SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P11138 Cluster: Trans-activating transcriptional regula...   177   2e-43
UniRef50_P41716 Cluster: Trans-activating transcriptional regula...    96   7e-19
UniRef50_A0C9F0 Cluster: Chromosome undetermined scaffold_16, wh...    42   0.021
UniRef50_A0EYQ9 Cluster: Immediately early 1; n=1; Ecotropis obl...    36   1.4  
UniRef50_Q555X5 Cluster: MIZ type Zn finger-containing protein; ...    36   1.4  
UniRef50_A6Q2P7 Cluster: Flagellar hook-associated protein 2 Fli...    34   3.3  
UniRef50_A5K9F0 Cluster: Putative uncharacterized protein; n=1; ...    34   3.3  
UniRef50_A0H7T7 Cluster: Putative uncharacterized protein; n=1; ...    34   4.3  
UniRef50_Q22D27 Cluster: Response regulator receiver domain cont...    33   5.7  
UniRef50_A6DER9 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q232N7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_Q1RL92 Cluster: Zinc finger protein; n=1; Ciona intesti...    33   7.5  
UniRef50_A7RZ47 Cluster: Predicted protein; n=1; Nematostella ve...    33   7.5  
UniRef50_Q9FF61 Cluster: Putative SWI/SNF-related matrix-associa...    33   7.5  
UniRef50_A2E4W6 Cluster: Beige/BEACH domain containing protein; ...    33   9.9  
UniRef50_A5E7A6 Cluster: Putative uncharacterized protein; n=1; ...    33   9.9  

>UniRef50_P11138 Cluster: Trans-activating transcriptional
           regulatory protein; n=11; Nucleopolyhedrovirus|Rep:
           Trans-activating transcriptional regulatory protein -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 582

 Score =  177 bits (432), Expect = 2e-43
 Identities = 79/81 (97%), Positives = 81/81 (100%)
 Frame = +3

Query: 507 MKPKYKKSTIQSCATLEQTINHNTNICTVASTQEITHYFTNDFAPYLMRFDDNDYNSNRF 686
           ++PKYKKSTIQSCATLEQTINHNTNICTVASTQEITHYFTNDFAPYLMRFDDNDYNSNRF
Sbjct: 155 LRPKYKKSTIQSCATLEQTINHNTNICTVASTQEITHYFTNDFAPYLMRFDDNDYNSNRF 214

Query: 687 SDHMSETGYYMFVVKKSEVKP 749
           SDHMSETGYYMFVVKKSEVKP
Sbjct: 215 SDHMSETGYYMFVVKKSEVKP 235



 Score =  138 bits (334), Expect = 1e-31
 Identities = 65/71 (91%), Positives = 68/71 (95%)
 Frame = +3

Query: 42  MTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAA 221
           MTQINFNASYTSA TPSRASFDN YSEFCDKQ PNDYL+YYN+PTPDGADTV+SDSETAA
Sbjct: 1   MTQINFNASYTSASTPSRASFDNSYSEFCDKQ-PNDYLSYYNHPTPDGADTVISDSETAA 59

Query: 222 ASNFLASVNSL 254
           ASNFLASVNSL
Sbjct: 60  ASNFLASVNSL 70



 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 43/69 (62%), Positives = 52/69 (75%)
 Frame = +1

Query: 361 EPSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQFNKNK*SLNTRKAQFK 540
           +PSPSSAY+AESFE S GVNQPSA GTKRKLDEYLD+SQ VVGQFNK K     +K+  +
Sbjct: 106 QPSPSSAYHAESFEHSAGVNQPSATGTKRKLDEYLDNSQGVVGQFNKIKLRPKYKKSTIQ 165

Query: 541 AVQPLSRQL 567
           +   L + +
Sbjct: 166 SCATLEQTI 174



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/38 (78%), Positives = 32/38 (84%)
 Frame = +2

Query: 260 DNDIMECLLKTTDNLGEAVSSAYYSESLELPVAENHRP 373
           DND++ECLLKTTDNL EAVSSAYYSESLE PV E   P
Sbjct: 72  DNDLVECLLKTTDNLEEAVSSAYYSESLEQPVVEQPSP 109


>UniRef50_P41716 Cluster: Trans-activating transcriptional
           regulatory protein; n=11; Nucleopolyhedrovirus|Rep:
           Trans-activating transcriptional regulatory protein -
           Choristoneura fumiferana nuclear polyhedrosis virus
           (CfMNPV)
          Length = 560

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 45/82 (54%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +3

Query: 507 MKPKYKKSTIQSCATLEQTINHNTNICTVASTQEITHYFTNDFAPYL-MRFDDNDYNSNR 683
           M+ +YKK+TIQ+  +L +  N+NT ICTVA T +I  YF +DF+ YL  +  D   ++NR
Sbjct: 136 MRQRYKKATIQNKTSLTEECNYNTEICTVAPTDQIAEYFKHDFSVYLEKQKSDCQMSANR 195

Query: 684 FSDHMSETGYYMFVVKKSEVKP 749
           FSD++SETGYY+FVVKKSE KP
Sbjct: 196 FSDYISETGYYVFVVKKSEHKP 217


>UniRef50_A0C9F0 Cluster: Chromosome undetermined scaffold_16, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_16, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1580

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/65 (29%), Positives = 34/65 (52%)
 Frame = +3

Query: 549  TLEQTINHNTNICTVASTQEITHYFTNDFAPYLMRFDDNDYNSNRFSDHMSETGYYMFVV 728
            TL +TI    ++    +  ++T +  ND  P +  F+ N YNS   + H+S+  YY  ++
Sbjct: 1122 TLSETIEQLISVAIKLNNSDLTEF--NDLNPLIFYFEFNSYNSLALAQHISQNYYYYNIL 1179

Query: 729  KKSEV 743
             KS +
Sbjct: 1180 SKSSL 1184


>UniRef50_A0EYQ9 Cluster: Immediately early 1; n=1; Ecotropis
           obliqua NPV|Rep: Immediately early 1 - Ecotropis obliqua
           NPV
          Length = 721

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 14/26 (53%), Positives = 20/26 (76%)
 Frame = +3

Query: 663 NDYNSNRFSDHMSETGYYMFVVKKSE 740
           ++ N  RF+D+M+ T YYMFVV KS+
Sbjct: 330 DESNDKRFADYMTSTSYYMFVVCKSK 355


>UniRef50_Q555X5 Cluster: MIZ type Zn finger-containing protein;
           n=3; Dictyostelium discoideum|Rep: MIZ type Zn
           finger-containing protein - Dictyostelium discoideum AX4
          Length = 834

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 6/82 (7%)
 Frame = +3

Query: 27  NNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNY------YNNPTPDGA 188
           N+ TT T  N N++Y S+   S ++ +  Y+   +    N+Y NY      YNN   +  
Sbjct: 153 NSTTTTTTTNNNSNYNSSNNNSNSNNNFNYNNNNNNYNNNNYNNYNNYNNNYNNNNYNYN 212

Query: 189 DTVVSDSETAAASNFLASVNSL 254
            ++ S+    A++NF   V  L
Sbjct: 213 GSINSEHHNQASNNFQLQVQKL 234


>UniRef50_A6Q2P7 Cluster: Flagellar hook-associated protein 2 FliD;
           n=1; Nitratiruptor sp. SB155-2|Rep: Flagellar
           hook-associated protein 2 FliD - Nitratiruptor sp.
           (strain SB155-2)
          Length = 452

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = -2

Query: 349 QLKGFRIISRTNCFSEIISGLEQTFHYIVIISNELTLAKKFEAAAVSLSDTTVSA 185
           +L G  I + TN FS+++SG+E T   +   ++ LT+AK F     SL DT VSA
Sbjct: 237 KLNGIIIENATNTFSDVLSGVEITAQEVG--TSSLTVAKDFSDIENSL-DTIVSA 288


>UniRef50_A5K9F0 Cluster: Putative uncharacterized protein; n=1;
            Plasmodium vivax|Rep: Putative uncharacterized protein -
            Plasmodium vivax
          Length = 1926

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 582  ICTVASTQEITHYFTNDFAPYLMRFDDNDYNSNRFSDHMSETGYY 716
            I T  + +EI +YF N +  YL RFD  +    +F+D +S   +Y
Sbjct: 919  ILTKKNREEIAYYFLNYYTKYLFRFDLPNNVVIKFTDRISGLSFY 963


>UniRef50_A0H7T7 Cluster: Putative uncharacterized protein; n=1;
           Comamonas testosteroni KF-1|Rep: Putative
           uncharacterized protein - Comamonas testosteroni KF-1
          Length = 273

 Score = 33.9 bits (74), Expect = 4.3
 Identities = 21/98 (21%), Positives = 40/98 (40%), Gaps = 4/98 (4%)
 Frame = +3

Query: 9   GGDTIVNNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGA 188
           G D  ++    + + N +   +SAP   R SFD+G+ E       + +  +  +  P G 
Sbjct: 108 GNDVPIDLARLIAKANNSVLTSSAPLNMRLSFDHGHDELVVSAWSHPFQEFCLHSCPSGF 167

Query: 189 DTVVSDSETAAASNFLASVNSLLMITI*W----NVCSR 290
           D VV           + +++    + + W     VC+R
Sbjct: 168 DVVVLHCAARQGGKTICNISGAQRLLMPWALKNEVCNR 205


>UniRef50_Q22D27 Cluster: Response regulator receiver domain
            containing protein; n=1; Tetrahymena thermophila
            SB210|Rep: Response regulator receiver domain containing
            protein - Tetrahymena thermophila SB210
          Length = 1468

 Score = 33.5 bits (73), Expect = 5.7
 Identities = 20/74 (27%), Positives = 36/74 (48%)
 Frame = +3

Query: 117  SEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSLLMITI*WNVCSRPL 296
            SE C++   N+YLNY+N+P  + +  V+S+       N    +           VC +P 
Sbjct: 1180 SELCNQVLKNNYLNYFNSPKQEESCDVMSECTEKKFPNQSEKL----------KVCEKPQ 1229

Query: 297  IISEKQLVLLIIRN 338
             +  K+++L I +N
Sbjct: 1230 KLQRKKMILKIDQN 1243


>UniRef50_A6DER9 Cluster: Putative uncharacterized protein; n=1;
           Caminibacter mediatlanticus TB-2|Rep: Putative
           uncharacterized protein - Caminibacter mediatlanticus
           TB-2
          Length = 224

 Score = 33.1 bits (72), Expect = 7.5
 Identities = 12/42 (28%), Positives = 25/42 (59%)
 Frame = +2

Query: 239 KRQFVTDDNDIMECLLKTTDNLGEAVSSAYYSESLELPVAEN 364
           K QF+ +  +I+E L+ T+D +     +  Y ++ +LP+ +N
Sbjct: 117 KEQFIRNSRNIVELLIPTSDKVRPLYEAIVYIDTFDLPIKQN 158


>UniRef50_Q232N7 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 469

 Score = 33.1 bits (72), Expect = 7.5
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = +3

Query: 30  NQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDS 209
           N  +++Q+N  +   S   P+ +S  N  S    +++ N+Y+N +NN   + A TV  D 
Sbjct: 341 NFQSISQLNNLSQTYSQLKPALSSIQNNLSPLLIQKKNNNYINNFNNFNSNFASTVFQDD 400

Query: 210 E 212
           +
Sbjct: 401 Q 401


>UniRef50_Q1RL92 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 1089

 Score = 33.1 bits (72), Expect = 7.5
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query: 48  QINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYY-NNPTPDGA 188
           Q    +S +S P+PS+A++D+ YS+  D +  +D+ +Y    P  +G+
Sbjct: 112 QNRHQSSPSSIPSPSKATYDSKYSQSIDSEVDSDHRSYVAATPNKEGS 159


>UniRef50_A7RZ47 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 948

 Score = 33.1 bits (72), Expect = 7.5
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = -3

Query: 306 PRLSVVLSKHSIISLSSVTN*RLPKSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYH 127
           PR  VV     +  + S  +  L   + +L+        RLH  W C ++  S  A++YH
Sbjct: 508 PRTQVVTKLIELADVLSDKHGNLVSFMAVLEGLALPQVTRLHHTWSCLHHQYSSSAIMYH 567

Query: 126 KTL 118
            TL
Sbjct: 568 STL 570


>UniRef50_Q9FF61 Cluster: Putative SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin subfamily A
           member 3-like 1; n=2; Arabidopsis thaliana|Rep: Putative
           SWI/SNF-related matrix-associated actin-dependent
           regulator of chromatin subfamily A member 3-like 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 881

 Score = 33.1 bits (72), Expect = 7.5
 Identities = 16/58 (27%), Positives = 37/58 (63%)
 Frame = +3

Query: 171 PTPDGADTVVSDSETAAASNFLASVNSLLMITI*WNVCSRPLIISEKQLVLLIIRNPL 344
           P PD ++T   D++++  S+ ++++ SLLM +   N  ++ ++ S+ + +LL++  PL
Sbjct: 688 PPPDSSNTDGEDAKSSTKSSKVSALLSLLMASRQENPNTKSVVFSQFRKMLLLLETPL 745


>UniRef50_A2E4W6 Cluster: Beige/BEACH domain containing protein; n=1;
            Trichomonas vaginalis G3|Rep: Beige/BEACH domain
            containing protein - Trichomonas vaginalis G3
          Length = 2475

 Score = 32.7 bits (71), Expect = 9.9
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +2

Query: 167  QSHAGWSRHGSI*QRDCSSFKLFGKRQFVTDDNDIMECLLKTTDNLGEAVSSA-YYSESL 343
            Q    W R  S+   +C  FKL    +F   DN +   + +   N+  AV     Y E L
Sbjct: 1702 QKEIKWKRDPSLQNYNCP-FKLRPNNKF---DNHMKASIARDEGNMNTAVEKTKIYEEEL 1757

Query: 344  ELPVAENHRPVLL 382
            +   AEN  PVLL
Sbjct: 1758 KRKYAENKPPVLL 1770


>UniRef50_A5E7A6 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 727

 Score = 32.7 bits (71), Expect = 9.9
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 6/89 (6%)
 Frame = +3

Query: 3   DIGGDTIVNNQTTM-TQINFNASYTSAPTPSRASFDNGYSEFCDKQQPND-YLN-YYNNP 173
           D GG+T  NN  +     N N+SY S+ + S+ + +N  +++ D    ND + N Y  N 
Sbjct: 403 DYGGNTKNNNNDSNDVDKNTNSSYISSSSSSKKN-NNNNNKYKDNDVDNDTHKNKYQQNQ 461

Query: 174 TPDGADTVVSDSETAA---ASNFLASVNS 251
            P+  D +   S   A   AS+  AS+NS
Sbjct: 462 RPNSPDKLRHKSARRAFEEASSSSASLNS 490


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 704,824,058
Number of Sequences: 1657284
Number of extensions: 14253287
Number of successful extensions: 43774
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 41439
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43740
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 61734884250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -