SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q086L4 Cluster: TonB-dependent receptor C-terminal regi...    35   2.4  
UniRef50_Q891V4 Cluster: Probably transmembrane protein; n=1; Cl...    33   5.5  

>UniRef50_Q086L4 Cluster: TonB-dependent receptor C-terminal region
           domain lipoprotein precursor; n=1; Shewanella
           frigidimarina NCIMB 400|Rep: TonB-dependent receptor
           C-terminal region domain lipoprotein precursor -
           Shewanella frigidimarina (strain NCIMB 400)
          Length = 691

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 14/43 (32%), Positives = 26/43 (60%)
 Frame = +1

Query: 187 HKLDHTVINVYILYLCHVIYRMCRSIPESEDKIGDKLDLKKST 315
           H    +VI   +LY+CH    +  ++ ES D + ++LDL++S+
Sbjct: 4   HPFSLSVIAAAVLYVCHSTNAVAETVTESIDNLNNQLDLQQSS 46


>UniRef50_Q891V4 Cluster: Probably transmembrane protein; n=1;
           Clostridium tetani|Rep: Probably transmembrane protein -
           Clostridium tetani
          Length = 482

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = -3

Query: 322 LFSCFFLDLAYHQFYLRFRESIDTSCILHDIDTVCRHL*RYDLIYVKQSST*TYVTII 149
           L + FFL L  +  Y   R+SI    +L  I T  R L  +DL+++K +   TY+TI+
Sbjct: 46  LVALFFLILDIYLIYEDKRKSILLFLLLLPIFTTVRRLFYFDLLFMKITFETTYITIL 103


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 663,314,233
Number of Sequences: 1657284
Number of extensions: 12579706
Number of successful extensions: 27230
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 26291
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27227
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59677054775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -