SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;...    97   4e-19
UniRef50_A1YRA1 Cluster: Late expression factor-10; n=2; Nucleop...    77   6e-13
UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep: ...    55   2e-06
UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9; Nucl...    45   0.002
UniRef50_Q91ER7 Cluster: ORF138 VP1054; n=5; Granulovirus|Rep: O...    40   0.065
UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6; Nucleopolyh...    38   0.34 
UniRef50_Q6QXI7 Cluster: ORF127; n=1; Agrotis segetum granulovir...    36   1.4  
UniRef50_UPI0001553937 Cluster: PREDICTED: hypothetical protein;...    33   5.6  
UniRef50_Q9PYM1 Cluster: ORF175; n=2; Granulovirus|Rep: ORF175 -...    33   7.4  
UniRef50_Q4DKJ0 Cluster: Putative uncharacterized protein; n=2; ...    33   7.4  
UniRef50_UPI000155B953 Cluster: PREDICTED: similar to Myosin-VII...    33   9.8  
UniRef50_UPI0000F1F6C7 Cluster: PREDICTED: similar to myosin XVA...    33   9.8  

>UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 42.5 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 378

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query: 255 MLHMTVLNSVFLNEHAKLYYRHLLRN--DQAEARKTILNADDVYECVLIKPIRTEHFRSV 428
           +LHMTV + +FL+E A+ YYR LLR   D A AR+  LNA  V++C+L++P  +EHF+S+
Sbjct: 58  LLHMTVYSDIFLDERARPYYRQLLRKRTDAAAARRAFLNAGQVHDCLLLEPAPSEHFKSI 117

Query: 429 DEAGEHNMGVLKIIIDTVIKYIGKLAETSTF 521
           +EAGE NM  L+ I+ T+  ++G++A T  F
Sbjct: 118 EEAGETNMSTLRTILATLTSFLGRVASTEYF 148



 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 30/57 (52%), Positives = 38/57 (66%)
 Frame = +1

Query: 82  MCSTKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNEN 252
           M   KK + L+ C SVKL P +P+R  K MQCW+HPRRA C+V R R+ Y D  NE+
Sbjct: 1   MSCAKKLVTLNPCTSVKLVPHRPIRATK-MQCWMHPRRATCRVQRLRDAYHDERNES 56



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 33/87 (37%), Positives = 52/87 (59%), Gaps = 9/87 (10%)
 Frame = +2

Query: 512 EYILIADRMYVDLIYSEFRAIILPQSAYIIKGDYAESDSESGQSVDVCNELQYPWNLITA 691
           EY LI DR+++DL+YSEFRA++LPQ AY+++   A++DS   +  +    ++ PWN I  
Sbjct: 146 EYFLIVDRLFIDLVYSEFRAVVLPQHAYVLQQACADTDSSDEEPCE--RGVEPPWNQIVV 203

Query: 692 NSFNVS---------TDESRQSQYIYR 745
            +   +          +  RQSQYIY+
Sbjct: 204 AAHVAAAHRHEGARYNEWQRQSQYIYQ 230


>UniRef50_A1YRA1 Cluster: Late expression factor-10; n=2;
           Nucleopolyhedrovirus|Rep: Late expression factor-10 -
           Maruca vitrata MNPV
          Length = 78

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 39/72 (54%), Positives = 45/72 (62%)
 Frame = +3

Query: 6   ATDVNLINCVLKDXXXXXXXXXXXXXVFDQETDQVRPLCLGEINXXXXXXXXXXXXMLDT 185
           A+DV+LINC+LKD             VFDQE DQ+R +CLGEI+            MLDT
Sbjct: 7   ASDVDLINCILKDNLFLIDNNYIILNVFDQEKDQIRSMCLGEIDTFQTDATAEANAMLDT 66

Query: 186 SSTSELQSNAST 221
           SSTSELQSNAST
Sbjct: 67  SSTSELQSNAST 78


>UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep:
           Vp1054 - Ecotropis obliqua NPV
          Length = 366

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +3

Query: 249 KRMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEARKTILNADDVYECVLIKPIRT-EHFRS 425
           K   H T++N+ +LN   K YY  L+       R   +NADD+Y  V +  I + E F  
Sbjct: 75  KYFYHETIINTFYLNYKKKPYYSVLISPQDIAKRGIYMNADDLYAYVHLNQIDSDEQFFG 134

Query: 426 VDEAGEHNMGVLKIIIDTVIKYIGKLAE 509
           +DE GE  M +L ++I ++I  + + ++
Sbjct: 135 IDENGERQMQILTMVIKSIIDCLNQCSQ 162



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +1

Query: 82  MCSTKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPR-NNYSDPDNENE 255
           M STK  +K   C S KLT FKP++ P    C  HP RANC+  +   +N  +  +E+E
Sbjct: 1   MSSTKNVVKFKQCVSEKLTVFKPLKRPPRTVCRFHPLRANCRAIKQHDDNLQNALDESE 59



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 518 ILIADRMYVDLIYSEFRAIILPQSAYII 601
           IL  D + +DL+YS +R ++LPQ  Y I
Sbjct: 165 ILCVDELMIDLLYSSYRIVVLPQKLYAI 192


>UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9;
           Nucleopolyhedrovirus|Rep: ORF105 vp1054 virion protein -
           Spodoptera exigua MNPV
          Length = 346

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = +1

Query: 103 IKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNEN 252
           ++L+ CAS KLTPF+P++     QC IH  RANCKV +  +  +D + +N
Sbjct: 10  VRLNRCASEKLTPFRPIKVTS-TQCPIHLFRANCKVIKRYDAENDTNFDN 58



 Score = 40.7 bits (91), Expect = 0.037
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = +2

Query: 509 DEYILIADRMYVDLIYSEFRAIILPQSAYIIKGD 610
           D YIL+ D + VDL+YS FR+IILPQ    I  D
Sbjct: 143 DRYILMIDELQVDLVYSIFRSIILPQRMIAIYTD 176



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = +3

Query: 261 HMTVLNSVFLNEHAKLYYRHLLR-NDQAEARKTILNADDVYECVLIKPI-RTEHFRSVDE 434
           H+T+LN V+ N + + +Y  L+   +  E R    NA+D+   V +  +   E F  +D 
Sbjct: 59  HLTILNGVYQNYNREPFYLALVNPANDLETRGVYTNANDMVLYVELHRLDDDERFFGIDA 118

Query: 435 AGEHNMGVLKIIIDTVI 485
           AGE N+  ++ +I  ++
Sbjct: 119 AGERNVATIRNVIKMIM 135


>UniRef50_Q91ER7 Cluster: ORF138 VP1054; n=5; Granulovirus|Rep:
           ORF138 VP1054 - Cydia pomonella granulosis virus (CpGV)
           (Cydia pomonellagranulovirus)
          Length = 332

 Score = 39.9 bits (89), Expect = 0.065
 Identities = 23/78 (29%), Positives = 41/78 (52%)
 Frame = +3

Query: 261 HMTVLNSVFLNEHAKLYYRHLLRNDQAEARKTILNADDVYECVLIKPIRTEHFRSVDEAG 440
           H+T L++ + + +   YY  L  ND  E R  + N   V   V       E  RS++EAG
Sbjct: 49  HITTLDARYCSTNGDPYYEWLTLNDNNE-RTRLKNGYSVECSVKYTMENEEELRSLEEAG 107

Query: 441 EHNMGVLKIIIDTVIKYI 494
           E+++ ++K ++  V +Y+
Sbjct: 108 EYDVQIVKKVLRFVYEYL 125


>UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6;
           Nucleopolyhedrovirus|Rep: VP1054 virion protein -
           Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 352

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +2

Query: 515 YILIADRMYVDLIYSEFRAIILPQSAYIIKG 607
           Y+L+ D   +D+IYS+ R ++LPQ  Y++ G
Sbjct: 157 YVLMFDEPQIDVIYSQLRTVLLPQRMYMLSG 187



 Score = 36.7 bits (81), Expect = 0.60
 Identities = 19/43 (44%), Positives = 24/43 (55%)
 Frame = +1

Query: 88  STKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTR 216
           +T    K + C S K   FKP+   K  QC IHP RANC+V +
Sbjct: 12  ATTTTTKYNQCVSEKSVSFKPITFRKS-QCPIHPLRANCRVIK 53


>UniRef50_Q6QXI7 Cluster: ORF127; n=1; Agrotis segetum
           granulovirus|Rep: ORF127 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 331

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 503 GRDEYILIADRMYVDLIYSEFRAIILPQSAYII 601
           G   Y+L+   MYVD +YS+ + IILPQ  Y I
Sbjct: 144 GNKTYVLLKS-MYVDCLYSDIQCIILPQEMYCI 175


>UniRef50_UPI0001553937 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 126

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 301 QNCIIGTCCATIKPRREKQFSTPTTCTS 384
           Q+C   TCCA + P +E  F  PTT  S
Sbjct: 17  QSCCSSTCCAPLPPAKEHGFQEPTTIQS 44


>UniRef50_Q9PYM1 Cluster: ORF175; n=2; Granulovirus|Rep: ORF175 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 323

 Score = 33.1 bits (72), Expect = 7.4
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 518 ILIADRMYVDLIYSEFRAIILPQSAYIIKGDYAE 619
           +L+   +YVD +YS+ + +ILPQ  Y I  D  E
Sbjct: 140 VLLLKDLYVDCLYSQRQCVILPQELYCIYKDDVE 173


>UniRef50_Q4DKJ0 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 457

 Score = 33.1 bits (72), Expect = 7.4
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = +2

Query: 641 SVDVCNELQYPWNLITANSFNVSTDESRQSQY 736
           S    NE   P+N+I  N  NVSTD  R+S+Y
Sbjct: 395 SYGTLNEAAPPYNMINKNDKNVSTDVGRRSEY 426


>UniRef50_UPI000155B953 Cluster: PREDICTED: similar to Myosin-VIIa
           motor domain, partial; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to Myosin-VIIa motor
           domain, partial - Ornithorhynchus anatinus
          Length = 249

 Score = 32.7 bits (71), Expect = 9.8
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = -1

Query: 610 ISFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFKTP 452
           +SF N +A+R++N  +FG + IDIH  + +  +  A +  YL+  S +  + P
Sbjct: 55  LSFGNAKAIRKDNSSRFGKD-IDIHFSK-KGAIEGAKIEQYLLEKSRVCRQAP 105


>UniRef50_UPI0000F1F6C7 Cluster: PREDICTED: similar to myosin XVA,;
            n=2; Danio rerio|Rep: PREDICTED: similar to myosin XVA, -
            Danio rerio
          Length = 1135

 Score = 32.7 bits (71), Expect = 9.8
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = -1

Query: 607  SFDNVRALRQNNGPKFGIN*IDIHAVRYQNVLVSASLPMYLMTVSMMIFK 458
            SF N + +  NN  +FG   + IH +  Q V+V  SL  YL+  S ++F+
Sbjct: 949  SFGNAKTILNNNSSRFG-KYLHIHIL--QGVVVGTSLSKYLLEKSRIVFQ 995


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 647,676,234
Number of Sequences: 1657284
Number of extensions: 12267101
Number of successful extensions: 30300
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 29374
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30286
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60911752460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -