SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P31354 Cluster: Early 35 kDa protein; n=16; Nucleopolyh...   184   2e-45
UniRef50_Q9YQQ7 Cluster: Apoptotic suppressor protein; n=3; Nucl...    52   2e-05
UniRef50_Q1A4T1 Cluster: P35/P49-like; n=1; Choristoneura occide...    46   0.001
UniRef50_Q4JA83 Cluster: Conserved protein; n=2; Sulfolobus|Rep:...    39   0.15 
UniRef50_Q9EN36 Cluster: AMV010; n=1; Amsacta moorei entomopoxvi...    37   0.62 
UniRef50_Q224H0 Cluster: Putative uncharacterized protein; n=6; ...    36   0.82 
UniRef50_Q7RIS8 Cluster: DnaJ domain, putative; n=5; Plasmodium ...    36   1.1  
UniRef50_Q23AU4 Cluster: Putative uncharacterized protein; n=2; ...    36   1.1  
UniRef50_A2FGM4 Cluster: Putative uncharacterized protein; n=1; ...    36   1.4  
UniRef50_Q94JR2 Cluster: AT5g45310/K9E15_9; n=2; Arabidopsis tha...    35   1.9  
UniRef50_Q4YP78 Cluster: Putative uncharacterized protein; n=3; ...    35   2.5  
UniRef50_A0BJX6 Cluster: Chromosome undetermined scaffold_111, w...    35   2.5  
UniRef50_Q8JKL2 Cluster: Copine-like protein T2I1.10; n=1; Helio...    34   3.3  
UniRef50_Q5UYM2 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_Q8IDG6 Cluster: Putative uncharacterized protein PF13_0...    34   4.4  
UniRef50_Q6BXP8 Cluster: Similar to CA5353|CaIML2 Candida albica...    34   4.4  
UniRef50_Q3IT60 Cluster: Putative uncharacterized protein; n=1; ...    34   4.4  
UniRef50_Q0IL44 Cluster: P49; n=1; Leucania separata nuclear pol...    33   5.8  
UniRef50_A5B1U0 Cluster: Putative uncharacterized protein; n=2; ...    33   5.8  
UniRef50_Q8IJW2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_Q7QI79 Cluster: ENSANGP00000021610; n=3; Culicidae|Rep:...    33   5.8  
UniRef50_Q23WT4 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_A5DPL9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_UPI000150A375 Cluster: putative serine esterase; n=1; T...    33   7.6  
UniRef50_Q9NCG0 Cluster: Kinesin-like kinetochore motor protein ...    33   7.6  
UniRef50_A7SWJ9 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.6  
UniRef50_A0C6A6 Cluster: Chromosome undetermined scaffold_151, w...    33   7.6  
UniRef50_Q59K46 Cluster: Likely vesicular transport factor Uso1p...    33   7.6  
UniRef50_A2QT24 Cluster: Contig An09c0030, complete genome; n=2;...    33   7.6  
UniRef50_Q3IQE9 Cluster: Probable restriction/modification enzym...    33   7.6  
UniRef50_Q4A5F4 Cluster: S-adenosylmethionine synthetase; n=4; B...    33   7.6  

>UniRef50_P31354 Cluster: Early 35 kDa protein; n=16;
           Nucleopolyhedrovirus|Rep: Early 35 kDa protein - Bombyx
           mori nuclear polyhedrosis virus (BmNPV)
          Length = 299

 Score =  184 bits (449), Expect = 2e-45
 Identities = 84/84 (100%), Positives = 84/84 (100%)
 Frame = +2

Query: 257 LRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSH 436
           LRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSH
Sbjct: 63  LRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSH 122

Query: 437 DYTDKKSIETYEKYCLPQLVDKHN 508
           DYTDKKSIETYEKYCLPQLVDKHN
Sbjct: 123 DYTDKKSIETYEKYCLPQLVDKHN 146



 Score =  177 bits (432), Expect = 2e-43
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +1

Query: 511 CYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDG 690
           CYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDG
Sbjct: 148 CYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDG 207

Query: 691 KQFEEFVQKLILPSSFNDSEKV 756
           KQFEEFVQKLILPSSFNDSEKV
Sbjct: 208 KQFEEFVQKLILPSSFNDSEKV 229



 Score =  130 bits (314), Expect = 4e-29
 Identities = 61/61 (100%), Positives = 61/61 (100%)
 Frame = +3

Query: 72  MCVIFPVEIDVSQTVIRDCHVDEQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKN 251
           MCVIFPVEIDVSQTVIRDCHVDEQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKN
Sbjct: 1   MCVIFPVEIDVSQTVIRDCHVDEQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKN 60

Query: 252 N 254
           N
Sbjct: 61  N 61


>UniRef50_Q9YQQ7 Cluster: Apoptotic suppressor protein; n=3;
           Nucleopolyhedrovirus|Rep: Apoptotic suppressor protein -
           Spodoptera littoralis nuclear polyhedrosis virus (SlNPV)
          Length = 446

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +1

Query: 514 YVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTG--LYEYDVLAYVDSVEFD 687
           YV +C LKP   N + + L F Y P   +VIVP  HEIN+ G  +Y Y+V+A +  V   
Sbjct: 169 YVVICSLKPKLLN-NKKTLCFTYKPQTGQVIVPLMHEINENGSDVYAYEVMAMIKDVRLS 227

Query: 688 GK 693
            K
Sbjct: 228 NK 229



 Score = 40.3 bits (90), Expect = 0.050
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 6/64 (9%)
 Frame = +3

Query: 72  MCVIFPVEIDVSQTVIRDCH--VDEQTRELVYINKIMNTQ----LTKPVLMMFNISGPIR 233
           MCV+ P   + S T I DC    D   R+L+Y+N +  ++    + + V+M  NISGP+ 
Sbjct: 1   MCVLIPT-FNASATTIVDCANLSDSSMRDLIYVNNVAVSKNGNYINRAVIMALNISGPLV 59

Query: 234 SVTR 245
            V R
Sbjct: 60  CVNR 63



 Score = 36.3 bits (80), Expect = 0.82
 Identities = 20/86 (23%), Positives = 36/86 (41%), Gaps = 1/86 (1%)
 Frame = +2

Query: 254 HLRDRIKSKVDEQFDQLER-EYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILK 430
           H+    +S +D  FD+  +  YS  +       + F  + Y+V C +   L + +   L 
Sbjct: 67  HIVHMYRSHIDRVFDKFNKLTYSATVTDGGGADRVFNSDDYTVVCMSRGDLLNNYKNCLL 126

Query: 431 SHDYTDKKSIETYEKYCLPQLVDKHN 508
           +        +E + KYCL  L +  N
Sbjct: 127 NEMGATYDDVEKFRKYCLKPLTETEN 152


>UniRef50_Q1A4T1 Cluster: P35/P49-like; n=1; Choristoneura
           occidentalis granulovirus|Rep: P35/P49-like -
           Choristoneura occidentalis granulovirus
          Length = 369

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/63 (38%), Positives = 35/63 (55%)
 Frame = +1

Query: 490 IGRQTQHCYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYV 669
           +  + +  YV +C LKP   N  +  +   Y P+ N VI+P  HEI++   Y+YDVLA V
Sbjct: 147 MSEKLKSAYVVLCCLKPELLN-EDCTVCVTYEPVNNIVIIPLQHEISEK--YKYDVLAIV 203

Query: 670 DSV 678
             V
Sbjct: 204 RGV 206


>UniRef50_Q4JA83 Cluster: Conserved protein; n=2; Sulfolobus|Rep:
           Conserved protein - Sulfolobus acidocaldarius
          Length = 169

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = +2

Query: 239 YAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNG 394
           + ++  + D +KS ++E+ D LERE  DK++ F+ NI+      Y+ S +NG
Sbjct: 45  FKEQIEILDSLKSLIEEKIDTLEREIHDKVNSFNVNIEELTYSIYN-SIENG 95


>UniRef50_Q9EN36 Cluster: AMV010; n=1; Amsacta moorei entomopoxvirus
           'L'|Rep: AMV010 - Amsacta moorei entomopoxvirus (AmEPV)
          Length = 272

 Score = 36.7 bits (81), Expect = 0.62
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +1

Query: 454 VY*NLRKILFAPIGRQTQHCYVAVCVLK----PGFENGSNQVLSFEYNPIGNKVIVPFAH 621
           +Y N  ++L   I    ++ Y+ +C++K    P   N SN  ++ +Y  + N +I+P   
Sbjct: 133 IYNNCIELLNNKINNINKY-YIILCIIKNENNPKILN-SNIFINIDYELLSNYIIIPTMS 190

Query: 622 EINDTGLYEYDVLAYVDSV 678
             N+  +Y+YD   Y+D+V
Sbjct: 191 NSNNN-IYDYDYKCYIDNV 208


>UniRef50_Q224H0 Cluster: Putative uncharacterized protein; n=6;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 246

 Score = 36.3 bits (80), Expect = 0.82
 Identities = 23/86 (26%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +2

Query: 245 QEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNG-SVLKSKFAK 421
           Q Q + +  + ++++Q ++LE++Y ++ DGF   ++YF D    V    G  +LK   AK
Sbjct: 131 QVQEIEELNRKRIEKQEEELEKKYRERYDGFTGTLKYFWDG--LVQAPRGYQILKE--AK 186

Query: 422 ILKSHDYTDKKSIETYEKYCLPQLVD 499
           ++   DY ++K+ +  ++  + ++VD
Sbjct: 187 VI---DYVEEKAQDGVDE-VIDKIVD 208


>UniRef50_Q7RIS8 Cluster: DnaJ domain, putative; n=5; Plasmodium
            (Vinckeia)|Rep: DnaJ domain, putative - Plasmodium yoelii
            yoelii
          Length = 1152

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 30/148 (20%), Positives = 60/148 (40%), Gaps = 7/148 (4%)
 Frame = +2

Query: 65   LQNVCNFSGRNRRVPDGYSRLSCGRTNQRVGVH*QDYEHAIDKTRSH--DV*HFGS--YT 232
            +Q   ++S  N +      + +    +  +  +  D E   DK   H  ++ H+ S  Y 
Sbjct: 989  IQKNMSYSNDNTKKKQSIEKRNNQNDSPNIYNNNSDNEQNQDKYNGHNGEIKHYDSSFYG 1048

Query: 233  KRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF---KDEHYSVSCQNGSVL 403
            K Y Q       IK+K+D++F Q   + S+    +++N  ++    DE+ +    N    
Sbjct: 1049 KNYVQTNKSISNIKNKLDKKFQQKNFDSSEDFSSYNENNNFYNMHNDEYKTFHFSNEQTD 1108

Query: 404  KSKFAKILKSHDYTDKKSIETYEKYCLP 487
            +      L S +     +I++Y     P
Sbjct: 1109 QDINKNYLHSENNIPPDNIKSYSFLTTP 1136


>UniRef50_Q23AU4 Cluster: Putative uncharacterized protein; n=2;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 767

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 25/88 (28%), Positives = 38/88 (43%)
 Frame = +2

Query: 248 EQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKIL 427
           +QHL +RI+     Q D   +EY        D I+YF  E YS+  Q       K  K  
Sbjct: 171 QQHLIERIQKMNLRQVDSNFQEYEKNFKSIEDQIRYFLLE-YSLKTQGYICEAKKKVKTD 229

Query: 428 KSHDYTDKKSIETYEKYCLPQLVDKHNT 511
           +     D + +E Y K+   + + K+ T
Sbjct: 230 QKAVIYDLQQVEQYSKFGNLKFLHKYET 257


>UniRef50_A2FGM4 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 587

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +2

Query: 296 DQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHD 439
           D+L+R   +K+D + +NIQY K     +S QN ++L  K  +I +  +
Sbjct: 225 DELQRSEQEKVDAYENNIQYLKTHLTELSNQN-TILTEKLQQITQQRE 271


>UniRef50_Q94JR2 Cluster: AT5g45310/K9E15_9; n=2; Arabidopsis
           thaliana|Rep: AT5g45310/K9E15_9 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 352

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 5/76 (6%)
 Frame = +2

Query: 248 EQHLRDRIKSK--VDEQFDQLEREYSD---KIDGFHDNIQYFKDEHYSVSCQNGSVLKSK 412
           E++LR+ IK    +++  D+LE E+ +   KI+     +Q  K+E+  +   NG   +SK
Sbjct: 111 EKNLREAIKEYRIMEQDLDELEDEHDEAISKIEKLEAELQELKEENLQLMEVNGKDYRSK 170

Query: 413 FAKILKSHDYTDKKSI 460
             K+  S + ++ +SI
Sbjct: 171 KGKVKPSEEPSEIRSI 186


>UniRef50_Q4YP78 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium berghei
          Length = 826

 Score = 34.7 bits (76), Expect = 2.5
 Identities = 21/75 (28%), Positives = 39/75 (52%)
 Frame = +2

Query: 146 QRVGVH*QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDK 325
           Q +GV   D +    K +++D  +FG++ K+  Q++++ + I   +DE  D+   E  DK
Sbjct: 295 QTIGVSNVDEKCESPKIKANDS-NFGNHIKQVGQDENIDENIDENIDENIDENNDENLDK 353

Query: 326 IDGFHDNIQYFKDEH 370
                +NI    DE+
Sbjct: 354 --NSDENIDENNDEN 366


>UniRef50_A0BJX6 Cluster: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 829

 Score = 34.7 bits (76), Expect = 2.5
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +2

Query: 275 SKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKK 454
           +K  EQ D   ++Y +++    D I+YFK+++ ++   N   L ++ + IL      ++K
Sbjct: 336 TKQREQIDIAFQQYEEQLKELSDQIEYFKEQNKNLIDDNNK-LHNQLSIILNERGEQEQK 394

Query: 455 SIETYEK 475
             E +EK
Sbjct: 395 LYEEFEK 401


>UniRef50_Q8JKL2 Cluster: Copine-like protein T2I1.10; n=1;
           Heliothis zea virus 1|Rep: Copine-like protein T2I1.10 -
           Heliothis zea virus 1
          Length = 241

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 2/42 (4%)
 Frame = -3

Query: 149 SGLFVHMTISNN--RLGHVDFYRKNYTHFAMVKLKCSLNTSN 30
           S L    TI+++  RL  +D YRK  T+F +V ++ SLNTSN
Sbjct: 25  SNLLNSETINSSLYRLASLDAYRKYKTNFKIVNIRLSLNTSN 66


>UniRef50_Q5UYM2 Cluster: Putative uncharacterized protein; n=1;
           Haloarcula marismortui|Rep: Putative uncharacterized
           protein - Haloarcula marismortui (Halobacterium
           marismortui)
          Length = 185

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 14/72 (19%), Positives = 39/72 (54%)
 Frame = +2

Query: 263 DRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDY 442
           ++I+  VDEQFD L   +++  D     ++   D +  ++ +  + +  +   ++++H+ 
Sbjct: 81  EQIRETVDEQFDFLLENHAEVFDNMETELEEGVDTYDEMTDEYVTAVNDQVDMLVEAHEE 140

Query: 443 TDKKSIETYEKY 478
            + +S+E  E++
Sbjct: 141 LEAQSVEAAEQF 152


>UniRef50_Q8IDG6 Cluster: Putative uncharacterized protein
           PF13_0278; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PF13_0278 - Plasmodium
           falciparum (isolate 3D7)
          Length = 1164

 Score = 33.9 bits (74), Expect = 4.4
 Identities = 25/105 (23%), Positives = 50/105 (47%), Gaps = 1/105 (0%)
 Frame = +2

Query: 167 QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQ-LEREYSDKIDGFHD 343
           ++Y+   DK  ++D  +  +Y  +Y  +++  +R     D+++D+  ++ Y DK D    
Sbjct: 101 KNYDDKYDK--NYDERYNKNYDDKY--DKNYDERYNKNYDDKYDKKYDKRYDDKYD---K 153

Query: 344 NIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 478
             Q  KD  Y    +     K  +  + +  DY  + + ETY+KY
Sbjct: 154 KYQDKKDNEYHKGKRKYDERKHSY--VSQEKDYNRRNNSETYDKY 196


>UniRef50_Q6BXP8 Cluster: Similar to CA5353|CaIML2 Candida albicans
           CaIML2 unknown function; n=3; Saccharomycetaceae|Rep:
           Similar to CA5353|CaIML2 Candida albicans CaIML2 unknown
           function - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 886

 Score = 33.9 bits (74), Expect = 4.4
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%)
 Frame = +2

Query: 242 AQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHD--NIQYFKDEHYSVSCQNGSVL 403
           +Q    R+ I S  D++FD  + E+SD  D FH   N+      H S S  N  VL
Sbjct: 309 SQNAKFRNPIPSSADDEFDDEDDEFSDASDTFHSFGNLSIPHLMHKSSSLANSQVL 364


>UniRef50_Q3IT60 Cluster: Putative uncharacterized protein; n=1;
           Natronomonas pharaonis DSM 2160|Rep: Putative
           uncharacterized protein - Natronomonas pharaonis (strain
           DSM 2160 / ATCC 35678)
          Length = 214

 Score = 33.9 bits (74), Expect = 4.4
 Identities = 16/69 (23%), Positives = 34/69 (49%)
 Frame = +2

Query: 269 IKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTD 448
           I+  +DEQ D LE   +D +D   +N+Q   +    +       L+ +   +L +H+  +
Sbjct: 83  IRDSIDEQLDTLEESQTDALDQLEENLQDGSESVDELLDDFLGTLEEQVNTLLDAHEDLE 142

Query: 449 KKSIETYEK 475
            +++E  E+
Sbjct: 143 DQTVEALEE 151


>UniRef50_Q0IL44 Cluster: P49; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: P49 - Leucania separata nuclear
           polyhedrosis virus (LsNPV)
          Length = 445

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +3

Query: 135 DEQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTR 245
           D   R+L+Y N++++      VL  FN+SGP+ +V R
Sbjct: 23  DANLRDLIYSNRLVDGPTNCNVLFAFNLSGPLVAVNR 59


>UniRef50_A5B1U0 Cluster: Putative uncharacterized protein; n=2;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 681

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 224 SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKD 364
           S   + +Q+  L DR++S ++++ D ++ + S KID   D+I  F +
Sbjct: 468 SINAQLSQKISLPDRVESSLNKKMDGVQHDLSQKIDNIQDSISRFSN 514


>UniRef50_Q8IJW2 Cluster: Putative uncharacterized protein; n=1;
            Plasmodium falciparum 3D7|Rep: Putative uncharacterized
            protein - Plasmodium falciparum (isolate 3D7)
          Length = 3853

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +2

Query: 248  EQHLRDRIKSKVDEQF-DQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKI 424
            E  L D++  K++++  D+LE +  DK+D   D+ +    EH S+     S +  K  KI
Sbjct: 2639 EDKLEDKLDDKLEDKLEDKLEDKLEDKLDNQLDDNELESKEHSSIHLYQLSDVNQKEEKI 2698

Query: 425  LKS-HDYTDKK 454
             +S +DY  ++
Sbjct: 2699 GESENDYEGER 2709


>UniRef50_Q7QI79 Cluster: ENSANGP00000021610; n=3; Culicidae|Rep:
           ENSANGP00000021610 - Anopheles gambiae str. PEST
          Length = 390

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
 Frame = +1

Query: 550 NGSNQVLSF--EYN-PIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDG 690
           NG+N+ +    EY  P+ +K+I  F    +DTG++E  V AY+ +  F G
Sbjct: 206 NGANKRIQLIDEYGCPVDDKLISRFRGSWSDTGVFETQVYAYMKTFRFTG 255


>UniRef50_Q23WT4 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1494

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 11/32 (34%), Positives = 22/32 (68%)
 Frame = -3

Query: 167 VNVHQLSGLFVHMTISNNRLGHVDFYRKNYTH 72
           +++  ++G+F   TI +N L  +DFY+ N+T+
Sbjct: 270 ISIEPITGIFAVYTIPDNNLSKIDFYQYNFTN 301


>UniRef50_A5DPL9 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 389

 Score = 33.5 bits (73), Expect = 5.8
 Identities = 21/85 (24%), Positives = 40/85 (47%)
 Frame = -3

Query: 281 LLILFCRANVVLARNASYRTRNVKHHENGFCQLRVHNLVNVHQLSGLFVHMTISNNRLGH 102
           L +L+  A   + +  ++ T  +KH +  F  L  +NL  + Q   L   + +SNN + H
Sbjct: 181 LTLLYHNAEATMVQLGAFNTSTIKHLDISFNGLTDYNLHRI-QFPELLESLNLSNNNIFH 239

Query: 101 VDFYRKNYTHFAMVKLKCSLNTSNV 27
           +     N  +   +K K  L+ +N+
Sbjct: 240 LSSSTLNLQNLPNLK-KLDLSNNNL 263


>UniRef50_UPI000150A375 Cluster: putative serine esterase; n=1;
           Tetrahymena thermophila SB210|Rep: putative serine
           esterase - Tetrahymena thermophila SB210
          Length = 747

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 20/81 (24%), Positives = 36/81 (44%)
 Frame = +2

Query: 245 QEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKI 424
           Q +H      S++D QF  L++  +D++  F++       + Y V+C N   +K  F + 
Sbjct: 243 QTKHYMQPFDSQID-QFHTLKQNSNDELMKFYETYISLLRDQYLVTCSNIKAIKKYFDET 301

Query: 425 LKSHDYTDKKSIETYEKYCLP 487
           +   D   +   E Y    LP
Sbjct: 302 VTCKDIVYQSLFEKYLPDDLP 322


>UniRef50_Q9NCG0 Cluster: Kinesin-like kinetochore motor protein
           CENP-meta; n=2; Drosophila melanogaster|Rep:
           Kinesin-like kinetochore motor protein CENP-meta -
           Drosophila melanogaster (Fruit fly)
          Length = 2244

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +2

Query: 317 SDKIDGFHDNIQYFK--DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 478
           +DKI     ++Q F   ++H+ V C+    LK K A++    D  +++S+   E+Y
Sbjct: 505 TDKIKKEIQDLQMFTSLEKHFEVECEEVQGLKEKLAEVTAQRDNLEQESLAEKERY 560


>UniRef50_A7SWJ9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 690

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 21/92 (22%), Positives = 52/92 (56%), Gaps = 4/92 (4%)
 Frame = +2

Query: 245 QEQHLRDRIKSKVDEQFDQLEREYSDK----IDGFHDNIQYFKDEHYSVSCQNGSVLKSK 412
           QE++L  + KS++++Q  QL+RE+S++    +D  +  +++ +DE+ + S      +++ 
Sbjct: 505 QEENLVSKSKSQLEQQRLQLQREHSNEMEKMLDKTNSRLKHMEDEYATRSATAQETVRTL 564

Query: 413 FAKILKSHDYTDKKSIETYEKYCLPQLVDKHN 508
             +I K  +   +  + + +K  +  + +KHN
Sbjct: 565 EGEIKKLKEENLRMRLSSEKK--IGSVSEKHN 594


>UniRef50_A0C6A6 Cluster: Chromosome undetermined scaffold_151,
           whole genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_151,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 442

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 17/70 (24%), Positives = 33/70 (47%)
 Frame = +2

Query: 167 QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDN 346
           ++YE  I+K            T++  Q Q  ++ IK + ++ F    R+  +K+D F D 
Sbjct: 204 KNYESKINKIYKQKYEKMDQLTQKVQQSQEHQELIKERSNQIFQTKIRKLKEKMDYFQDK 263

Query: 347 IQYFKDEHYS 376
           I + + +  S
Sbjct: 264 INFIEKKRLS 273


>UniRef50_Q59K46 Cluster: Likely vesicular transport factor Uso1p;
            n=1; Candida albicans|Rep: Likely vesicular transport
            factor Uso1p - Candida albicans (Yeast)
          Length = 1880

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 5/88 (5%)
 Frame = +2

Query: 263  DRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEH---YSVSCQNGSVLKSKFAKILKS 433
            ++ ++ + E  + + +EYSDKI      I   K+ H    +   +  + LK   AK+ + 
Sbjct: 1539 EKERAMLSENSETVIKEYSDKIKSLESKINSIKENHSKEITTHNEQKTSLKQDIAKLSQD 1598

Query: 434  HDYTDKKSIETYEKYC--LPQLVDKHNT 511
            H+ + +  +E  E     L   ++KHNT
Sbjct: 1599 HE-SAQTQLEDKENQLKELKASLEKHNT 1625


>UniRef50_A2QT24 Cluster: Contig An09c0030, complete genome; n=2;
            Pezizomycotina|Rep: Contig An09c0030, complete genome -
            Aspergillus niger
          Length = 1547

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 16/56 (28%), Positives = 25/56 (44%)
 Frame = +2

Query: 362  DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKHNTATWRYA 529
            D  + ++C N  + +    +     DY  K    TY +YC PQ++  H    WR A
Sbjct: 1142 DSEHLIACWNAVLARHDIFRSRSHLDYRGKGPRRTYARYC-PQVMRVHGFNLWREA 1196


>UniRef50_Q3IQE9 Cluster: Probable restriction/modification enzyme;
           n=1; Natronomonas pharaonis DSM 2160|Rep: Probable
           restriction/modification enzyme - Natronomonas pharaonis
           (strain DSM 2160 / ATCC 35678)
          Length = 1258

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 11/44 (25%), Positives = 25/44 (56%)
 Frame = +2

Query: 239 YAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEH 370
           ++ +  L +RI    +  +D +E  ++  +D   +N++Y K+EH
Sbjct: 640 WSYQSGLEERINHHTERDYDGVEEFFAPYVDDMLENVRYLKEEH 683


>UniRef50_Q4A5F4 Cluster: S-adenosylmethionine synthetase; n=4;
           Bacteria|Rep: S-adenosylmethionine synthetase -
           Mycoplasma synoviae (strain 53)
          Length = 382

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +3

Query: 111 TVIRDCHVDEQTRELVYINKIMNTQLTKPVLMMFNISGPIR 233
           T+I  CH +E+  E  + N I  TQ+ KPVL  FN+  P R
Sbjct: 175 TIIFSCHHNEKYNETKFKNYI-KTQILKPVLDEFNLELPER 214


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 708,284,707
Number of Sequences: 1657284
Number of extensions: 14207538
Number of successful extensions: 42778
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 40806
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42742
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62558016040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -