SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxoph...   116   8e-25
UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata ...   113   6e-24
UniRef50_P17500 Cluster: Major capsid protein; n=15; Nucleopolyh...   108   2e-22
UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata nucleopolyh...    86   1e-15
UniRef50_P35840 Cluster: Major capsid protein; n=12; Nucleopolyh...    80   5e-14
UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP...    61   3e-08
UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep: Vp3...    51   3e-05
UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostel...    50   8e-05
UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum granulovir...    49   1e-04
UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3; Nuc...    49   1e-04
UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -...    46   8e-04
UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea o...    43   0.007
UniRef50_A0NRY8 Cluster: Short-chain dehydrogenase/reductase SDR...    34   4.4  
UniRef50_Q5QBL6 Cluster: Cathepsin L; n=1; Culicoides sonorensis...    33   7.7  

>UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxophyes
           honmai NPV|Rep: Major capsid protein VP39 - Adoxophyes
           honmai nucleopolyhedrovirus
          Length = 312

 Score =  116 bits (278), Expect = 8e-25
 Identities = 87/247 (35%), Positives = 120/247 (48%), Gaps = 3/247 (1%)
 Frame = +3

Query: 30  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 209
           MAL+P G+   +   N CIFA + SFDAC  Y + CS DA  +DGW+IC  H    FKM 
Sbjct: 1   MALVPAGLTSSRSNSN-CIFAGVQSFDACYRYPNECSKDADSNDGWYICEYHASVHFKME 59

Query: 210 KMVLPIFDEDDNQFK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SFI* 389
           KM L I D  DN+   R++G  L    E  +             ++  V   P   + I 
Sbjct: 60  KMSLAIPDA-DNKVLFRTVGRSLVKHTEEGTARILVPNKNNYESVL-NVQDLPLAEALII 117

Query: 390 YITTKRRLTLYATI*NIPKFHKRHATRYTQRLRNYKKHSST---TNPNTFCSRVSRDELR 560
           ++  +  L     I    KF +  A RY    + Y    S     NP+ FC+ VS   LR
Sbjct: 118 HMIYE-NLEKQKEICERLKFTEHFADRYKNVQKLYSNTMSVLNMANPDHFCAEVSLTSLR 176

Query: 561 FFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETG 740
            F   +         D  F  +  F++NL+ +AVAPE ++I TE++  RN +TCII+ TG
Sbjct: 177 QF---SNEIGNEPAQDTNFELFPKFIKNLVTKAVAPEIMKIGTEDIYIRNCSTCIINSTG 233

Query: 741 LVASVPD 761
           LVA  PD
Sbjct: 234 LVAD-PD 239



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = +2

Query: 257 TIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 436
           T+ R LV + E G  RIL+P+  NY+ V N+  +  AE LI H+IY N E    IC+ LK
Sbjct: 76  TVGRSLVKHTEEGTARILVPNKNNYESVLNVQDLPLAEALIIHMIYENLEKQKEICERLK 135

Query: 437 YTE 445
           +TE
Sbjct: 136 FTE 138


>UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata
           NPV-A|Rep: Vp39 capsid - Mamestra configurata NPV-A
          Length = 325

 Score =  113 bits (271), Expect = 6e-24
 Identities = 82/243 (33%), Positives = 118/243 (48%), Gaps = 2/243 (0%)
 Frame = +3

Query: 30  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 209
           MAL P G    Q + N CIF +I  FD C TY SPCS DA  +DGWFIC  HL  RF+M 
Sbjct: 1   MALTPYGS--NQPQSNNCIFGAIRPFDTCRTYSSPCSNDASQEDGWFICEYHLSIRFRME 58

Query: 210 KMVLPIFDEDDNQFK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SF-I 386
           KMVLPI D +   +  RS+G  L I    S+      +   +  L       P    F +
Sbjct: 59  KMVLPIPDAEGTIYN-RSVGKSL-ISGTESNRVLIPTKTNYEDVLKLPSMSLPEQLIFHM 116

Query: 387 *YITTKRRLTLYATI*NIPKFHKRHATRYTQRLRNYKKH-SSTTNPNTFCSRVSRDELRF 563
            Y    ++  +   +     FH     +  +R+ N      + TNP  FC+RV+ +  R 
Sbjct: 117 IYDEPDKQNEICKLLQYNENFHS-DLYKVVERVYNKTAEVLAKTNPERFCARVNINNFRS 175

Query: 564 FDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETGL 743
           +   +       + +  +N   GFL+NLI ++VAP  +      +  RN+ATC I++ GL
Sbjct: 176 YGTAD----ETDIANVTYNAMPGFLKNLINKSVAPCTMDFPGGTINLRNAATCAINQQGL 231

Query: 744 VAS 752
           VA+
Sbjct: 232 VAT 234



 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%)
 Frame = +2

Query: 257 TIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 436
           ++ + L+   E    R+LIP+ TNY++V  L SM   EQLIFH+IY+  +  N IC  L+
Sbjct: 75  SVGKSLISGTESN--RVLIPTKTNYEDVLKLPSMSLPEQLIFHMIYDEPDKQNEICKLLQ 132

Query: 437 YTE 445
           Y E
Sbjct: 133 YNE 135


>UniRef50_P17500 Cluster: Major capsid protein; n=15;
           Nucleopolyhedrovirus|Rep: Major capsid protein - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 351

 Score =  108 bits (259), Expect = 2e-22
 Identities = 48/75 (64%), Positives = 59/75 (78%)
 Frame = +3

Query: 30  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 209
           MAL+  G++ R+   N CIF +I  FD+C+TY+SPCS DA  DDGWFIC+ HL  RFKMS
Sbjct: 1   MALVSPGVSSRRS-TNHCIFGAIEPFDSCVTYRSPCSSDASVDDGWFICDYHLKLRFKMS 59

Query: 210 KMVLPIFDEDDNQFK 254
           KMVLPI+DEDDNQ+K
Sbjct: 60  KMVLPIYDEDDNQYK 74



 Score =  105 bits (251), Expect = 2e-21
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query: 507 STTNPNTFCSRVSRDELRFFDVTNA-RTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQI 683
           S T+P  +CSRV+ D++RFFD       ++ G GD +FNN  GFL+NLIRRAVAPE LQI
Sbjct: 160 SLTDPQAYCSRVANDDVRFFDANVVDNNYQAGNGDTVFNNMPGFLRNLIRRAVAPETLQI 219

Query: 684 DTEELRFRNSATCIIDETGLVASV 755
           D+E+LR RN  TC+I+ TGLVA+V
Sbjct: 220 DSEDLRLRNCNTCVINNTGLVATV 243



 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 43/63 (68%), Positives = 49/63 (77%)
 Frame = +2

Query: 257 TIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 436
           TIARHLVG+KERG+KRIL+P+  NY  VFNL  MM AEQLIFHLIY+N   VN IC +LK
Sbjct: 76  TIARHLVGHKERGVKRILVPTRANYMTVFNLPGMMLAEQLIFHLIYDNRLEVNRICASLK 135

Query: 437 YTE 445
             E
Sbjct: 136 NNE 138


>UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: VP39 - Clanis bilineata
           nucleopolyhedrosis virus
          Length = 350

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 41/70 (58%), Positives = 49/70 (70%)
 Frame = +3

Query: 30  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 209
           MAL+  GMA  ++  N CIF S+  FDAC  Y+SPCS DA ++DGW IC+ HL  RFKM 
Sbjct: 1   MALVVSGMATGRIN-NYCIFGSVQPFDACGPYRSPCSDDAKNNDGWLICDYHLSTRFKME 59

Query: 210 KMVLPIFDED 239
           KMVLPI D D
Sbjct: 60  KMVLPIPDAD 69



 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 39/79 (49%), Positives = 49/79 (62%)
 Frame = +3

Query: 519 PNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEEL 698
           PN +CSR    + R + VT+       VG Q+FN    FLQNLI +AV PE +QI+ EEL
Sbjct: 164 PNRYCSRPLYTDDRIWSVTD----ENNVGGQVFNEMPPFLQNLISKAVGPEIMQIENEEL 219

Query: 699 RFRNSATCIIDETGLVASV 755
             RN ATC I ++GLVA V
Sbjct: 220 LLRNCATCHITQSGLVADV 238



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/67 (41%), Positives = 42/67 (62%)
 Frame = +2

Query: 245 SIQMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 424
           ++  T+AR LV +K  G +RIL+P+  NY  V N+ ++  AEQ IFH+IY N+     IC
Sbjct: 72  ALNRTLARSLVNHKAIGDERILVPTKRNYMSVLNILALQLAEQYIFHIIYENDVERERIC 131

Query: 425 DNLKYTE 445
             L+ +E
Sbjct: 132 QMLEISE 138


>UniRef50_P35840 Cluster: Major capsid protein; n=12;
           Nucleopolyhedrovirus|Rep: Major capsid protein -
           Lymantria dispar multicapsid nuclear polyhedrosis virus
           (LdMNPV)
          Length = 356

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 37/80 (46%), Positives = 54/80 (67%)
 Frame = +3

Query: 30  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 209
           MAL+   ++  ++R N C+F ++  FD C  Y SPCSPD+ ++DGWFIC+ H   RFK+ 
Sbjct: 1   MALVSGALSTNRLR-NYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIE 59

Query: 210 KMVLPIFDEDDNQFK*RSLG 269
           KMVLPI D + N +  R++G
Sbjct: 60  KMVLPIPDAEGNIYN-RTVG 78



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 30/63 (47%), Positives = 42/63 (66%)
 Frame = +2

Query: 257 TIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 436
           T+ + LV +K  G  R+LIP+  NY+ V NLNSM  AEQL+ H+IY+N EA   +C  L+
Sbjct: 76  TVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCKALQ 135

Query: 437 YTE 445
           + E
Sbjct: 136 HNE 138



 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 33/81 (40%), Positives = 47/81 (58%)
 Frame = +3

Query: 513 TNPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTE 692
           TNP  +CS+V+ +  R +   +       V   +F +   FL+NLI  AVAPE + ID +
Sbjct: 162 TNPRRYCSQVNSNYARIWTTDDVN-----VAGNVFESMPPFLKNLINVAVAPEQIMIDEK 216

Query: 693 ELRFRNSATCIIDETGLVASV 755
            L  RN  TC ID++GLVA+V
Sbjct: 217 TLVIRNCPTCNIDDSGLVANV 237


>UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP39
           - Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 302

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 28/68 (41%), Positives = 40/68 (58%)
 Frame = +2

Query: 242 QSIQMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVI 421
           Q +   + + LV +  R   RILIP+  NYQ V N++ +  AE+L+ HLIYNN  A   I
Sbjct: 73  QKLYRIVGKSLVSHNARANDRILIPTQENYQAVMNVSMLPPAERLVLHLIYNNRTAAAEI 132

Query: 422 CDNLKYTE 445
           C+ L+  E
Sbjct: 133 CNQLRQQE 140



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 2/70 (2%)
 Frame = +3

Query: 30  MALMPVGMAPRQMRVNRCIFASI--VSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFK 203
           MAL+  G A  +M+ N CIF  +  + F+ C  Y+SPCS DA  +DG F+C  HL + FK
Sbjct: 1   MALVSGGNANSRMK-NYCIFQGVRPIEFNQCSNYRSPCSDDASQNDGVFMCQYHLSRFFK 59

Query: 204 MSKMVLPIFD 233
           + K  + I D
Sbjct: 60  IEKTSIAIPD 69



 Score = 37.9 bits (84), Expect = 0.27
 Identities = 25/79 (31%), Positives = 37/79 (46%)
 Frame = +3

Query: 513 TNPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTE 692
           T+P  FCS V+ +++R F      T       + +N+   F++NLI   VAPE L +   
Sbjct: 161 TDPEAFCSVVASNDIRSFGNEADLT-------RTYNSLPPFIKNLINTLVAPEVLTLGNN 213

Query: 693 ELRFRNSATCIIDETGLVA 749
               +  AT  I   GL A
Sbjct: 214 TFPLKACATVSITTNGLQA 232


>UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep:
           Vp39-capsid - Adoxophyes orana granulovirus (AoGV)
          Length = 291

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 6/74 (8%)
 Frame = +3

Query: 45  VGMAPRQMRVNRCIFASIVS----FDACITYKSPCSPDAYHD--DGWFICNSHLIKRFKM 206
           + + P ++  N CIF  +V     +  C  Y SPCSPDA +   DG FICN HL K FK+
Sbjct: 4   INVGPCELN-NYCIFQGVVGMMPDYYRCENYSSPCSPDASNSNLDGTFICNYHLNKYFKI 62

Query: 207 SKMVLPIFDEDDNQ 248
            K    I    DN+
Sbjct: 63  LKSSFRIPSGKDNK 76



 Score = 36.3 bits (80), Expect = 0.83
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = +3

Query: 570 VTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETGLVA 749
           +T  + +R    +  +N +S FL+NLI R V P  + I+   ++  N  TC     GL  
Sbjct: 173 LTTNKENRVFNNETYYNQFSPFLKNLINRLVRPITMTINNYVIKIDNVDTCNFTSDGL-- 230

Query: 750 SVPD 761
           +VPD
Sbjct: 231 TVPD 234


>UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF79 peptide - Plutella xylostella
           granulovirus
          Length = 320

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/71 (42%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +3

Query: 51  MAPRQMRV-NRCIFASIVSFDA--CITYKSPCSPDAYHDDGWFICNSHLIKRFKMSKMVL 221
           M+ RQ RV N CIF ++   ++  C      CS DA +DDG FICN HL   F + KM L
Sbjct: 2   MSLRQNRVYNNCIFQAVSYSNSSLCADPVLHCSKDASNDDGTFICNHHLSMYFPLEKMTL 61

Query: 222 PIFDEDDNQFK 254
            I       FK
Sbjct: 62  EIPSGTGTSFK 72



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 5/69 (7%)
 Frame = +2

Query: 245 SIQMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEA----- 409
           S ++ I + LV  ++   + I+IPS  NY +   +N+M  AE+ I + IY          
Sbjct: 70  SFKLLIGKSLV--QQDATRNIIIPSKANYIDYLRVNNMSPAEKFIMYSIYGESATEPTGL 127

Query: 410 VNVICDNLK 436
           +  +C++L+
Sbjct: 128 ITQLCESLR 136


>UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum
           granulovirus|Rep: ORF086 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 292

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/53 (49%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +3

Query: 75  NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMSKMVLPI 227
           N CIF  +    F  C  Y+ PC    Y+DDG FIC  HL K FKM KMV+ I
Sbjct: 12  NLCIFQGVQPPEFLNCRPYEPPCI-QPYNDDGTFICQYHLAKYFKMEKMVVRI 63



 Score = 39.5 bits (88), Expect = 0.089
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 516 NPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEE 695
           NP  +C      ++R FD         GV   +F+    FL+NLIR  V P+ + +   +
Sbjct: 158 NPAIYCRPEIIRDIRSFD----NPPGNGVQTAVFDQMPPFLKNLIRLTVRPQTMTVSNTQ 213

Query: 696 LRFRNSATC-IIDETGLVAS 752
           L      TC ++ E GLVA+
Sbjct: 214 LLLAQVPTCDLVPERGLVAA 233


>UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3;
           Nucleopolyhedrovirus|Rep: Major viral capsid protein 39
           - Neodiprion abietis nucleopolyhedrovirus
          Length = 315

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 16/45 (35%), Positives = 33/45 (73%)
 Frame = +2

Query: 302 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 436
           R+++P+  NY+++F +  +  + QL+FHL+Y N+ A++ IC ++K
Sbjct: 104 RVIVPTRRNYEDIFKVAYLPISYQLVFHLLYQNQSAIDKICQDVK 148


>UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 329

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +3

Query: 75  NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMSKMVLPI 227
           N CIF  +    F  C  Y  PCS D  + DG F+C+ HL + FK+ K V  I
Sbjct: 16  NLCIFQGVQPPEFMNCGIYTPPCSDDCVNKDGTFVCSYHLARYFKLKKEVFEI 68



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +3

Query: 519 PNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEEL 698
           P+  C     + +R F   + R  +     + F     F++NLI R V P  LQI + EL
Sbjct: 190 PSIICRPTREETVRTFSSNDNR--QPDENQRAFEAMPNFIKNLIMRLVRPVTLQIGSTEL 247

Query: 699 RFRNSATCIID-ETGLV 746
               SATC I+ + GL+
Sbjct: 248 ILDQSATCRIEPQQGLI 264


>UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea
           operculella granulovirus|Rep: Capsid protein VP39 -
           Phthorimaea operculella granulovirus
          Length = 293

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 28/65 (43%), Positives = 34/65 (52%), Gaps = 5/65 (7%)
 Frame = +3

Query: 75  NRCIFASI-VSFDACITYKSPCSPDAYHD--DGWFICNSHLIKRFKM--SKMVLPIFDED 239
           N CIF  +   FD C  Y   CS DA +   DG FICN HL K F++  SK  +P    D
Sbjct: 13  NYCIFQGVNYQFD-CDGYTRQCSEDARYSQLDGTFICNFHLGKYFRILKSKFEIPSGGVD 71

Query: 240 DNQFK 254
           +  FK
Sbjct: 72  NRSFK 76



 Score = 34.7 bits (76), Expect = 2.5
 Identities = 22/68 (32%), Positives = 31/68 (45%)
 Frame = +3

Query: 558 RFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDET 737
           R F    A+       D+ F     FLQNL++  V P  L+I T  L    + TC   + 
Sbjct: 169 RLFCPPKAKMLYSYTSDESFKKLPKFLQNLVQCLVKPVKLEIGTFSLVLETANTCSFTDN 228

Query: 738 GLVASVPD 761
           GL  +VP+
Sbjct: 229 GL--AVPE 234


>UniRef50_A0NRY8 Cluster: Short-chain dehydrogenase/reductase SDR;
           n=1; Stappia aggregata IAM 12614|Rep: Short-chain
           dehydrogenase/reductase SDR - Stappia aggregata IAM
           12614
          Length = 270

 Score = 33.9 bits (74), Expect = 4.4
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 2/90 (2%)
 Frame = +2

Query: 215 GFAHFRRRRQSIQMTIARHLVGNKERGIKRILIPSATNY--QEVFNLNSMMQAEQLIFHL 388
           G AH  R+R    +T    LV    RGI      S   Y  + V    S    E++   +
Sbjct: 8   GKAHPERKRYMFDLTGQVALVTGASRGIGEAAARSLAKYGAKVVLAARSDKDIERIAGEI 67

Query: 389 IYNNEEAVNVICDNLKYTEVSQAARNALYT 478
               ++A  V+CD   Y +V +A + A+ T
Sbjct: 68  RAEGQDATAVVCDVADYDDVVKAVQTAVDT 97


>UniRef50_Q5QBL6 Cluster: Cathepsin L; n=1; Culicoides
           sonorensis|Rep: Cathepsin L - Culicoides sonorensis
          Length = 331

 Score = 33.1 bits (72), Expect = 7.7
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +3

Query: 606 DQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATC 722
           ++L  N  G+++  +RR +APE    DT+++  +N A C
Sbjct: 99  NELMTNADGWIEKPLRRQLAPESYAWDTKDVPVKNQAQC 137


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 766,015,186
Number of Sequences: 1657284
Number of extensions: 14813709
Number of successful extensions: 34406
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 33267
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34389
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63381147830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -