQLTT-DFFTIVKNQNRLDVRAVKQILIE 102

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L EA+  LHK N++H DIK
Sbjct: 103 LGEAIQYLHKFNYVHRDIK 121


>UniRef50_Q2UCX8 Cluster: Serine/threonine protein kinase Chk2 and
           related proteins; n=3; Eurotiomycetidae|Rep:
           Serine/threonine protein kinase Chk2 and related
           proteins - Aspergillus oryzae
          Length = 701

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
 Frame = -3

Query: 223 QLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCE 50
           ++M D  HPN ++   +H       I+M+Y+   +L   LQ  G++   +V  I RQ+  
Sbjct: 289 KIMKDLKHPNIVQYMDHHEHERWIYIIMEYVPGGELSTYLQSTGKIPEDMVKTIARQVLH 348

Query: 49  ALNDLHKHNFIHNDIK 2
           AL  LH     H DIK
Sbjct: 349 ALQYLHTRKITHRDIK 364


>UniRef50_P11730 Cluster: Calcium/calmodulin-dependent protein
           kinase type II gamma chain; n=38; Coelomata|Rep:
           Calcium/calmodulin-dependent protein kinase type II
           gamma chain - Rattus norvegicus (Rat)
          Length = 527

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>UniRef50_Q13555 Cluster: Calcium/calmodulin-dependent protein
           kinase type II gamma chain; n=237; Eumetazoa|Rep:
           Calcium/calmodulin-dependent protein kinase type II
           gamma chain - Homo sapiens (Human)
          Length = 558

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>UniRef50_UPI00006CF2DC Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 842

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK----GELSHQLVSNIIRQLCEAL 44
           DHPN +K        +N+ IVM+YI C  L + ++ +       + Q +S I+  L  AL
Sbjct: 125 DHPNIVKFKKFIELDSNKYIVMEYIGCGTLQQLIEERKAKNNPFNQQEISVIMSHLMSAL 184

Query: 43  NDLHKHNFIHNDIK 2
             +H++N +H DIK
Sbjct: 185 KCMHENNVLHRDIK 198


>UniRef50_UPI00006CDA40 Cluster: Protein kinase domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
            kinase domain containing protein - Tetrahymena
            thermophila SB210
          Length = 2082

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI-- 68
            +EIK+ Q+ ++HPN +K+Y  +       +V +Y    +L++ L+ +       +     
Sbjct: 1854 NEIKI-QIFSNHPNILKLYGFYYDEEFVYLVQEYASHGELYQELKRQPNQRFDEIKGAAY 1912

Query: 67   IRQLCEALNDLHKHNFIHNDIK 2
            +RQ+C+A   LH+++ IH DIK
Sbjct: 1913 MRQICDAFTYLHRYHIIHRDIK 1934


>UniRef50_Q0AXM0 Cluster: Serine/threonine protein kinase; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Serine/threonine protein kinase - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 612

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 24/90 (26%), Positives = 43/90 (47%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           + +F   FN + +   QL   HPN + ++          IVM+Y++   L E L  +  L
Sbjct: 48  DKSFVEKFNTEALSAAQL--SHPNIVNVFDVGQQDQLYYIVMEYVEGKSLKELLDTEAPL 105

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + ++  +I   +C+ ++  H    IH DIK
Sbjct: 106 TVEMAVDIAIGICDGIHHAHSKGIIHRDIK 135


>UniRef50_Q038H6 Cluster: Serine/threonine protein kinase with
           beta-lactam (PASTA) domains; n=2; Lactobacillus|Rep:
           Serine/threonine protein kinase with beta-lactam (PASTA)
           domains - Lactobacillus casei (strain ATCC 334)
          Length = 666

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/69 (31%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + IY        Q +VM+Y+   DL   +     + +Q V +++ Q+  A+   H 
Sbjct: 69  HPNIVSIYDVGESQGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQILSAVQTAHD 128

Query: 28  HNFIHNDIK 2
           HN IH D+K
Sbjct: 129 HNIIHRDLK 137


>UniRef50_Q65ZH3 Cluster: Putative uncharacterized protein; n=4;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 1592

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HPN I+IY      +  ++VM+Y    +L++ +   G L       I RQ
Sbjct: 123 EIRIMSALN-HPNIIQIYEVFENKDKIILVMEYSSGGELYDYVSRCGSLPEAEARRIFRQ 181

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   HKH   H D+K
Sbjct: 182 ITSAVLYCHKHRVAHRDLK 200


>UniRef50_Q4Q1Y6 Cluster: Protein kinase, putative; n=3;
           Leishmania|Rep: Protein kinase, putative - Leishmania
           major
          Length = 793

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 23/79 (29%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +++  HP+  ++Y      ++ V+VM+Y+   +LF+ + +KG L       + +Q
Sbjct: 70  EIKIMRVLR-HPHITRLYDVVKTKHDIVLVMEYVSGGELFDYVTLKGRLEEPTARALFQQ 128

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H++   H DIK
Sbjct: 129 LTAAVAYCHRYRVTHRDIK 147


>UniRef50_Q23T79 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 508

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/83 (26%), Positives = 39/83 (46%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74
           NFN+    ++     HPN IK Y  +    N   + +++D   L + +      S +LV 
Sbjct: 113 NFNITNEIIYLSQLSHPNIIKAYEYYKDSINYYFIFEFVDSGSLIDRIIECDFFSEKLVK 172

Query: 73  NIIRQLCEALNDLHKHNFIHNDI 5
            + +Q+ E L  +H  + +H DI
Sbjct: 173 TVAKQVLEVLAYIHNRHIVHRDI 195


>UniRef50_Q19962 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 333

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 1/87 (1%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ 83
           G  F VD E+++  L+  H + I I       N   IV ++    DL+ET++  G +   
Sbjct: 109 GKCFFVDNEVEMLSLIQ-HDHIISIIDAFSTENQYFIVFEHAQYGDLYETIRKNGRIEEP 167

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
             + I  Q+  ALN LH+ N +H D+K
Sbjct: 168 DAAIITLQVASALNYLHERNVVHRDVK 194


>UniRef50_A2EZI0 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 322

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I IY +    N  V++++Y    +L E ++    +    + N  RQ+ E L+  H+
Sbjct: 71  HPNVINIYDSFSDNNYFVLILEYCPNGNLEEYIKKNSPIKESEILNFARQILEVLSYCHQ 130

Query: 28  HNFIHNDIK 2
           +N  H+DIK
Sbjct: 131 NNICHHDIK 139


>UniRef50_A2DHM8 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 494

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/79 (27%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +L+ DHP+ +K+       ++  IV++Y +  +LF+ L  +G  S ++   + RQ
Sbjct: 59  EVALMRLL-DHPHLLKLIEVLESPHHMYIVLEYAEHGELFDYLVSRGRFSPEVAMKMFRQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++ LH+H   H D+K
Sbjct: 118 IIYGIDYLHQHMICHRDLK 136


>UniRef50_A0BRM8 Cluster: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_123,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 463

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IK+Y     + N  ++M+     +LF+ +   G+LS +    +  Q+  A++  H
Sbjct: 80  DHPNIIKLYETFEDVRNIYLIMELCTGGELFDQIVTHGQLSEKDAQQVFIQIMRAISYCH 139

Query: 31  KHNFIHNDIK 2
                H D+K
Sbjct: 140 SKGIAHRDLK 149


>UniRef50_A0BPA1 Cluster: Chromosome undetermined scaffold_12, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_12,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 767

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 23/72 (31%), Positives = 37/72 (51%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           +  HP  +K+ F     +   +++DY    DL E LQ +  L   +V N + ++  AL D
Sbjct: 506 ITSHPFIVKLRFAFQTQDKLFMILDYCPGGDLGEVLQKQKRLPESIVKNYLCEIVLALED 565

Query: 37  LHKHNFIHNDIK 2
           LHK + I  D+K
Sbjct: 566 LHKRDIIFRDLK 577


>UniRef50_A0BFB3 Cluster: Chromosome undetermined scaffold_103,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_103,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 418

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 25/89 (28%), Positives = 50/89 (56%)
 Frame = -3

Query: 268 NNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELS 89
           +NF     ++EI++H L+N H N +++        +  ++++  +   L   +  K +LS
Sbjct: 161 DNFSEQDIMNEIQIHSLIN-HQNIVRLLGISKTQRHFYLLLELPNGDTLKNYMCKKIKLS 219

Query: 88  HQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            + +  I++QL +A++ LH +N IH DIK
Sbjct: 220 EEEIVGILKQLLQAIDHLHSNNIIHRDIK 248


>UniRef50_Q2UL03 Cluster: Serine/threonine protein kinase; n=2;
           Pezizomycotina|Rep: Serine/threonine protein kinase -
           Aspergillus oryzae
          Length = 475

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ--LV 77
           F   EIK+H + + HPN + +      ++   +V+++    DLF ++  KG   H   LV
Sbjct: 85  FQQREIKLHHMASQHPNVVSLVRIMDSVDCTYVVIEFCPEGDLFSSITEKGNFVHNDPLV 144

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
             +  Q+ +A+   H     H D+K
Sbjct: 145 RRVFLQILDAVQYCHNIGIYHRDLK 169


>UniRef50_Q96GX5 Cluster: Microtubule-associated
           serine/threonine-protein kinase-like; n=36;
           Eumetazoa|Rep: Microtubule-associated
           serine/threonine-protein kinase-like - Homo sapiens
           (Human)
          Length = 879

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>UniRef50_Q7RAH3 Cluster: Calcium-dependent protein kinase 1; n=28;
           Apicomplexa|Rep: Calcium-dependent protein kinase 1 -
           Plasmodium yoelii yoelii
          Length = 535

 Score = 46.4 bits (105), Expect = 9e-04
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IK++          +V ++ +  +LFE +  + +      +NI++Q+   +  LH
Sbjct: 123 DHPNIIKLFDVFEDKKYFYLVTEFYEGGELFEQIINRHKFDECDAANIMKQILSGICYLH 182

Query: 31  KHNFIHNDIK 2
           KHN +H DIK
Sbjct: 183 KHNIVHRDIK 192


>UniRef50_UPI00006CD328 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 649

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           + E K  Q +N HPN +K+Y  F          +M+ ++  ++FE ++  G  S Q+ S 
Sbjct: 97  IREFKNIQKLN-HPNIVKMYELFVDEVKRRIYTIMELVEAREMFEVIRKLGSYSEQIASK 155

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I +Q+ +++  +H     H D+K
Sbjct: 156 IFKQILQSIKYMHDQLVCHRDLK 178


>UniRef50_Q4RFA4 Cluster: Chromosome 8 SCAF15119, whole genome shotgun
            sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 8
            SCAF15119, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1294

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/81 (29%), Positives = 44/81 (54%)
 Frame = -3

Query: 244  VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
            + EI++ Q + DHPN +K+   +   N+ V+V++  D     + +   G L+ + V+  +
Sbjct: 1018 LQEIRLLQTL-DHPNLVKLLDTYEMANSYVLVLEMADQGRFLDYVVSWGNLTEEKVALYL 1076

Query: 64   RQLCEALNDLHKHNFIHNDIK 2
            R++ EAL  LH     H D+K
Sbjct: 1077 REILEALQYLHGWRVAHLDLK 1097


>UniRef50_Q8G5T5 Cluster: Putative uncharacterized protein; n=3;
           Bifidobacterium|Rep: Putative uncharacterized protein -
           Bifidobacterium longum
          Length = 566

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = -3

Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDI 5
           VIV DY+    L +  +  G L+  +   +I Q+CEA+ +LH+H  IH DI
Sbjct: 81  VIVYDYVPGSTLAQIAEENGRLAPNVAVQLIDQICEAVQELHQHGVIHRDI 131


>UniRef50_Q1EW82 Cluster: Protein kinase:PASTA:Serine/threonine
           protein kinase, active site; n=2; Clostridiaceae|Rep:
           Protein kinase:PASTA:Serine/threonine protein kinase,
           active site - Clostridium oremlandii OhILAs
          Length = 651

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +Y      +   IVM+Y++   L E ++ KG+L+   + +  RQ+  AL   H 
Sbjct: 67  HPNIVNVYDVGEEDDIYYIVMEYVNGKTLKEVIKEKGKLNKDEILDFTRQIALALKHAHA 126

Query: 28  HNFIHNDIK 2
           ++ +H DIK
Sbjct: 127 NHVVHRDIK 135


>UniRef50_A4J588 Cluster: Protein kinase; n=2; Peptococcaceae|Rep:
           Protein kinase - Desulfotomaculum reducens MI-1
          Length = 621

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + IY       +  +VM+Y+D   L E ++ +  L+   V  + RQ+ +AL   H+
Sbjct: 67  HPNIVSIYDVGQENESHYLVMEYVDGESLKEMIRREAPLAPFRVIQLGRQIADALEHAHE 126

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 127 NSIIHRDVK 135


>UniRef50_Q23ML0 Cluster: Protein kinase domain containing protein;
           n=3; cellular organisms|Rep: Protein kinase domain
           containing protein - Tetrahymena thermophila SB210
          Length = 1569

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EI++H L   H N +K+  +     N  +VM+Y +  DLF  L+   +LS      I  
Sbjct: 85  NEIEIH-LDLKHKNIVKMIKSFEDSENLYLVMEYCEGGDLFHYLKHHKKLSETEAKRITY 143

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L E L  LH  + IH D+K
Sbjct: 144 KLAEGLKYLHDKSIIHRDLK 163


>UniRef50_Q23FR5 Cluster: Protein kinase domain containing protein;
           n=2; Oligohymenophorea|Rep: Protein kinase domain
           containing protein - Tetrahymena thermophila SB210
          Length = 524

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/80 (31%), Positives = 45/80 (56%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           DEI + + + DHPN IK+Y  +   +   +V +Y +  +LF+ +     L  +  + I+R
Sbjct: 95  DEINILKEL-DHPNIIKLYEVYESESTIYLVTEYCEGGELFQYVVQNKRLQEKDAALIMR 153

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL  A++ +H +  IH D+K
Sbjct: 154 QLFSAVSYIHDNGVIHRDLK 173


>UniRef50_Q22X58 Cluster: Protein kinase domain containing protein;
           n=1; Tetrahymena thermophila SB210|Rep: Protein kinase
           domain containing protein - Tetrahymena thermophila
           SB210
          Length = 643

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI   ++++ HPN +K Y       N  +V++YI+  D+ + +Q     +S ++ + I
Sbjct: 75  LNEINSLKILS-HPNILKFYEYFENQKNIFLVLEYIEGLDMIDFIQKDSTSISEKVAATI 133

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           ++QL EAL   H    +H DIK
Sbjct: 134 MKQLLEALAYTHDKKIVHRDIK 155


>UniRef50_Q179M6 Cluster: Myosin light chain kinase; n=1; Aedes
           aegypti|Rep: Myosin light chain kinase - Aedes aegypti
           (Yellowfever mosquito)
          Length = 390

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQL-MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNII 65
           E +VH + +  HP   ++Y  + F     +VM+ ++  +LF+  L  K  L+ +  S  +
Sbjct: 77  EREVHMMNVLRHPKIAQLYGAYEFDRTFCMVMELVEGGELFDRVLDEKFILTEKACSIFM 136

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+C+A+  +H +N +H D+K
Sbjct: 137 RQICDAIGYIHSNNIVHLDLK 157


>UniRef50_A5DIL0 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 774

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIR 62
           EI +H+++  HPN   +  +     +  ++++Y    DL++ +Q   G  + Q + ++ +
Sbjct: 95  EIGIHKILGPHPNISTLVDSF----DSYLILEYCSRGDLYDAIQAGSGPSTSQDIKDVFQ 150

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  AL   H HN  H D+K
Sbjct: 151 QILNALEFCHSHNVYHRDLK 170


>UniRef50_Q8WZ42 Cluster: Titin; n=65; Eukaryota|Rep: Titin - Homo
             sapiens (Human)
          Length = 34350

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208   HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLH 32
             H N + ++ +   +   V++ ++I   D+FE +     EL+ + + + + Q+CEAL  LH
Sbjct: 32231 HRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEALQFLH 32290

Query: 31    KHNFIHNDIK 2
              HN  H DI+
Sbjct: 32291 SHNIGHFDIR 32300


>UniRef50_UPI0000E47761 Cluster: PREDICTED: similar to
           serine/threonine kinase 36 (fused homolog, Drosophila),
           partial; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to serine/threonine kinase 36 (fused
           homolog, Drosophila), partial - Strongylocentrotus
           purpuratus
          Length = 789

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/79 (35%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ + M+ HPN I++          V V DY +  +LF+ L+  G L  + V  I  Q
Sbjct: 51  EIEIMKEMH-HPNIIEMLDTFETDKEVVAVTDYAE-GELFQILEDDGTLPEEQVKEIACQ 108

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  AL  LH H  +H D+K
Sbjct: 109 LLSALYYLHAHRILHRDMK 127


>UniRef50_UPI00006CF805 Cluster: Protein kinase domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
           kinase domain containing protein - Tetrahymena
           thermophila SB210
          Length = 716

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ--IKGELSHQLVSN 71
           V EIK+   +N HPN ++I        N  ++ ++    DL   ++   +G++S  L   
Sbjct: 100 VSEIKILTRLN-HPNIVRIIDFKKTSQNYYLIFEFCSNGDLENYIKKHYEGKISETLCQQ 158

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           +I Q+ EA  +L KH  +H D+K
Sbjct: 159 VIFQVREAFKELTKHKIVHRDLK 181


>UniRef50_UPI00004990CF Cluster: protein kinase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 446

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/79 (26%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI V + +++HPN +K+Y  +      ++V++Y+   +L++ +  +G  +    S+I+ Q
Sbjct: 197 EIDVMRKLSNHPNVVKLYDVYEDEKTILMVIEYMSGGELYDQIIQRGSFTEADASDIVYQ 256

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  +H +   H D+K
Sbjct: 257 ILSALCYIHSNGIGHRDLK 275


>UniRef50_UPI000069E463 Cluster: Microtubule-associated
           serine/threonine-protein kinase-like (EC 2.7.11.1).;
           n=3; Tetrapoda|Rep: Microtubule-associated
           serine/threonine-protein kinase-like (EC 2.7.11.1). -
           Xenopus tropicalis
          Length = 890

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/72 (27%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  ++M+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNIYLIMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>UniRef50_Q8EGX7 Cluster: Protein kinase, putative; n=1; Shewanella
           oneidensis|Rep: Protein kinase, putative - Shewanella
           oneidensis
          Length = 1376

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQ---VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           +HP  +K+Y +   + NQ    IV +Y++  D+ E +Q +   +H+ V  + +Q+ E L 
Sbjct: 559 EHPYVVKVY-DADVLPNQGPPYIVFEYLEGLDVSELIQQRSLTAHE-VWTMAKQVAEGLQ 616

Query: 40  DLHKHNFIHNDIK 2
            LH+HN  H DIK
Sbjct: 617 HLHEHNIFHCDIK 629


>UniRef50_Q8DGU1 Cluster: Serine/threonine protein kinase; n=1;
           Synechococcus elongatus|Rep: Serine/threonine protein
           kinase - Synechococcus elongatus (Thermosynechococcus
           elongatus)
          Length = 488

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           +HP+ +++   F  G      IVMDYI    L + +Q +G L  +   + IRQ+  AL  
Sbjct: 79  NHPHIVRVSDCFIEG--GRPFIVMDYIPGRTLAQVIQEEGPLPEKTALHYIRQVASALEL 136

Query: 37  LHKHNFIHNDIK 2
           +H+H  +H D+K
Sbjct: 137 VHEHGLLHRDVK 148


>UniRef50_Q4CAD2 Cluster: Protein kinase; n=1; Crocosphaera watsonii
           WH 8501|Rep: Protein kinase - Crocosphaera watsonii
          Length = 356

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/83 (28%), Positives = 44/83 (53%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           F  ++ ++++L  +HP   K+Y      N+  +V ++I+   LF+ +  KG  S   +  
Sbjct: 26  FKREKKRLYEL--NHPQIPKLYAYFEDNNDFYLVQEFIEGDTLFDEVWQKGRFSEGKIKL 83

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
            +R+L   L+ LHK   +H DIK
Sbjct: 84  FLRELLPVLDYLHKQKILHRDIK 106


>UniRef50_Q8MVX2 Cluster: Putative serine/threonine protein kinase;
           n=3; Haemonchus contortus|Rep: Putative serine/threonine
           protein kinase - Haemonchus contortus (Barber pole worm)
          Length = 966

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ + + DHPN +K+Y          +V++Y    ++F+ L   G +  +      RQ
Sbjct: 39  EVKIMKQL-DHPNIVKLYQVMENEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARVKFRQ 97

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH  N IH D+K
Sbjct: 98  IVSAVQYLHSKNIIHRDLK 116


>UniRef50_Q7QSM7 Cluster: GLP_618_5648_4455; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_618_5648_4455 - Giardia lamblia ATCC
           50803
          Length = 397

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 4/83 (4%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKG---ELSHQLVSN 71
           E+K    M +HPN +K+        +   V +YI+  +LF+  +Q +    ++S  +  +
Sbjct: 50  EVKSLIRMKEHPNIVKLMEVVRQKEDLYFVFEYINSGNLFDFVVQQRSAGIKISELVAKD 109

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++RQ+ E L  +H++N++H D+K
Sbjct: 110 LVRQILEGLEHIHRNNYMHRDLK 132


>UniRef50_Q388G0 Cluster: Protein kinase, putative; n=1; Trypanosoma
           brucei|Rep: Protein kinase, putative - Trypanosoma
           brucei
          Length = 1506

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/79 (31%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ Q +N HPN ++   +    NN  IVM+Y D  DL   ++ +G ++   +     Q
Sbjct: 51  ECRMLQKLN-HPNIVRYVEHFENRNNLYIVMEYCDDGDLHGKIK-RGPMNESRILYYYSQ 108

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +C A+  LH  + +H DIK
Sbjct: 109 VCLAMEYLHSRHILHRDIK 127


>UniRef50_A3FPQ1 Cluster: Calcium-dependent protein kinase 7; n=2;
           Cryptosporidium|Rep: Calcium-dependent protein kinase 7
           - Cryptosporidium parvum Iowa II
          Length = 357

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/100 (23%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIY-FNHGFINNQV----IVMDYIDCPDL 122
           +++++ +    +  ++E+++ +L+ DH N + I   N   I+       +V++     DL
Sbjct: 64  KVIYSTDEVSIDRIIEEVEIMKLLKDHQNIVSIIDSNIEHIDEDKYEVKMVLELCKGGDL 123

Query: 121 FETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ +   G +  ++V  I+  L +AL  +HK+  IH D+K
Sbjct: 124 YQYVLANGAMEEKIVQKIMINLLDALKFIHKNGIIHRDLK 163


>UniRef50_A2GE35 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 311

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 1/84 (1%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP-DLFETLQIKGELSHQLVS 74
           FN  EI   + + DH N I +Y  + F +   + M+Y  CP DL + L+   +++ + ++
Sbjct: 50  FNQAEIDCMKTV-DHVNIINLYNYYFFKDYVYLCMEY--CPFDLLKILKRDEDINDETLT 106

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
             I  +  A+N  H+ N  HNDIK
Sbjct: 107 RYIHDILAAINACHEKNVAHNDIK 130


>UniRef50_A2EXT9 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 307

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -3

Query: 232 KVHQLMN-DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQL 56
           +++ L+N +HPN +++Y      N Q IV++Y     L   L+ K ++  + V    R +
Sbjct: 63  EINALINLNHPNIVRVYDQFISDNYQFIVLEYCQNGSLQSILKQKEKIPTESVIKYTRDI 122

Query: 55  CEALNDLHKHNFIHNDIK 2
            EAL  +H + F H DIK
Sbjct: 123 IEALFYMHSNGFAHCDIK 140


>UniRef50_A2ERA7 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 350

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/90 (30%), Positives = 46/90 (51%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           ENN    F   E++  Q +N HPN +++Y      N   ++M+Y    +LF+ +  +  +
Sbjct: 62  ENNLFYRFE-REVRTLQTLN-HPNIVRLYDVVYEDNLIYLIMEYCQHGELFQFIIDQQRV 119

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              L  NI +QL +A+  +H  +  H DIK
Sbjct: 120 PEFLARNIFKQLLDAIAYIHSKSVAHRDIK 149


>UniRef50_A2DTF0 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 399

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/79 (29%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ Q M+ HP  +++       NN  ++M++    +LF+ +  +  LS      + RQ
Sbjct: 63  EIRIAQQMH-HPGIVELCDLLKDDNNYYVIMEFCPNGELFQFIVDRNNLSEDEAKPLFRQ 121

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EAL  +H H   H D+K
Sbjct: 122 ILEALQYVHSHGVSHRDLK 140


>UniRef50_A0CJD7 Cluster: Chromosome undetermined scaffold_2, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_2,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 492

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK 101
           V    N   +    EI + + +N HPN +++      +NN  I+ +Y +  DL   L   
Sbjct: 51  VIDRRNVDFDIQSQEISIMKQLN-HPNIVQLIDFVISVNNLYIITEYCNGTDLKTYLNQH 109

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             LS +    +I+ + + L  + ++NFIH DIK
Sbjct: 110 NPLSEESALKLIKSIIKGLKCIIQNNFIHRDIK 142


>UniRef50_A0CC44 Cluster: Chromosome undetermined scaffold_166,
           whole genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_166,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 405

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/71 (29%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDL 35
           H N +K+Y ++   N Q+ ++M+Y++  +L + L+ KG   S +      RQ+  A++  
Sbjct: 152 HKNIVKVYNSYALKNTQMAVIMEYLEGGELSDRLKQKGGRFSEEEACKYFRQIVCAISYC 211

Query: 34  HKHNFIHNDIK 2
           H+ N +H D+K
Sbjct: 212 HQKNVVHRDLK 222


>UniRef50_A0C060 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 562

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/95 (31%), Positives = 47/95 (49%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           Q V  ++    N  + EI + + + DHPN I++   + F N   +VM+Y     L + +Q
Sbjct: 33  QEVAVKHQIIQNSFLSEISILEKI-DHPNIIRLLKEYKFGNMSYLVMEYCSGGTLKDYIQ 91

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            K  L+   +  I+R L  A+  LH    IH DIK
Sbjct: 92  KK--LTEDEIIGIMRSLLSAVEYLHGQGIIHRDIK 124


>UniRef50_Q5UNT4 Cluster: Putative serine/threonine-protein kinase
           L670; n=1; Acanthamoeba polyphaga mimivirus|Rep:
           Putative serine/threonine-protein kinase L670 -
           Mimivirus
          Length = 539

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = -3

Query: 226 HQLMNDHPNFIKIYFNHGFINNQVIV---MDYIDCPDLFETLQIKGELSHQLVSNIIRQL 56
           + +M DHPN IK+   HG+  +Q I    ++  D P L++ L  KG LS +L  + I QL
Sbjct: 305 NMIMLDHPNIIKM---HGYYYSQGITHIGLELCDMP-LYKKLD-KGNLSPELKKSFIIQL 359

Query: 55  CEALNDLHKHNFIHNDI 5
              L  LH +N IH D+
Sbjct: 360 LCGLKYLHNNNIIHRDL 376


>UniRef50_O34507 Cluster: Serine/threonine-protein kinase prkC;
           n=16; Bacillaceae|Rep: Serine/threonine-protein kinase
           prkC - Bacillus subtilis
          Length = 648

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/70 (32%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN + IY      +   IVM+Y++   L E +   G L  +   NI+ Q+  A+   H
Sbjct: 67  DHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVSAIAHAH 126

Query: 31  KHNFIHNDIK 2
           ++  +H DIK
Sbjct: 127 QNQIVHRDIK 136


>UniRef50_O60285 Cluster: NUAK family SNF1-like kinase 1; n=16;
           Euteleostomi|Rep: NUAK family SNF1-like kinase 1 - Homo
           sapiens (Human)
          Length = 661

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/79 (29%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I IY      +  VI+M+Y    +L++ +  +  LS +   +  RQ
Sbjct: 103 EIEIMSSLN-HPHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  HK+  +H D+K
Sbjct: 162 IVSAVHYCHKNGVVHRDLK 180


>UniRef50_Q9UQB9 Cluster: Serine/threonine-protein kinase 13; n=8;
           Catarrhini|Rep: Serine/threonine-protein kinase 13 -
           Homo sapiens (Human)
          Length = 309

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y          ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 93  EIQAHL---QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 149

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +AL   H    IH DIK
Sbjct: 150 LADALTYCHDKKVIHRDIK 168


>UniRef50_UPI00015B60DA Cluster: PREDICTED: similar to
           calcium/calmodulin dependent protein kinase I; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to
           calcium/calmodulin dependent protein kinase I - Nasonia
           vitripennis
          Length = 443

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/69 (27%), Positives = 40/69 (57%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++       +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 100 HPNIVQLLETFEDKHKVYLVMELVTGGELFDRIVEKGSYTERDASSLIRQVLEAVDYMHE 159

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 160 QGVVHRDLK 168


>UniRef50_UPI00006CC8F2 Cluster: Protein kinase domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
            kinase domain containing protein - Tetrahymena
            thermophila SB210
          Length = 1319

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238  EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYID---CPDLFETLQIKGELSHQLVSNI 68
            E+ +H   ++H N ++            ++++Y     C  L E L ++  L+ Q   NI
Sbjct: 1101 ELNIHSQYSNHENVLECLGYFEDEKYYYLLLEYASDGTCASLIENLPLR-RLTEQQSCNI 1159

Query: 67   IRQLCEALNDLHKHNFIHNDIK 2
            ++Q+ E++N LHK+  IH D+K
Sbjct: 1160 VKQILESVNYLHKNKIIHRDLK 1181


>UniRef50_UPI00006CB12C Cluster: Protein kinase domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: Protein
            kinase domain containing protein - Tetrahymena
            thermophila SB210
          Length = 1318

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = -3

Query: 217  MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
            + +HP  +K+ +     +   ++MDY    DL E LQ + + S +LV   + +   AL D
Sbjct: 1061 LTNHPFIVKLNYAFQTSDKLFLIMDYCPGGDLGEHLQKEKKFSEELVKIYLAETILALED 1120

Query: 37   LHKHNFIHNDIK 2
            LHK + I  D+K
Sbjct: 1121 LHKRDVIFRDLK 1132


>UniRef50_Q4SXH2 Cluster: Chromosome undetermined SCAF12413, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF12413, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 319

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/64 (29%), Positives = 39/64 (60%)
 Frame = -3

Query: 193 KIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIH 14
           K +  H  + N++ V+  +   +LF+ +  +G  + Q  S +I+Q+ EA++ LHK++ +H
Sbjct: 28  KKHLAHSNLENEIRVLRRLSGGELFDRILDRGVYTEQDASKVIKQVLEAVSYLHKNSIVH 87

Query: 13  NDIK 2
            D+K
Sbjct: 88  RDLK 91


>UniRef50_Q4RWR4 Cluster: Chromosome 15 SCAF14981, whole genome
           shotgun sequence; n=5; Clupeocephala|Rep: Chromosome 15
           SCAF14981, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 411

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +Y     +    +VM+Y    DLF  +  +G LS      +  Q+  A+  +H 
Sbjct: 138 HPNVVCLYEMVETLERLYLVMEYASRGDLFSRISTRGRLSDLESKLVFSQVLSAVKHMHD 197

Query: 28  HNFIHNDIK 2
           +N +H D+K
Sbjct: 198 NNIVHRDLK 206


>UniRef50_Q03W19 Cluster: Serine/threonine protein kinase with
           beta-lactam (PASTA) domains; n=1; Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293|Rep:
           Serine/threonine protein kinase with beta-lactam (PASTA)
           domains - Leuconostoc mesenteroides subsp. mesenteroides
           (strain ATCC 8293 /NCDO 523)
          Length = 641

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/83 (28%), Positives = 45/83 (54%)
 Frame = -3

Query: 250 FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSN 71
           F  + + V +L+ND  N +++Y    +  +Q IVM+Y+D  +L   +     +++Q V +
Sbjct: 56  FQREALSVTELIND--NIVQVYDVGEYQGSQYIVMEYVDGTNLKSYIGEHFPIAYQQVVD 113

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I+ Q+  A+   H    IH D+K
Sbjct: 114 IMMQILNAVQAAHNAGIIHRDLK 136


>UniRef50_A7P4N8 Cluster: Chromosome chr4 scaffold_6, whole genome
           shotgun sequence; n=2; Magnoliophyta|Rep: Chromosome
           chr4 scaffold_6, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 445

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++        ++M+Y+   D+   L  +  LS  +    I Q   A+  +HKHN+I
Sbjct: 150 VKLYYSFQDAEYLYLIMEYLPGGDMMTLLMREDTLSESVAKFYIAQSVLAIESIHKHNYI 209

Query: 16  HNDIK 2
           H DIK
Sbjct: 210 HRDIK 214


>UniRef50_Q9TXI1 Cluster: Putative uncharacterized protein F23C8.8;
           n=1; Caenorhabditis elegans|Rep: Putative
           uncharacterized protein F23C8.8 - Caenorhabditis elegans
          Length = 301

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = -3

Query: 157 VIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           VI+ DY +   L E  LQ K    H L + + RQL EA+N LHK   +H D+K
Sbjct: 99  VIISDYYERGTLLEWILQKKRLKEHPLAATLFRQLIEAINYLHKRGIVHRDVK 151


>UniRef50_Q761X1 Cluster: Putative uncharacterized protein; n=1;
           Entamoeba histolytica|Rep: Putative uncharacterized
           protein - Entamoeba histolytica
          Length = 457

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/78 (29%), Positives = 48/78 (61%), Gaps = 4/78 (5%)
 Frame = -3

Query: 223 QLMND--HPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNIIRQL 56
           QLM    H N +K++    + NN+++  +++Y++  +L++ L ++G L+ +  + ++ QL
Sbjct: 215 QLMRQLHHKNIVKLF--DVYENNEILYLILEYVEGGELYDRL-VQGALNERQAACVLYQL 271

Query: 55  CEALNDLHKHNFIHNDIK 2
             A+  LHK+N  H D+K
Sbjct: 272 VSAITYLHKNNIAHRDLK 289


>UniRef50_Q5CHJ7 Cluster: Calcium-dependent protein kinase; n=4;
           Cryptosporidium|Rep: Calcium-dependent protein kinase -
           Cryptosporidium hominis
          Length = 677

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN IK++      N    VM+     +LF+ +  +G  S +  + I+RQ+  A+   H
Sbjct: 238 DHPNIIKLFEVFEDTNYLYFVMEICTGGELFDRIIKRGHFSERYAAVIMRQVFSAIAYCH 297

Query: 31  KHNFIHNDIK 2
            + F+H D+K
Sbjct: 298 SNEFMHRDLK 307


>UniRef50_Q21017 Cluster: Protein kinase protein 29; n=2;
           Caenorhabditis|Rep: Protein kinase protein 29 -
           Caenorhabditis elegans
          Length = 822

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ +++ DHP+ +K Y      N   IV +Y    +L+ETL  KG ++  +      +
Sbjct: 63  EVKIVKVI-DHPHIVKSYEIMRVDNMLYIVSEYCSSGELYETLIEKGRVAENVARKWFSE 121

Query: 58  LCEALNDLHKHNFIHNDIK 2
              A+  LH    +H D+K
Sbjct: 122 TASAVAYLHSQGIVHRDLK 140


>UniRef50_A2DV83 Cluster: AGC family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 740

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = -3

Query: 220 LMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           L N +P  +  Y++    +N  +VM+Y+   DL+  L   G L          Q+ +AL 
Sbjct: 375 LQNSNPFIVDFYYSIIGDHNLYLVMEYLPGGDLYSLLNNIGSLDETAARIYTAQIVKALE 434

Query: 40  DLHKHNFIHNDIK 2
            LH H  +H D+K
Sbjct: 435 YLHSHGIVHRDLK 447


>UniRef50_A2DPA3 Cluster: CAMK family protein kinase; n=1;
           Trichomonas vaginalis G3|Rep: CAMK family protein kinase
           - Trichomonas vaginalis G3
          Length = 419

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           +N   A  N  EI +H  +N HPN +K Y  +   +   IVM+Y     L+++ + +   
Sbjct: 46  QNTSQARLN-KEIDIHSSLN-HPNIVKFYGTYTDESYTYIVMEYCPNGSLYDSEKYRNHQ 103

Query: 91  SHQL--VSNIIRQLCEALNDLHKHNFIHNDIK 2
              L    +I+  L +A+  +H   FIH+DIK
Sbjct: 104 IFSLDEARSILNDLGKAIQYMHNKAFIHHDIK 135


>UniRef50_A0D448 Cluster: Chromosome undetermined scaffold_37, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_37,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 659

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/69 (24%), Positives = 40/69 (57%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  I++Y         +++M+ +   DL+  ++ K  +  +  + +++ +CEAL+++H 
Sbjct: 249 HPGIIRLYDVIQEKEKLILIMEIVSDGDLYSLIKEKKRIPEKEAAVMLKGVCEALHEMHI 308

Query: 28  HNFIHNDIK 2
           + F+H D+K
Sbjct: 309 NEFVHRDLK 317


>UniRef50_A0C3Q6 Cluster: Chromosome undetermined scaffold_147,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_147,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 499

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 3/85 (3%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELSHQLV 77
           +++E +V Q +N HPN IKI   H F  N+    +V D      LF+ ++ +G  S +  
Sbjct: 103 SMNEFRVLQKLN-HPNIIKI---HEFYQNKFSFNLVSDLQTGGQLFDKMRKEGRFSEKQA 158

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
           + I++Q+  A+N  H    IH D++
Sbjct: 159 AEIMKQILLAVNYCHNEKIIHGDLR 183


>UniRef50_A0BCB2 Cluster: Chromosome undetermined scaffold_10, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_10,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 299

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/93 (29%), Positives = 44/93 (47%)
 Frame = -3

Query: 280 VFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK 101
           V A+ N   N   + + + +L   HPN IK+Y      N   IV++Y    +LF  L+ +
Sbjct: 52  VLAKINGAYNMRQEILFLSKLQ--HPNIIKMYETFEDENYFYIVLEYCSKGNLFLLLKEQ 109

Query: 100 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G    +       Q+ +A+  +HK   IH D+K
Sbjct: 110 GAFPEEKAFKYFNQILQAIQFMHKRQIIHRDLK 142


>UniRef50_Q6FM66 Cluster: Candida glabrata strain CBS138 chromosome
           K complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome K complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 446

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/90 (30%), Positives = 43/90 (47%)
 Frame = -3

Query: 271 ENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL 92
           E N G     DE+ + Q + DHPN +K        +   IV       +LF+ +   G+ 
Sbjct: 102 EKNGGLEPIYDELNIIQHL-DHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKY 160

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + +   NI+ Q+ +A+  LH  N IH D+K
Sbjct: 161 TEEDAVNIVVQILKAVEYLHSQNIIHRDLK 190


>UniRef50_Q6CPN3 Cluster: Similar to sgd|S0002874 Saccharomyces
           cerevisiae YDR466w; n=1; Kluyveromyces lactis|Rep:
           Similar to sgd|S0002874 Saccharomyces cerevisiae YDR466w
           - Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 647

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HP  IK+Y+      N   V+D+    +L + LQ +G  +     + + QL +AL  +H
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIH 128

Query: 31  KHNFIHNDIK 2
               +H D+K
Sbjct: 129 GCKVVHRDLK 138


>UniRef50_A3LVN1 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 1465

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/79 (29%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L++ HPN + +Y      N+  ++++YI+  +LF+ L  +G+L      N  +Q
Sbjct: 126 EIIIMKLIS-HPNIMGLYDVWENKNDLYLILEYIEGGELFDYLIKRGKLQEFEAINYFKQ 184

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +  LH+ N  H D+K
Sbjct: 185 IIHGIGYLHQFNICHRDLK 203


>UniRef50_Q9NRP7 Cluster: Serine/threonine-protein kinase 36; n=28;
           Vertebrata|Rep: Serine/threonine-protein kinase 36 -
           Homo sapiens (Human)
          Length = 1315

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +  +       V+V DY +  +LF+ L+  G+L    V  I  QL  AL  LH 
Sbjct: 60  HPNIVHMLDSFETDKEVVVVTDYAE-GELFQILEDDGKLPEDQVQAIAAQLVSALYYLHS 118

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 119 HRILHRDMK 127


>UniRef50_Q9NJU9 Cluster: Calcium-dependent protein kinase 3; n=6;
           Plasmodium|Rep: Calcium-dependent protein kinase 3 -
           Plasmodium falciparum (isolate 3D7)
          Length = 562

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K+       N   +VM+     +LF+ +  KG       S I++Q+   LN LH
Sbjct: 171 DHPNVVKLLETFEDSNQIYLVMELCTGGELFDKIVKKGCFVETFASFIMKQIFSVLNYLH 230

Query: 31  KHNFIHNDIK 2
             N  H DIK
Sbjct: 231 IRNICHRDIK 240


>UniRef50_UPI0000E46D98 Cluster: PREDICTED: similar to doublecortin
           and CaM kinase-like 3; n=6; Deuterostomia|Rep:
           PREDICTED: similar to doublecortin and CaM kinase-like 3
           - Strongylocentrotus purpuratus
          Length = 991

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y  +    +  +VM+Y+   DLF+ +    + + +  + ++  L +AL  LH 
Sbjct: 750 HPNIVRLYEEYETRGHIYLVMEYVTGGDLFDAITESVKFTERDAALMVTDLAKALKYLHD 809

Query: 28  HNFIHNDIK 2
            N +H D+K
Sbjct: 810 LNVVHRDLK 818


>UniRef50_Q9K9Z0 Cluster: Serine/threonine protein kinase; n=1;
           Bacillus halodurans|Rep: Serine/threonine protein kinase
           - Bacillus halodurans
          Length = 664

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/69 (33%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + IY      N   IVM+Y++ P L E +Q +G L      +I+ Q+  A++  H 
Sbjct: 67  HQNVVSIYDVGEEENLYYIVMEYVEGPTLKELIQQRGPLPVDETIDIMSQMMAAISHAHM 126

Query: 28  HNFIHNDIK 2
           +  +H DIK
Sbjct: 127 NQIVHRDIK 135


>UniRef50_Q92AI8 Cluster: Lin1934 protein; n=13; Bacillales|Rep:
           Lin1934 protein - Listeria innocua
          Length = 657

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINN-QVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN + +Y + G  N+   IVM+++D  DL + +Q    +S+    +I+ Q+  A+   H
Sbjct: 68  HPNIVSVY-DVGEENDLHYIVMEHVDGMDLKQYIQENHPISYDKAVDIMLQIVSAVAIAH 126

Query: 31  KHNFIHNDIK 2
           +H+ IH D+K
Sbjct: 127 QHHIIHRDLK 136


>UniRef50_Q5SHY6 Cluster: Serine/threonine protein kinase; n=2;
           Thermus thermophilus|Rep: Serine/threonine protein
           kinase - Thermus thermophilus (strain HB8 / ATCC 27634 /
           DSM 579)
          Length = 652

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINN-QVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+Y +HG +     I M+++D   L + ++ +  LS +  + I+ ++ +AL  +
Sbjct: 154 DHPNIVKVY-DHGQVEGVHYIAMEFLDGEGLDKLIE-ERRLSLRQAAAILARVADALKHI 211

Query: 34  HKHNFIHNDIK 2
           H    +H DIK
Sbjct: 212 HAQGIVHRDIK 222


>UniRef50_Q1IN33 Cluster: Serine/threonine protein kinase; n=1;
           Acidobacteria bacterium Ellin345|Rep: Serine/threonine
           protein kinase - Acidobacteria bacterium (strain
           Ellin345)
          Length = 919

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HPN   IY    F N  VI M+ ++   L + + + G L+   + +I  Q+ +AL+  H
Sbjct: 65  NHPNICTIYAAEQFDNTWVIAMELLEGSTLGQLI-VDGTLNTDRILDIAIQVSDALDVAH 123

Query: 31  KHNFIHNDIK 2
            H  +H DIK
Sbjct: 124 AHGIVHRDIK 133


>UniRef50_Q0PIH7 Cluster: Ser/Thr protein kinase; n=1; Heliobacillus
           mobilis|Rep: Ser/Thr protein kinase - Heliobacillus
           mobilis
          Length = 634

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/69 (31%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +Y      +   IVM++ID P L E ++ +  L  +    + +Q+ +AL   H+
Sbjct: 67  HPNIVNVYDVGREGDIDYIVMEFIDGPTLKEVIRSRAPLPPEEAVELGKQISDALEHAHE 126

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 127 RGIIHRDIK 135


>UniRef50_Q8S9G0 Cluster: SNF1-related protein kinase; n=2; BEP
           clade|Rep: SNF1-related protein kinase - Triticum
           aestivum (Wheat)
          Length = 175

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I++Y      ++  +VM+Y+   +LF+ +  KG L      N  +Q
Sbjct: 21  EIKILRLFM-HPHIIRLYEVIETPSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQ 79

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 80  IISGVEYCHRNMVVHRDLK 98


>UniRef50_Q8IDV5 Cluster: Calcium-dependent protein kinase; n=7;
           Plasmodium|Rep: Calcium-dependent protein kinase -
           Plasmodium falciparum (isolate 3D7)
          Length = 568

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + + M DHPN IK+Y  +       +V++  D  +LF+ +   G  S      I++Q
Sbjct: 170 EILIMKQM-DHPNIIKLYEVYEDNEKLYLVLELCDGGELFDKIVKYGSFSEYEAYKIMKQ 228

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL   H  N +H D+K
Sbjct: 229 IFSALYYCHSKNIMHRDLK 247


>UniRef50_A3FQ66 Cluster: Protein kinase domain, putative; n=2;
           Cryptosporidium|Rep: Protein kinase domain, putative -
           Cryptosporidium parvum Iowa II
          Length = 516

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/69 (33%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +KIY       N  +VM+ ++  +LF+ L  +  +  +    IIRQ+ E++N LH 
Sbjct: 212 HPNVMKIYQVLEDEENFYLVMEGLEGGELFQFLITEQAIPEETCKYIIRQILESVNHLHC 271

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 272 LKMLHRDVK 280


>UniRef50_A2GPR1 Cluster: AGC family protein kinase; n=3;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 554

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = -3

Query: 220 LMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           L   +P  +K Y++    +N  +VM+Y+   DL+  LQ  G L  +       Q+  AL+
Sbjct: 199 LQFSNPYIVKFYYSIIGHHNLYLVMEYLPGGDLYSLLQNVGCLDEENTRIYALQILSALH 258

Query: 40  DLHKHNFIHNDIK 2
            LHK   IH D+K
Sbjct: 259 TLHKSGIIHRDLK 271


>UniRef50_A0EFS0 Cluster: Chromosome undetermined scaffold_94, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_94,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 658

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 6/86 (6%)
 Frame = -3

Query: 241 DEIKVHQLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE----LSHQL 80
           + +K  QL+    HPN I  Y +    +N  I+M+Y +  DL + L+   E    +  + 
Sbjct: 83  EALKEAQLLRKLKHPNIITYYMSFIEQDNLCIIMEYAEGGDLQKLLKDYKERRKFMQEET 142

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           +  + R+L  AL  LH++N IH DIK
Sbjct: 143 IWEMSRELSSALQHLHENNIIHRDIK 168


>UniRef50_A0CJM5 Cluster: Chromosome undetermined scaffold_2, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_2,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 594

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNII 65
           DEI V   + D PN +K+       +N  IVM+Y +  DL      +G+ +  Q    I+
Sbjct: 59  DEISVLTKI-DSPNVLKLEHYFQSKSNCYIVMEYCNGGDLERYWTREGKRIKEQKALEIV 117

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q+   L++LHK N IH DIK
Sbjct: 118 IQILNGLSELHKQNVIHRDIK 138


>UniRef50_A0CEB3 Cluster: Chromosome undetermined scaffold_170,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_170,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 612

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVI-VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           H N IKI   +   + QV+ +M++++  DL + +Q KG+L+ +    I RQ+ +A+   H
Sbjct: 152 HKNIIKIINCYTLPSMQVVLIMEFLEGGDLVDYIQQKGKLTEEEARIIFRQIADAICYCH 211

Query: 31  KHNFIHNDIK 2
               +H D+K
Sbjct: 212 DQKLVHRDLK 221


>UniRef50_A0CDL4 Cluster: Chromosome undetermined scaffold_17, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_17,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 510

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/94 (25%), Positives = 49/94 (52%), Gaps = 1/94 (1%)
 Frame = -3

Query: 280 VFAENNFGANFNV-DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI 104
           VF +NN      +  EI++ + +  H N IK+   +    +  +++DY+   +L + +  
Sbjct: 159 VFKKNNISNKLGLFKEIQILRQLQ-HKNVIKLNEVYENAKHLYLILDYLPGGELLQAISS 217

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
               S  +V  +I+ L +AL+ +H++  +H DIK
Sbjct: 218 AEVYSESVVQELIKNLLQALDYIHQNKILHRDIK 251


>UniRef50_Q8SR98 Cluster: SNF1-RELATED PROTEIN KINASE; n=1;
           Encephalitozoon cuniculi|Rep: SNF1-RELATED PROTEIN
           KINASE - Encephalitozoon cuniculi
          Length = 467

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 21/74 (28%), Positives = 38/74 (51%)
 Frame = -3

Query: 223 QLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEAL 44
           QL+ +H N  K+Y       N V+V++ +   DL   ++  G L      ++  Q+  A+
Sbjct: 57  QLILNHENICKLYGCISTSKNLVLVLELVRGVDLHRYIRRNGRLEEAYARSLFIQMLRAV 116

Query: 43  NDLHKHNFIHNDIK 2
           + LH H+ +H D+K
Sbjct: 117 DYLHTHSIVHRDLK 130


>UniRef50_Q5KCH7 Cluster: Calmodulin-dependent protein kinase I,
           putative; n=2; Filobasidiella neoformans|Rep:
           Calmodulin-dependent protein kinase I, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 485

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/81 (28%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           +DEI V + + DHPN + ++ +    +   I  +     +LF+ +  +G+ + +     I
Sbjct: 78  LDEISVLKHL-DHPNIVHVWDDFESRDKYYIAFELAVGGELFDRISERGKFTERDAVECI 136

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ +A   LH+HN  H D+K
Sbjct: 137 RQVLQATAYLHEHNVAHRDLK 157


>UniRef50_Q1DV10 Cluster: Putative uncharacterized protein; n=2;
           Onygenales|Rep: Putative uncharacterized protein -
           Coccidioides immitis
          Length = 1252

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/79 (27%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + +L+ +HPN I +Y          +V++Y++  +LF+ +  +G L       + RQ
Sbjct: 173 EVVIMKLI-EHPNVISLYDVWENRGELYLVLEYVEGGELFDYVSERGPLPEIEAVRLFRQ 231

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H++N  H D+K
Sbjct: 232 IIAALSCCHQYNICHRDLK 250


>UniRef50_A7TFG1 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 1123

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/79 (30%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+N HPN +++Y      NN  +V++Y +  +LF  L  KG L         RQ
Sbjct: 79  EIIIMKLLN-HPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQ 137

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    +H D+K
Sbjct: 138 IIIGMSYCHALGIVHRDLK 156


>UniRef50_A7E3Z6 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 428

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = -3

Query: 274 AENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KG 98
           A++ F  + + +E+  H  +  HPN + +  +     +  IV+++    DL+E ++   G
Sbjct: 59  ADSAFAIDEHSEELSCHARLGSHPNIVNLIHSFETEAHVYIVLEFCSRGDLYEAIRTGTG 118

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            L  + V   + QL +A+  +H     H DIK
Sbjct: 119 PLETEHVRQFMLQLIDAVAYIHSKGMYHRDIK 150


>UniRef50_A5DU07 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 988

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIR 62
           EIK+H+++ DHPN  K+Y +H    +  +V+++    DL+E + +  G  +   + ++  
Sbjct: 95  EIKIHEILGDHPNISKLY-DH---FDSCLVLEFCSRGDLYEAIHKGNGPATTLDIKDVFH 150

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A++  H     H D+K
Sbjct: 151 QIVNAVDFCHSKGVYHRDLK 170


>UniRef50_A3LWU1 Cluster: Serine/threonine protein kinase; n=1;
           Pichia stipitis|Rep: Serine/threonine protein kinase -
           Pichia stipitis (Yeast)
          Length = 816

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGELSHQLVSNIIR 62
           EI++H+++  HPN   +Y +H    +  ++++Y    DL+E +    G  + Q + ++  
Sbjct: 101 EIRIHKILGSHPNVSSLY-DH---FDSYLILEYCSRGDLYEAIHGGNGPSTSQDIKDVFS 156

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  AL   H H   H D+K
Sbjct: 157 QVLGALEYCHSHQVYHRDLK 176


>UniRef50_A3LWS0 Cluster: Predicted protein; n=2;
           Saccharomycetaceae|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 548

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/69 (28%), Positives = 39/69 (56%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN IK+  +    ++  +V++Y +  ++F  +      S  L  ++ +QL  A++ LHK
Sbjct: 68  HPNIIKLLHSVNTHDHCFLVLEYCNGGEIFNKIIEYTYFSEPLSRHVFKQLVSAIDHLHK 127

Query: 28  HNFIHNDIK 2
           ++ +H DIK
Sbjct: 128 NDIVHRDIK 136


>UniRef50_A3LNW8 Cluster: Predicted protein; n=5;
           Saccharomycetales|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 720

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQ 83
           GA   VD E+ + + + DHPN + +   +  ++N  IVM+ +   DL + +   G +   
Sbjct: 178 GAMVGVDRELSILRKL-DHPNIVSLKAFYEDLDNYYIVMELVPGGDLMDFVAANGAIGED 236

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
               I RQ+ E +  +HK    H D+K
Sbjct: 237 ATQVITRQILEGIAYVHKLGISHRDLK 263


>UniRef50_Q8ZYE4 Cluster: Serine/threonine protein kinase, putative;
           n=4; Pyrobaculum|Rep: Serine/threonine protein kinase,
           putative - Pyrobaculum aerophilum
          Length = 369

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N   I+++Y++   L + L+ +  L  Q V  + +QL + L D+HKHN +H DIK
Sbjct: 193 NPPYILLEYMEGGTLRDLLRARKRLPVQQVIELFKQLAQGLYDIHKHNIVHLDIK 247


>UniRef50_P50528 Cluster: Serine/threonine-protein kinase plo1; n=1;
           Schizosaccharomyces pombe|Rep: Serine/threonine-protein
           kinase plo1 - Schizosaccharomyces pombe (Fission yeast)
          Length = 683

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 25/79 (31%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIKVHQ M+ HPN +          N  ++++  +   L E L+ + +L+   V  ++ Q
Sbjct: 88  EIKVHQSMS-HPNIVGFIDCFEDSTNIYLILELCEHKSLMELLRKRKQLTEPEVRYLMMQ 146

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  +HK   IH D+K
Sbjct: 147 ILGALKYMHKKRVIHRDLK 165


>UniRef50_Q16816 Cluster: Phosphorylase b kinase gamma catalytic
           chain, skeletal muscle isoform; n=16; Chordata|Rep:
           Phosphorylase b kinase gamma catalytic chain, skeletal
           muscle isoform - Homo sapiens (Human)
          Length = 387

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>UniRef50_Q9H093 Cluster: NUAK family SNF1-like kinase 2; n=31;
           Euteleostomi|Rep: NUAK family SNF1-like kinase 2 - Homo
           sapiens (Human)
          Length = 628

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/79 (29%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I I+      +  VIVM+Y    DL++ +  + +LS +   +  RQ
Sbjct: 100 EIEIMSSLN-HPHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQ 158

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H++  +H D+K
Sbjct: 159 IVSAVHYCHQNRVVHRDLK 177


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 708,775,441
Number of Sequences: 1657284
Number of extensions: 14131062
Number of successful extensions: 54038
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 49879
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53709
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 69966202150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -