SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9YML3 Cluster: Uncharacterized Bro-N domain-containing...   123   3e-27
UniRef50_P24655 Cluster: Uncharacterized Bro-N domain-containing...   120   3e-26
UniRef50_Q287E9 Cluster: BRO-D; n=3; unclassified Nucleopolyhedr...   118   8e-26
UniRef50_Q0N3Z7 Cluster: BRO-B; n=13; Nucleopolyhedrovirus|Rep: ...   117   2e-25
UniRef50_Q287M2 Cluster: BRO-A; n=1; Agrotis segetum nucleopolyh...   109   4e-23
UniRef50_A1YJ59 Cluster: BRO; n=1; Spodoptera frugiperda MNPV|Re...    94   2e-18
UniRef50_Q0IL61 Cluster: Bro-e; n=1; Leucania separata nuclear p...    88   2e-16
UniRef50_Q06KR1 Cluster: Baculovirus repeated ORF-a; n=6; Nucleo...    84   3e-15
UniRef50_Q9E231 Cluster: Orf60-like protien; n=14; Baculoviridae...    60   4e-08
UniRef50_Q9PYR4 Cluster: ORF131; n=1; Xestia c-nigrum granulovir...    59   9e-08
UniRef50_Q8QLB1 Cluster: BRO-g; n=3; Nucleopolyhedrovirus|Rep: B...    51   2e-05
UniRef50_Q8QLB2 Cluster: BRO-f; n=4; Nucleopolyhedrovirus|Rep: B...    48   2e-04
UniRef50_Q4KT11 Cluster: BRO-B; n=2; Nucleopolyhedrovirus|Rep: B...    47   3e-04
UniRef50_A4KXK3 Cluster: Bro17; n=2; Heliothis virescens ascovir...    47   3e-04
UniRef50_Q80LR2 Cluster: Baculovirus repeated ORF; n=1; Adoxophy...    46   9e-04
UniRef50_A3HNE6 Cluster: BRO domain protein domain protein; n=1;...    45   0.001
UniRef50_Q4KT25 Cluster: BRO-A; n=3; root|Rep: BRO-A - Chrysodei...    45   0.002
UniRef50_Q99GY7 Cluster: Bro; n=27; root|Rep: Bro - Helicoverpa ...    44   0.002
UniRef50_A4XBY6 Cluster: BRO domain protein domain protein; n=2;...    44   0.002
UniRef50_Q06KD3 Cluster: Baculovirus repeated ORF; n=1; Anticars...    43   0.005
UniRef50_A0RLT8 Cluster: Antirepressor, phage associated; n=3; B...    43   0.005
UniRef50_Q8QLL3 Cluster: BRO-a; n=1; Mamestra configurata NPV-A|...    43   0.006
UniRef50_Q0IKW6 Cluster: Bro-i; n=3; dsDNA viruses, no RNA stage...    43   0.006
UniRef50_Q2L2E4 Cluster: Phage protein; n=1; Bordetella avium 19...    43   0.006
UniRef50_Q919G9 Cluster: CUN108 putative bro protein, ATP_GTP_A ...    42   0.008
UniRef50_A5IZL9 Cluster: Bro-1; n=1; Spodoptera litura granulovi...    42   0.008
UniRef50_A5IZW6 Cluster: Bro-5; n=2; Spodoptera litura granulovi...    42   0.011
UniRef50_Q9PYR5 Cluster: ORF130; n=1; Xestia c-nigrum granulovir...    42   0.014
UniRef50_Q3Y2L0 Cluster: BRO, N-terminal; n=1; Enterococcus faec...    42   0.014
UniRef50_Q0I4I5 Cluster: Putative uncharacterized protein; n=2; ...    41   0.025
UniRef50_A7LYR8 Cluster: Putative uncharacterized protein; n=2; ...    41   0.025
UniRef50_A5MYH6 Cluster: Predicted prophage antirepressor; n=1; ...    41   0.025
UniRef50_Q9YML4 Cluster: Ld-bro-i; n=1; Lymantria dispar MNPV|Re...    40   0.032
UniRef50_Q47HX8 Cluster: BRO, N-terminal; n=1; Dechloromonas aro...    40   0.032
UniRef50_Q1J4V4 Cluster: Phage antirepressor protein; n=1; Strep...    40   0.032
UniRef50_Q0SWM4 Cluster: BRO family, N-terminal domain protein; ...    40   0.032
UniRef50_A6PK75 Cluster: BRO domain protein; n=1; Victivallis va...    40   0.032
UniRef50_Q5UP77 Cluster: Uncharacterized Bro-N domain-containing...    40   0.032
UniRef50_Q7N339 Cluster: Similar to bacteriophage protein; n=2; ...    40   0.043
UniRef50_Q30XK5 Cluster: Prophage antirepressor-like; n=2; Desul...    40   0.043
UniRef50_A6LVQ3 Cluster: Prophage antirepressor; n=3; root|Rep: ...    40   0.043
UniRef50_Q185G9 Cluster: Putative phage-related regulatory prote...    40   0.057
UniRef50_A4P0J2 Cluster: Possible prophage antirepressor; n=1; H...    40   0.057
UniRef50_A0A7D8 Cluster: Prophage antirepressor; n=1; Cyanophage...    40   0.057
UniRef50_A5IZQ5 Cluster: Bro-2; n=1; Spodoptera litura granulovi...    39   0.075
UniRef50_Q92FM4 Cluster: Lin0080 protein; n=14; root|Rep: Lin008...    39   0.075
UniRef50_A5I4G4 Cluster: BRO family protein; n=1; Clostridium bo...    39   0.075
UniRef50_A4TYQ8 Cluster: BRO, N-terminal; n=1; Magnetospirillum ...    39   0.099
UniRef50_A3QSE3 Cluster: Putative antirepressor; n=1; Clostridiu...    39   0.099
UniRef50_P44189 Cluster: Uncharacterized protein HI1418; n=8; Pa...    39   0.099
UniRef50_Q9YMQ6 Cluster: Ld-bro-c; n=6; dsDNA viruses, no RNA st...    38   0.13 
UniRef50_Q919R4 Cluster: CUN001 putative bro protein, ATP_GTP_A ...    38   0.13 
UniRef50_A4KXK8 Cluster: Bro20; n=1; Heliothis virescens ascovir...    38   0.13 
UniRef50_Q5L2M6 Cluster: Phage associated-antirepressor; n=4; ro...    38   0.13 
UniRef50_A7A2N3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.13 
UniRef50_Q9YVP8 Cluster: ORF MSV194 ALI motif gene family protei...    38   0.17 
UniRef50_Q9PAJ2 Cluster: Phage-related protein; n=22; Gammaprote...    38   0.17 
UniRef50_Q8D9R6 Cluster: Prophage antirepressor; n=1; Vibrio vul...    38   0.17 
UniRef50_Q3J623 Cluster: Putative uncharacterized protein; n=1; ...    38   0.17 
UniRef50_Q03FD4 Cluster: Uncharacterized phage-encoded protein; ...    38   0.17 
UniRef50_A1AN22 Cluster: BRO domain protein domain protein; n=1;...    38   0.17 
UniRef50_Q65PV1 Cluster: Lj965 prophage antirepressor; n=4; root...    38   0.23 
UniRef50_A6TLJ8 Cluster: Prophage antirepressor; n=5; root|Rep: ...    38   0.23 
UniRef50_A6NWY1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.23 
UniRef50_A3VVX0 Cluster: Hypothetical BRO family protein; n=1; R...    38   0.23 
UniRef50_Q7Y4K9 Cluster: Gp15; n=9; root|Rep: Gp15 - Streptococc...    38   0.23 
UniRef50_UPI0000397D5D Cluster: COG3617: Prophage antirepressor;...    37   0.30 
UniRef50_Q8FRD3 Cluster: Putative uncharacterized protein; n=1; ...    37   0.30 
UniRef50_Q6NK48 Cluster: Putative anti-repressor protein; n=3; C...    37   0.30 
UniRef50_Q5F6A8 Cluster: Putative uncharacterized protein; n=2; ...    37   0.30 
UniRef50_A6NXW4 Cluster: Putative uncharacterized protein; n=1; ...    37   0.30 
UniRef50_A3DI85 Cluster: BRO-like protein; n=1; Clostridium ther...    37   0.30 
UniRef50_Q9PYY1 Cluster: ORF62; n=1; Xestia c-nigrum granuloviru...    37   0.40 
UniRef50_Q8QNG2 Cluster: EsV-1-117; n=1; Ectocarpus siliculosus ...    37   0.40 
UniRef50_Q8G2Q7 Cluster: BRO family protein; n=3; Brucella|Rep: ...    37   0.40 
UniRef50_Q84IK9 Cluster: Antirepressor protein; n=1; Clostridium...    37   0.40 
UniRef50_A0VJ08 Cluster: BRO-like; n=1; Delftia acidovorans SPH-...    37   0.40 
UniRef50_Q1A0E0 Cluster: Gp77; n=1; Mycobacterium phage Che12|Re...    37   0.40 
UniRef50_A6N1W8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_Q8W644 Cluster: Putative uncharacterized protein; n=2; ...    36   0.53 
UniRef50_A5YK15 Cluster: Gp47; n=3; unclassified Siphoviridae|Re...    36   0.70 
UniRef50_A4KXE7 Cluster: Bro9; n=1; Heliothis virescens ascoviru...    35   1.2  
UniRef50_Q47D43 Cluster: BRO family protein; n=1; Dechloromonas ...    35   1.2  
UniRef50_A3DG82 Cluster: BRO-like protein; n=1; Clostridium ther...    35   1.2  
UniRef50_Q91FW9 Cluster: 201R; n=2; Invertebrate iridescent viru...    35   1.6  
UniRef50_Q4ZAE4 Cluster: ORF018; n=4; Staphylococcus phage 53 se...    35   1.6  
UniRef50_Q9YVP6 Cluster: ORF MSV196 ALI motif gene family protei...    34   2.1  
UniRef50_Q8JM96 Cluster: Putative uncharacterized protein; n=1; ...    34   2.1  
UniRef50_Q4KT10 Cluster: BRO-C; n=1; Chrysodeixis chalcites nucl...    34   2.1  
UniRef50_A3M6B7 Cluster: Putative uncharacterized protein; n=1; ...    34   2.1  
UniRef50_A3DFZ3 Cluster: BRO-like protein; n=1; Clostridium ther...    34   2.1  
UniRef50_Q8SDX0 Cluster: Anti-repressor; n=19; root|Rep: Anti-re...    34   2.1  
UniRef50_A7IY79 Cluster: Putative antirepressor; n=1; Corynebact...    34   2.1  
UniRef50_Q6BTQ2 Cluster: Similar to sp|P53971 Saccharomyces cere...    34   2.1  
UniRef50_Q9YVP7 Cluster: ORF MSV195 ALI motif gene family protei...    34   2.8  
UniRef50_Q0IL00 Cluster: Bro-f; n=1; Leucania separata nuclear p...    34   2.8  
UniRef50_Q6AC67 Cluster: Prophage antirepressor protein; n=2; Le...    34   2.8  
UniRef50_A3X9C1 Cluster: Putative uncharacterized protein; n=1; ...    34   2.8  
UniRef50_A0QB24 Cluster: Gp54 protein; n=2; Mycobacterium avium ...    34   2.8  
UniRef50_Q58M49 Cluster: Putative uncharacterized protein; n=1; ...    34   2.8  
UniRef50_Q54HZ6 Cluster: Putative uncharacterized protein; n=1; ...    34   2.8  
UniRef50_Q91BW9 Cluster: Bro-a; n=3; Nucleopolyhedrovirus|Rep: B...    33   3.7  
UniRef50_Q63HM1 Cluster: Probable arylformamidase; n=21; Amniota...    33   3.7  
UniRef50_Q8QLL0 Cluster: BRO-b; n=2; Nucleopolyhedrovirus|Rep: B...    33   4.9  
UniRef50_Q197E1 Cluster: Putative uncharacterized protein; n=1; ...    33   4.9  
UniRef50_Q65943 Cluster: E1B protein, large T-antigen; n=3; Cani...    33   4.9  
UniRef50_Q6NEV9 Cluster: Putative DNA-binding bacteriophage prot...    33   6.5  
UniRef50_A5C2N5 Cluster: Putative uncharacterized protein; n=1; ...    33   6.5  
UniRef50_Q8YHA3 Cluster: PHAGE-RELATED DNA BINDING PROTEIN; n=4;...    32   8.6  
UniRef50_Q3JTQ5 Cluster: BRO family, N-terminal domain protein; ...    32   8.6  
UniRef50_Q0VTH4 Cluster: Transcriptional regulator, GntR family;...    32   8.6  
UniRef50_Q0LDQ8 Cluster: Von Willebrand factor, type A precursor...    32   8.6  
UniRef50_Q05W40 Cluster: Putative uncharacterized protein; n=1; ...    32   8.6  
UniRef50_Q55YG4 Cluster: Putative uncharacterized protein; n=2; ...    32   8.6  

>UniRef50_Q9YML3 Cluster: Uncharacterized Bro-N domain-containing
           protein J; n=1; Lymantria dispar MNPV|Rep:
           Uncharacterized Bro-N domain-containing protein J -
           Lymantria dispar multicapsid nuclear polyhedrosis virus
           (LdMNPV)
          Length = 403

 Score =  123 bits (297), Expect = 3e-27
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 5/107 (4%)
 Frame = +2

Query: 257 APDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           A +++AKQGDPLYLHPHTVL+TK GVIQLIMKSKLPY +ELQ WLLEEVIPQVLCTGKY 
Sbjct: 70  ASNALAKQGDPLYLHPHTVLVTKEGVIQLIMKSKLPYAVELQAWLLEEVIPQVLCTGKYD 129

Query: 437 PAVEMDTNDVIAKIDDLTQKLTVAT-----QILRKQPIAHFVCQRND 562
           PA++    +     D L +  T  T      +++K+    FV + N+
Sbjct: 130 PAIKHQQEETKRMTDRLIKVFTDHTTTLHAALVKKEKFVEFVVESNN 176



 Score =  113 bits (271), Expect = 4e-24
 Identities = 50/69 (72%), Positives = 59/69 (85%)
 Frame = +3

Query: 51  MAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           M+QVKIG+FKFG+DTFTLRYVLG EQ V+FVAKDIAS+LK+ NC  A+R HVDGKYKSTF
Sbjct: 1   MSQVKIGQFKFGQDTFTLRYVLGGEQQVKFVAKDIASNLKHANCAEAVRKHVDGKYKSTF 60

Query: 231 EHADQIQHM 257
           EH +   H+
Sbjct: 61  EHGEIRSHL 69


>UniRef50_P24655 Cluster: Uncharacterized Bro-N domain-containing
           protein ORF2; n=12; Nucleopolyhedrovirus|Rep:
           Uncharacterized Bro-N domain-containing protein ORF2 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 328

 Score =  120 bits (288), Expect = 3e-26
 Identities = 59/93 (63%), Positives = 66/93 (70%)
 Frame = +2

Query: 245 NPAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCT 424
           N     +SV K+GDPLYL PHTVLITKSGVIQLIMKSKLPY IELQEWLLEEVIPQVLCT
Sbjct: 66  NGGPTSNSVVKRGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCT 125

Query: 425 GKYAPAVEMDTNDVIAKIDDLTQKLTVATQILR 523
           GKY PA++    +    +  L    T  T  L+
Sbjct: 126 GKYDPAIKQREEESKQLVTKLIATFTEHTNALQ 158



 Score =  102 bits (245), Expect = 5e-21
 Identities = 48/65 (73%), Positives = 54/65 (83%)
 Frame = +3

Query: 51  MAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           MA+VKIGEFKFGEDTF LRYVL  +Q VRFVAKD+A+SLKY  C++AIRVHVD KYKS F
Sbjct: 1   MARVKIGEFKFGEDTFNLRYVLERDQQVRFVAKDVANSLKYTVCDKAIRVHVDNKYKSLF 60

Query: 231 EHADQ 245
           E   Q
Sbjct: 61  EQTIQ 65


>UniRef50_Q287E9 Cluster: BRO-D; n=3; unclassified
           Nucleopolyhedrovirus|Rep: BRO-D - Agrotis segetum
           nuclear polyhedrosis virus (AsNPV)
          Length = 336

 Score =  118 bits (285), Expect = 8e-26
 Identities = 52/76 (68%), Positives = 64/76 (84%)
 Frame = +2

Query: 275 KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMD 454
           K+G+PLYL PHT+LITKSGVIQLIMKSKLPY +ELQEWLLEEVIPQVLCTGKY PAV+  
Sbjct: 86  KKGNPLYLQPHTILITKSGVIQLIMKSKLPYAVELQEWLLEEVIPQVLCTGKYQPAVDNG 145

Query: 455 TNDVIAKIDDLTQKLT 502
               ++ + +++Q L+
Sbjct: 146 NGATVSMLHEISQSLS 161



 Score = 79.8 bits (188), Expect = 4e-14
 Identities = 38/61 (62%), Positives = 45/61 (73%)
 Frame = +3

Query: 51  MAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           MAQVKIG FKFGED F LRYV+ ++  V FV KDIA  LKY +C++AI  HV+ KYK  F
Sbjct: 1   MAQVKIGVFKFGEDEFELRYVVDNDMQVLFVGKDIARVLKYNDCKQAIHKHVNEKYKCVF 60

Query: 231 E 233
           E
Sbjct: 61  E 61


>UniRef50_Q0N3Z7 Cluster: BRO-B; n=13; Nucleopolyhedrovirus|Rep:
           BRO-B - Clanis bilineata nucleopolyhedrosis virus
          Length = 339

 Score =  117 bits (281), Expect = 2e-25
 Identities = 59/94 (62%), Positives = 71/94 (75%)
 Frame = +2

Query: 278 QGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDT 457
           +GD LYL PHT+LITK GVIQLIMKSKLPY +ELQ WLLEEVIPQVLCTGKYAPAVEMDT
Sbjct: 76  KGDSLYLQPHTILITKEGVIQLIMKSKLPYAVELQAWLLEEVIPQVLCTGKYAPAVEMDT 135

Query: 458 NDVIAKIDDLTQKLTVATQILRKQPIAHFVCQRN 559
           +   +KI + T K  +A +  + Q +   + + N
Sbjct: 136 DIQESKILN-TYKQDIAEKDEKIQNLTTVLIETN 168



 Score = 81.4 bits (192), Expect = 1e-14
 Identities = 37/63 (58%), Positives = 51/63 (80%)
 Frame = +3

Query: 60  VKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHA 239
           VKIG FKFGEDTF LRYV+ + + V+FVAKD+AS+LK+ N ++A++ HVD KYKST+E  
Sbjct: 5   VKIGNFKFGEDTFRLRYVV-EREIVKFVAKDVASNLKHQNTKKAVKDHVDEKYKSTYEMG 63

Query: 240 DQI 248
            ++
Sbjct: 64  KEV 66


>UniRef50_Q287M2 Cluster: BRO-A; n=1; Agrotis segetum
           nucleopolyhedrovirus|Rep: BRO-A - Agrotis segetum
           nuclear polyhedrosis virus (AsNPV)
          Length = 324

 Score =  109 bits (263), Expect = 4e-23
 Identities = 58/106 (54%), Positives = 75/106 (70%), Gaps = 4/106 (3%)
 Frame = +2

Query: 275 KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMD 454
           K+G PL+L+  T+LITKSGVIQLIMKSKLPY +ELQEWLLEEVIPQVLCTGKY PAV  +
Sbjct: 91  KKGHPLFLYDQTILITKSGVIQLIMKSKLPYAVELQEWLLEEVIPQVLCTGKYQPAV-AN 149

Query: 455 TNDVIAKIDDLTQKLTVATQILRKQ----PIAHFVCQRNDCGSTRR 580
            ++ ++K +++  K++    IL KQ     I   +  R D  + RR
Sbjct: 150 NSECLSKSNEMILKMS-QELILAKQNSDAMIQEMIVARRDAETARR 194



 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 38/60 (63%), Positives = 43/60 (71%)
 Frame = +3

Query: 51  MAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           M QVKIG FKFGED F LRYV+G+++ V FVAKDIAS LKY     A+  HVD KYK  F
Sbjct: 1   MPQVKIGVFKFGEDKFKLRYVVGNDKDVLFVAKDIASVLKYEKPANAVAKHVDKKYKCYF 60


>UniRef50_A1YJ59 Cluster: BRO; n=1; Spodoptera frugiperda MNPV|Rep:
           BRO - Spodoptera frugiperda nuclear polyhedrosis virus
           (SfNPV)
          Length = 334

 Score = 93.9 bits (223), Expect = 2e-18
 Identities = 41/62 (66%), Positives = 48/62 (77%)
 Frame = +2

Query: 290 LYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVI 469
           LY+HP T++I KSGVIQLIMKSKL Y +ELQEW+ EEVIPQVLCTGKY+P   +     I
Sbjct: 89  LYVHPQTIMINKSGVIQLIMKSKLSYAVELQEWMFEEVIPQVLCTGKYSPQAALTEEKEI 148

Query: 470 AK 475
            K
Sbjct: 149 VK 150



 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 35/60 (58%), Positives = 41/60 (68%)
 Frame = +3

Query: 51  MAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           MA VKI  FKFG++   LRYV+GD   V FV KDIA+ LKY N ++AI  HVD KYK  F
Sbjct: 1   MASVKINLFKFGDEEIELRYVIGDNDEVFFVGKDIATMLKYENTKKAIIDHVDDKYKIAF 60


>UniRef50_Q0IL61 Cluster: Bro-e; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: Bro-e - Leucania separata
           nuclear polyhedrosis virus (LsNPV)
          Length = 354

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 48/87 (55%), Positives = 57/87 (65%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 HAPDSVAKQGDP--LYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTG 427
           H+PD  A+        LHP TVLI KSGVIQLIM SKLPY +ELQEWLLEEVIPQVL TG
Sbjct: 89  HSPDYDAESSSDSETNLHPQTVLINKSGVIQLIMHSKLPYAVELQEWLLEEVIPQVLSTG 148

Query: 428 KYA--PAVEMDTNDVIAKIDDLTQKLT 502
           +Y    A     ND  ++   L Q+++
Sbjct: 149 RYVCETAPSKSVNDCQSQTVVLLQEIS 175



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/64 (43%), Positives = 40/64 (62%)
 Frame = +3

Query: 48  KMAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKST 227
           KM  V + +FKFG+ T  LRY +  +  V FV +DIA  LKY   + AI+ HV+ KYK+ 
Sbjct: 27  KMCTVVVRDFKFGDITMRLRYTIDQDNCVWFVGRDIAKLLKYQRTQDAIKKHVNVKYKAL 86

Query: 228 FEHA 239
            +H+
Sbjct: 87  IKHS 90


>UniRef50_Q06KR1 Cluster: Baculovirus repeated ORF-a; n=6;
           Nucleopolyhedrovirus|Rep: Baculovirus repeated ORF-a -
           Anticarsia gemmatalis nuclear polyhedrosis virus
           (AgMNPV)
          Length = 243

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 42/60 (70%), Positives = 49/60 (81%)
 Frame = +3

Query: 51  MAQVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           MAQVKIG+FKFGEDTFTLRYVL D+  V+FVAKDIASSL Y     A++ +VD KYKST+
Sbjct: 1   MAQVKIGQFKFGEDTFTLRYVL-DKDIVKFVAKDIASSLGYEKFSNAVKKYVDIKYKSTY 59



 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 24/48 (50%), Positives = 34/48 (70%)
 Frame = +2

Query: 275 KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVL 418
           K+GD LYL PHT+L++  GV+QLI +SK+P   E Q+W  + V+P  L
Sbjct: 69  KRGDLLYLQPHTILLSNIGVLQLISRSKMPNAAEFQDWFYDHVLPACL 116


>UniRef50_Q9E231 Cluster: Orf60-like protien; n=14;
           Baculoviridae|Rep: Orf60-like protien - Helicoverpa zea
           SNPV
          Length = 501

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 26/50 (52%), Positives = 36/50 (72%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           PL   P+T+ IT++G+  LIM+SKLP   E Q WL EEV+P++  TGKY+
Sbjct: 77  PLNWQPNTLFITEAGIYALIMRSKLPAAEEFQSWLFEEVLPELRRTGKYS 126


>UniRef50_Q9PYR4 Cluster: ORF131; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF131 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 442

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDV 466
           P    P+TV IT++GV  LI+KSKLP   + Q+WL EEV+P++  TGKY  +    T+  
Sbjct: 60  PANWQPNTVFITEAGVWALIIKSKLPAAEKFQKWLFEEVLPELRRTGKYDMSEAASTSTE 119

Query: 467 IAKID 481
           I   D
Sbjct: 120 IVNYD 124


>UniRef50_Q8QLB1 Cluster: BRO-g; n=3; Nucleopolyhedrovirus|Rep:
           BRO-g - Mamestra configurata NPV-A
          Length = 235

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 20/39 (51%), Positives = 29/39 (74%)
 Frame = +2

Query: 299 HPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQV 415
           HPHTV + K+G++Q+I K KL    +LQ+WL EEV P++
Sbjct: 81  HPHTVSVNKAGLVQMITKCKLKNADKLQKWLYEEVFPKI 119


>UniRef50_Q8QLB2 Cluster: BRO-f; n=4; Nucleopolyhedrovirus|Rep:
           BRO-f - Mamestra configurata NPV-A
          Length = 357

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 HAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYG-IE-LQEWLLEEVIPQVLCTG 427
           H P++   +G     HPHTV + + G+ Q+I+ SKL    +E  ++W+ EEV+P +  TG
Sbjct: 67  HVPET---KGITSSTHPHTVFVNEPGLYQMILSSKLKNNRVEPFKKWVFEEVLPTIRKTG 123

Query: 428 KY---APAVEMDTNDV--IAKIDDLTQKL 499
           +Y     A   + NDV  +A +  ++Q +
Sbjct: 124 QYKMDTAAAPTNGNDVNTVALLQTISQNI 152


>UniRef50_Q4KT11 Cluster: BRO-B; n=2; Nucleopolyhedrovirus|Rep:
           BRO-B - Chrysodeixis chalcites nucleopolyhedrovirus
          Length = 635

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 20/60 (33%), Positives = 36/60 (60%)
 Frame = +2

Query: 296 LHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAK 475
           LHP T  I K+G+ +LI  SK+P   E ++W+  +++P++   G+Y   V++  N+   K
Sbjct: 74  LHPKTKFINKAGLFELIQNSKMPKAQEFKQWINFDLLPKLCDKGRYDMQVDVLANNCAQK 133


>UniRef50_A4KXK3 Cluster: Bro17; n=2; Heliothis virescens ascovirus
           3e|Rep: Bro17 - Heliothis virescens ascovirus 3e
          Length = 502

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           P    P+TV IT+  + +L  KS LP   E Q+W+ EEV+P +  TG Y
Sbjct: 79  PANWQPNTVFITEPAIYKLCTKSTLPEAEEFQDWIYEEVLPTIRRTGGY 127


>UniRef50_Q80LR2 Cluster: Baculovirus repeated ORF; n=1; Adoxophyes
           honmai NPV|Rep: Baculovirus repeated ORF - Adoxophyes
           honmai nucleopolyhedrovirus
          Length = 113

 Score = 45.6 bits (103), Expect = 9e-04
 Identities = 18/30 (60%), Positives = 27/30 (90%)
 Frame = +3

Query: 141 VAKDIASSLKYVNCERAIRVHVDGKYKSTF 230
           +AKD+A++LKYV+C++AIR++VD KYK  F
Sbjct: 1   MAKDVAAALKYVDCKQAIRINVDEKYKCKF 30


>UniRef50_A3HNE6 Cluster: BRO domain protein domain protein; n=1;
           Pseudomonas putida GB-1|Rep: BRO domain protein domain
           protein - Pseudomonas putida (strain GB-1)
          Length = 285

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +2

Query: 284 DPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY-APAVEMD 454
           D   L P   +I +  V +L+M+SK+P     +EW++ EV+P +  TG Y APA   D
Sbjct: 79  DSFTLGPSANIIPERDVYRLVMRSKMPQAERFEEWVVSEVLPSIRKTGGYTAPAQPAD 136



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 81  FGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVH 203
           F  + F +R VL D +P  F A+D+A  L Y N ++A+R H
Sbjct: 29  FNFEGFDVRVVLVDGEPW-FSARDVAEGLGYSNPQKAVRDH 68


>UniRef50_Q4KT25 Cluster: BRO-A; n=3; root|Rep: BRO-A - Chrysodeixis
           chalcites nucleopolyhedrovirus
          Length = 517

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = +2

Query: 296 LHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAP 439
           LHP T  I K+G+ +LI  SK+P   E ++W+  +++P +    +Y+P
Sbjct: 116 LHPKTKFINKAGLFELIQNSKMPQAQEFKQWINSDLLPTLCQQREYSP 163


>UniRef50_Q99GY7 Cluster: Bro; n=27; root|Rep: Bro - Helicoverpa
           armigera nucleopolyhedrovirus G4
          Length = 527

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/55 (30%), Positives = 34/55 (61%)
 Frame = +2

Query: 284 DPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVE 448
           D + LHP +  I ++G+ +LI  S++P   E ++W+  +++P++   GKY  A +
Sbjct: 250 DDVTLHPMSKFINRAGLFELIQASRMPKAQEFRDWINSDLLPKLCDDGKYDMAAD 304



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 141 VAKDIASSLKYVNCERAIRVHVDGKYKSTFE 233
           VA   A +L Y N  RAIRVHV  K +  +E
Sbjct: 27  VANPFAEALSYSNVNRAIRVHVSEKNQQNYE 57


>UniRef50_A4XBY6 Cluster: BRO domain protein domain protein; n=2;
           Salinispora|Rep: BRO domain protein domain protein -
           Salinispora tropica CNB-440
          Length = 284

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 4/99 (4%)
 Frame = +2

Query: 254 HAPD-SVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGK 430
           HA D S A+  D +    H  +  +SG+  LI +S+ P     + W+  EV+P +  TG+
Sbjct: 68  HADDLSTAEVIDGMGRRQHVRITNESGLYDLIFQSRKPEARAFRRWVTHEVLPAIRATGR 127

Query: 431 Y--APAVEMDTNDVIAKIDDLTQKLTV-ATQILRKQPIA 538
           Y   PAV     D +    D  ++L   A ++    P A
Sbjct: 128 YESVPAVPQSYADALQLAADQARQLDAQAAELAEAAPKA 166


>UniRef50_Q06KD3 Cluster: Baculovirus repeated ORF; n=1; Anticarsia
           gemmatalis nucleopolyhedrovirus|Rep: Baculovirus
           repeated ORF - Anticarsia gemmatalis nuclear
           polyhedrosis virus (AgMNPV)
          Length = 60

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/25 (76%), Positives = 21/25 (84%)
 Frame = +2

Query: 251 AHAPDSVAKQGDPLYLHPHTVLITK 325
           A A D+VAKQ DPLYL PHT+LITK
Sbjct: 30  APAADTVAKQRDPLYLQPHTILITK 54


>UniRef50_A0RLT8 Cluster: Antirepressor, phage associated; n=3;
           Bacillus cereus group|Rep: Antirepressor, phage
           associated - Bacillus thuringiensis (strain Al Hakam)
          Length = 262

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 11/93 (11%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMD---TN-----DVIA 472
           I +  + +LI+KSKLP   + + W+ EEV+P +   G Y     ++   TN      ++ 
Sbjct: 76  INEPNLYRLIVKSKLPQAEQFETWVFEEVLPSIRKHGAYMTDQVLEQAVTNPDFAIGLLT 135

Query: 473 KIDDLTQKLTVA-TQILRKQPIAHF--VCQRND 562
           K+ +  +KL  A  QI+++QP+  F   C ++D
Sbjct: 136 KLKEEKEKLAAAQQQIVQQQPLVTFAEACMQSD 168


>UniRef50_Q8QLL3 Cluster: BRO-a; n=1; Mamestra configurata
           NPV-A|Rep: BRO-a - Mamestra configurata NPV-A
          Length = 161

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/53 (35%), Positives = 31/53 (58%)
 Frame = +2

Query: 245 NPAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEV 403
           N  +AP     +  P + H +TV I ++GV+ LIM S++ Y  E ++W  EE+
Sbjct: 12  NMENAPKPRNMENAPKHWHSNTVFIDEAGVMSLIMNSEISYAKEFKKWFYEEL 64


>UniRef50_Q0IKW6 Cluster: Bro-i; n=3; dsDNA viruses, no RNA
           stage|Rep: Bro-i - Leucania separata nuclear
           polyhedrosis virus (LsNPV)
          Length = 263

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 15/40 (37%), Positives = 28/40 (70%)
 Frame = +2

Query: 296 LHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQV 415
           LHP +  I K+G+++L++KS++ Y  E + WL+ E+ P +
Sbjct: 96  LHPSSRFINKAGLLELVLKSRMRYAAEFRFWLVNELFPSL 135


>UniRef50_Q2L2E4 Cluster: Phage protein; n=1; Bordetella avium
           197N|Rep: Phage protein - Bordetella avium (strain 197N)
          Length = 374

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAP-AVEMDTNDVIAK 475
           V+I +SG+  L+++S+ P   +  +W+  EV+PQ+  TG Y P    ++  D++ K
Sbjct: 135 VIINESGLYALVLRSRKPEARKFAKWVTSEVLPQIRKTGAYLPKEFAVNPGDILTK 190


>UniRef50_Q919G9 Cluster: CUN108 putative bro protein, ATP_GTP_A
           motif, similar to AcMNPV ORF2; n=1; Culex nigripalpus
           NPV|Rep: CUN108 putative bro protein, ATP_GTP_A motif,
           similar to AcMNPV ORF2 - Culex nigripalpus NPV
          Length = 601

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 2/68 (2%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDV--IAKIDD 484
           V++ + GV QLI++S+LP     ++W+   V+P +  TG+Y   +E++       ++I+ 
Sbjct: 241 VMLNEGGVQQLILESRLPNAKRYKQWVCGTVLPSIRKTGRYERTMELEPKSCGDNSRIEL 300

Query: 485 LTQKLTVA 508
           L  KL +A
Sbjct: 301 LETKLALA 308


>UniRef50_A5IZL9 Cluster: Bro-1; n=1; Spodoptera litura
           granulovirus|Rep: Bro-1 - Spodoptera litura granulovirus
          Length = 471

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 2/85 (2%)
 Frame = +2

Query: 296 LHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPA--VEMDTNDVI 469
           LHP++  I ++G+ +LI  S +P   + ++W+  +++ ++  TGKY+         ND +
Sbjct: 70  LHPYSKFINQAGLFELIQSSCMPKAQQFKDWVTSKLLTRLCKTGKYSMTDNAPAQINDAM 129

Query: 470 AKIDDLTQKLTVATQILRKQPIAHF 544
             I   T + T A  I ++   A +
Sbjct: 130 NTIHAATNEGTQAPWIKQEDESAQY 154


>UniRef50_A5IZW6 Cluster: Bro-5; n=2; Spodoptera litura
           granulovirus|Rep: Bro-5 - Spodoptera litura granulovirus
          Length = 256

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGK 430
           P    P+TV I+++GV  LIM+ KL      ++WL EEV+P++   G+
Sbjct: 75  PANWQPNTVFISEAGVYALIMRCKLHTADLFRQWLFEEVLPELRKNGR 122


>UniRef50_Q9PYR5 Cluster: ORF130; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF130 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 237

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQV 415
           P    P+TV IT++GV  LI KSKL      +EWL + +IPQ+
Sbjct: 51  PSNWQPNTVFITEAGVYALINKSKLAGAEIFREWLFDTIIPQM 93


>UniRef50_Q3Y2L0 Cluster: BRO, N-terminal; n=1; Enterococcus faecium
           DO|Rep: BRO, N-terminal - Enterococcus faecium DO
          Length = 248

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = +2

Query: 254 HAPDSVAKQG-DPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGK 430
           H   S+   G D L       +I +S V +LI+KS LP   + + W++EEV+P +  TG 
Sbjct: 46  HCKKSIETWGNDSLGRRQKFKVIPESDVYRLIIKSNLPSAEKFEAWVMEEVLPTIRKTGS 105

Query: 431 YA 436
           Y+
Sbjct: 106 YS 107


>UniRef50_Q0I4I5 Cluster: Putative uncharacterized protein; n=2;
           Histophilus somni|Rep: Putative uncharacterized protein
           - Haemophilus somnus (strain 129Pt) (Histophilus somni
           (strain 129Pt))
          Length = 204

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           I +  + ++I KS+    +E Q W+ EEV+PQ+  TGKY
Sbjct: 69  INEPNLYRIIFKSRKAEAVEFQNWVFEEVLPQIRKTGKY 107


>UniRef50_A7LYR8 Cluster: Putative uncharacterized protein; n=2;
           Bacteroides ovatus ATCC 8483|Rep: Putative
           uncharacterized protein - Bacteroides ovatus ATCC 8483
          Length = 269

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           I +  VI+LIM+SKLP     Q+W+ EE++P +   G Y
Sbjct: 78  INEGDVIRLIMRSKLPQAEAFQDWVCEEILPSIRKHGAY 116


>UniRef50_A5MYH6 Cluster: Predicted prophage antirepressor; n=1;
           Clostridium kluyveri DSM 555|Rep: Predicted prophage
           antirepressor - Clostridium kluyveri DSM 555
          Length = 267

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDT-NDVIAK 475
           I +  + +L+  S+LP   E + W+ ++V+PQ+  TG Y P  E ++  D++AK
Sbjct: 71  IPEGDIYRLVANSELPGAQEFESWIFDKVLPQINHTGGYIPNNEDESEEDILAK 124


>UniRef50_Q9YML4 Cluster: Ld-bro-i; n=1; Lymantria dispar MNPV|Rep:
           Ld-bro-i - Lymantria dispar multicapsid nuclear
           polyhedrosis virus (LdMNPV)
          Length = 346

 Score = 40.3 bits (90), Expect = 0.032
 Identities = 20/77 (25%), Positives = 39/77 (50%)
 Frame = +2

Query: 269 VAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVE 448
           VA    P   HP T+ + + GV  L+ +S  P   E  +++ E ++P +  TGK+  +  
Sbjct: 77  VAPPTTPANWHPETLFVLEPGVYALLARSNKPLAKERMKFVYETILPTIRKTGKFEMSKT 136

Query: 449 MDTNDVIAKIDDLTQKL 499
            D  +  A++ ++  +L
Sbjct: 137 SDVINYDARMAEMKVEL 153


>UniRef50_Q47HX8 Cluster: BRO, N-terminal; n=1; Dechloromonas
           aromatica RCB|Rep: BRO, N-terminal - Dechloromonas
           aromatica (strain RCB)
          Length = 111

 Score = 40.3 bits (90), Expect = 0.032
 Identities = 15/41 (36%), Positives = 28/41 (68%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +L+++SG+ +LIM+S  P     Q+W+ +EV+P +  TG +
Sbjct: 57  ILVSESGLYKLIMRSDKPQAKAFQDWVTKEVLPSIRKTGSF 97


>UniRef50_Q1J4V4 Cluster: Phage antirepressor protein; n=1;
           Streptococcus pyogenes MGAS10750|Rep: Phage
           antirepressor protein - Streptococcus pyogenes serotype
           M4 (strain MGAS10750)
          Length = 244

 Score = 40.3 bits (90), Expect = 0.032
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQ 493
           +I +SG+  LI+ SKLP     + W+  EV+P +   G Y    E  TN+ +     L  
Sbjct: 70  IINESGLYSLILSSKLPQAKIFKAWVTREVLPSIRKNGGYIVGQEKKTNEEL-----LAD 124

Query: 494 KLTVATQILRKQ 529
            + VA +I+ ++
Sbjct: 125 AILVANRIIAER 136


>UniRef50_Q0SWM4 Cluster: BRO family, N-terminal domain protein;
           n=3; Clostridium perfringens|Rep: BRO family, N-terminal
           domain protein - Clostridium perfringens (strain SM101 /
           Type A)
          Length = 191

 Score = 40.3 bits (90), Expect = 0.032
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = +2

Query: 302 PHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKID 481
           P  V+  + G+   I  SKLP GI  ++WL  EV+P++   G Y+   E   +++  K +
Sbjct: 85  PKLVIFYEEGLYGFINYSKLPIGISFRKWLRREVLPELRAKGTYSINKESYKDNLKYKNE 144

Query: 482 DLT 490
           +L+
Sbjct: 145 NLS 147


>UniRef50_A6PK75 Cluster: BRO domain protein; n=1; Victivallis
           vadensis ATCC BAA-548|Rep: BRO domain protein -
           Victivallis vadensis ATCC BAA-548
          Length = 357

 Score = 40.3 bits (90), Expect = 0.032
 Identities = 18/45 (40%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY-APAV 445
           +++++ V++LI  SKLP   + + W+ EEV+P +  TG Y AP+V
Sbjct: 70  ILSEADVMRLICGSKLPAAQKFERWVFEEVLPAIRRTGSYAAPSV 114


>UniRef50_Q5UP77 Cluster: Uncharacterized Bro-N domain-containing
           protein L2; n=1; Acanthamoeba polyphaga mimivirus|Rep:
           Uncharacterized Bro-N domain-containing protein L2 -
           Mimivirus
          Length = 246

 Score = 40.3 bits (90), Expect = 0.032
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           P  L   T  I  SG   LI  SK P+ +++++WL +EVIP ++  G Y+
Sbjct: 168 PKTLDKKTKFINLSGFCNLIHHSKKPFAMKIKKWLDDEVIPALIMDGVYS 217


>UniRef50_Q7N339 Cluster: Similar to bacteriophage protein; n=2;
           Enterobacteriaceae|Rep: Similar to bacteriophage protein
           - Photorhabdus luminescens subsp. laumondii
          Length = 314

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 15/42 (35%), Positives = 27/42 (64%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           +L  +S + +L+M+S LP     Q+W+ E V+P ++ TG Y+
Sbjct: 139 ILAGQSDMFRLVMRSNLPSAERFQDWVCEAVLPSIMETGSYS 180


>UniRef50_Q30XK5 Cluster: Prophage antirepressor-like; n=2;
           Desulfovibrio desulfuricans G20|Rep: Prophage
           antirepressor-like - Desulfovibrio desulfuricans (strain
           G20)
          Length = 197

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLT 490
           ++I + G+  LI +S+ P  I  Q+W+ +EV+P +   G Y      DT++ I  I   T
Sbjct: 82  LIINEPGLYTLIFQSRKPEAIAFQDWVCKEVLPSIRKHGAYFMMKPTDTDESI--IQKAT 139

Query: 491 QKLTVATQ 514
           Q + +A +
Sbjct: 140 QIIALARE 147


>UniRef50_A6LVQ3 Cluster: Prophage antirepressor; n=3; root|Rep:
           Prophage antirepressor - Clostridium beijerinckii NCIMB
           8052
          Length = 251

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 3/81 (3%)
 Frame = +2

Query: 236 CRPNPAHAPDSVA---KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVI 406
           CR +  H    V    K G     +    +I +  + +L+ KS+LP   + + W+ +EV+
Sbjct: 48  CRGSVKHGVGVVTGKRKDGTDAIQNVEMSVIPEGDIYRLVAKSELPGAEKFEAWIFDEVL 107

Query: 407 PQVLCTGKYAPAVEMDTNDVI 469
           P +  TG YA    +D  D++
Sbjct: 108 PCIRKTGMYATDELLDNPDLL 128


>UniRef50_Q185G9 Cluster: Putative phage-related regulatory protein;
           n=1; Clostridium difficile 630|Rep: Putative
           phage-related regulatory protein - Clostridium difficile
           (strain 630)
          Length = 121

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 21/53 (39%), Positives = 31/53 (58%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAK 475
           +T+SGV +LI KS+       Q+W+ +EV+P +  TG Y       TN+VI K
Sbjct: 74  LTESGVYKLIFKSRKEEAERFQDWISDEVLPSIRQTGAYI------TNNVIPK 120


>UniRef50_A4P0J2 Cluster: Possible prophage antirepressor; n=1;
           Haemophilus influenzae 22.4-21|Rep: Possible prophage
           antirepressor - Haemophilus influenzae 22.4-21
          Length = 210

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           I +  + ++I +S     IE Q W+ EEV+PQ+  TGKY
Sbjct: 69  INEPNLYRIIFRSNKAEAIEFQNWIFEEVLPQIRKTGKY 107


>UniRef50_A0A7D8 Cluster: Prophage antirepressor; n=1; Cyanophage
           Ma-LMM01|Rep: Prophage antirepressor - Cyanophage
           Ma-LMM01
          Length = 270

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 14/40 (35%), Positives = 29/40 (72%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           I++SG+ +L++ S+ P     Q+W+++EV+P +  TG+Y+
Sbjct: 75  ISESGLYRLVLSSRKPQAELFQDWVVQEVLPTIRKTGRYS 114


>UniRef50_A5IZQ5 Cluster: Bro-2; n=1; Spodoptera litura
           granulovirus|Rep: Bro-2 - Spodoptera litura granulovirus
          Length = 368

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 347 MKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           M+SKLP   E Q WL EEV+P++  +GKY
Sbjct: 1   MRSKLPAAEEFQRWLFEEVLPELRKSGKY 29


>UniRef50_Q92FM4 Cluster: Lin0080 protein; n=14; root|Rep: Lin0080
           protein - Listeria innocua
          Length = 257

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAK-IDDLTQ 493
           I ++G+ QLI KSKL      Q+W+  EV+P V   G Y       TND I K I D   
Sbjct: 69  INEAGLYQLIFKSKLESAERFQDWVTSEVLPSVRKHGAYM------TNDTIEKAITDPDF 122

Query: 494 KLTVATQI 517
            + +AT +
Sbjct: 123 LIKLATNL 130


>UniRef50_A5I4G4 Cluster: BRO family protein; n=1; Clostridium
           botulinum A str. ATCC 3502|Rep: BRO family protein -
           Clostridium botulinum A str. ATCC 3502
          Length = 266

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQK 496
           I +  + +LI  S+LP   + + W+ +E++P +  TG Y  + ++  N  +  +D+ ++ 
Sbjct: 71  IDEGNLYRLITHSELPSAEKFEIWIFDEILPTIRKTGGYVASEDLFINTYLPYLDEQSKM 130

Query: 497 LTVAT-QILRKQ 529
           +   T +I+RKQ
Sbjct: 131 VFRNTLEIVRKQ 142


>UniRef50_A4TYQ8 Cluster: BRO, N-terminal; n=1; Magnetospirillum
           gryphiswaldense|Rep: BRO, N-terminal - Magnetospirillum
           gryphiswaldense
          Length = 300

 Score = 38.7 bits (86), Expect = 0.099
 Identities = 14/38 (36%), Positives = 26/38 (68%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTG 427
           ++++  V++LI+ SKLP  +  + W+ EEV+P +  TG
Sbjct: 68  ILSEPDVLRLIVGSKLPAAVRFERWVFEEVLPTIRTTG 105


>UniRef50_A3QSE3 Cluster: Putative antirepressor; n=1; Clostridium
           phage phiC2|Rep: Putative antirepressor - Clostridium
           phage phiC2
          Length = 212

 Score = 38.7 bits (86), Expect = 0.099
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDL 487
           LIT+  V +LI+ S LP   + + W+ +EV+P +  TG+Y     + T ++   I DL
Sbjct: 66  LITEGDVYRLIVGSNLPNAEKFESWVFDEVLPTIRQTGQYQAQQNVIT-ELTGTIGDL 122


>UniRef50_P44189 Cluster: Uncharacterized protein HI1418; n=8;
           Pasteurellaceae|Rep: Uncharacterized protein HI1418 -
           Haemophilus influenzae
          Length = 201

 Score = 38.7 bits (86), Expect = 0.099
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           I +  + +LI+KS+ P     + W+ EEV+PQ+  TGKY
Sbjct: 86  INEPNLYRLIIKSRKPEAEPFEAWVFEEVLPQIRKTGKY 124


>UniRef50_Q9YMQ6 Cluster: Ld-bro-c; n=6; dsDNA viruses, no RNA
           stage|Rep: Ld-bro-c - Lymantria dispar multicapsid
           nuclear polyhedrosis virus (LdMNPV)
          Length = 528

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +2

Query: 269 VAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVE 448
           VA    P   HP T+ + + GV  L+ +S  P   E  +++ E ++P +  TGK+     
Sbjct: 77  VAPPTTPANWHPETLFVLEPGVYALMARSTKPMAKEKMKFVYETILPTIRKTGKFEMNKT 136

Query: 449 MDTN-DVIAKIDDLTQKLTVATQILR 523
            + N +   KI  L +K+   + + R
Sbjct: 137 SNINYETEMKIKLLEEKMEHQSTVAR 162


>UniRef50_Q919R4 Cluster: CUN001 putative bro protein, ATP_GTP_A
           motif, similar to AcMNPV ORF 2; n=1; Culex nigripalpus
           NPV|Rep: CUN001 putative bro protein, ATP_GTP_A motif,
           similar to AcMNPV ORF 2 - Culex nigripalpus NPV
          Length = 593

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           V++ + GV QLI++S+LP     ++W+   V+P +  TG+Y
Sbjct: 244 VMLNEGGVQQLILESRLPNAKRYKQWVCGTVLPSIRRTGRY 284


>UniRef50_A4KXK8 Cluster: Bro20; n=1; Heliothis virescens ascovirus
           3e|Rep: Bro20 - Heliothis virescens ascovirus 3e
          Length = 191

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 13/46 (28%), Positives = 28/46 (60%)
 Frame = +2

Query: 296 LHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +   T  I ++G+ +LIM S++P   + Q W+  +++P++   G+Y
Sbjct: 90  IRARTKFINRAGMFELIMSSRMPRARKFQRWVFSDLLPKLCQNGQY 135


>UniRef50_Q5L2M6 Cluster: Phage associated-antirepressor; n=4;
           root|Rep: Phage associated-antirepressor - Geobacillus
           kaustophilus
          Length = 246

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = +2

Query: 284 DPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTND 463
           D L     T ++ + G+  LI+ S+     + + W+  EVIP +  TG Y    ++    
Sbjct: 59  DSLGRKQETFIVNEPGLYTLILGSRKSEAKQFKRWVTHEVIPTIRKTGGYVANDDLFVET 118

Query: 464 VIAKIDDLTQKLTVAT-QILRKQ 529
            +   D+ T+ L  AT + +RKQ
Sbjct: 119 YLKHADEQTKLLFRATLETVRKQ 141


>UniRef50_A7A2N3 Cluster: Putative uncharacterized protein; n=1;
           Bifidobacterium adolescentis L2-32|Rep: Putative
           uncharacterized protein - Bifidobacterium adolescentis
           L2-32
          Length = 263

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMD 454
           ++I++ G+ +LIM+S+ P   E Q W+  EV+P +   G Y     +D
Sbjct: 69  LIISEPGLYKLIMRSRKPEAKEFQRWVTHEVLPSIRKHGAYMTQQTLD 116


>UniRef50_Q9YVP8 Cluster: ORF MSV194 ALI motif gene family protein;
           n=2; Melanoplus sanguinipes entomopoxvirus|Rep: ORF
           MSV194 ALI motif gene family protein - Melanoplus
           sanguinipes entomopoxvirus (MsEPV)
          Length = 409

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 293 YLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDT 457
           Y   +T+ I++SG+  LI+ SK       ++W+  EV+P +   G+Y    E++T
Sbjct: 69  YNEKNTIYISESGLYSLILSSKKSEAKIFKKWITNEVLPNIRKHGEYKIKKELET 123


>UniRef50_Q9PAJ2 Cluster: Phage-related protein; n=22;
           Gammaproteobacteria|Rep: Phage-related protein - Xylella
           fastidiosa
          Length = 530

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = +2

Query: 284 DPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTND 463
           D L     T +I++  +++LI+ SKLP     + W+ EE++P +  TG   PA++  T+ 
Sbjct: 219 DSLGRSRETRIISEPDMLRLIVSSKLPAAERFERWVFEELLPTLRKTGN-RPALDHSTHS 277

Query: 464 VIA 472
             A
Sbjct: 278 ANA 280



 Score = 33.1 bits (72), Expect = 4.9
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 5/59 (8%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA-----PAVEMDTNDVIAKI 478
           I +SG+  LIM S  P     + W+  EV+P +  TG Y+     P +   T D IA +
Sbjct: 348 INESGLYALIMGSTKPAAKRFKRWVTSEVLPTLRKTGTYSTPGALPTLPGPTQDRIAAL 406


>UniRef50_Q8D9R6 Cluster: Prophage antirepressor; n=1; Vibrio
           vulnificus|Rep: Prophage antirepressor - Vibrio
           vulnificus
          Length = 251

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQK 496
           +T+ GV ++ M++K     + Q W+L+EV+P +   G Y P    D + ++   D   ++
Sbjct: 84  VTEPGVYRVAMQAKSSGAKKFQNWVLKEVMPSIRRFGIYPPPEVNDDDFLLQVADQQAKQ 143

Query: 497 LTVATQILR 523
             + +Q +R
Sbjct: 144 SQLLSQFMR 152


>UniRef50_Q3J623 Cluster: Putative uncharacterized protein; n=1;
           Rhodobacter sphaeroides 2.4.1|Rep: Putative
           uncharacterized protein - Rhodobacter sphaeroides
           (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM158)
          Length = 151

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +LI++SG+ +L+M+   P   + Q+W+  EV+P +  TG Y
Sbjct: 63  MLISESGLNKLVMRPDKPEAKKFQDWVTREVLPSIRKTGTY 103


>UniRef50_Q03FD4 Cluster: Uncharacterized phage-encoded protein;
           n=3; root|Rep: Uncharacterized phage-encoded protein -
           Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)
          Length = 267

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +I++ G+ QL  +SKLP     Q+W+ EEV+P +   G Y
Sbjct: 68  VISEPGIYQLAGQSKLPTAEPFQDWIYEEVLPSIRKHGAY 107


>UniRef50_A1AN22 Cluster: BRO domain protein domain protein; n=1;
           Pelobacter propionicus DSM 2379|Rep: BRO domain protein
           domain protein - Pelobacter propionicus (strain DSM
           2379)
          Length = 247

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +I +  + +LIM+SKLP     +EW++ EV+P +  TG Y
Sbjct: 68  IIPERDLYRLIMRSKLPAAERFEEWVVAEVLPAIRKTGFY 107


>UniRef50_Q65PV1 Cluster: Lj965 prophage antirepressor; n=4;
           root|Rep: Lj965 prophage antirepressor - Lactobacillus
           johnsonii
          Length = 278

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +2

Query: 308 TVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           T++  +SG+  LI+ SKLP   + + W+  EV+P +   G Y
Sbjct: 69  TIITNESGMYSLILSSKLPSAKKFKRWVTSEVLPAIREDGAY 110


>UniRef50_A6TLJ8 Cluster: Prophage antirepressor; n=5; root|Rep:
           Prophage antirepressor - Alkaliphilus metalliredigens
           QYMF
          Length = 276

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKID---D 484
           +I +SG+  LI+ SKLP     + W+  EV+P +   G Y    +++  +V+   D    
Sbjct: 70  IINESGLYGLILSSKLPNAKRFKRWVTSEVLPSIQRHGVYMTPDKIE--EVLLNPDMIIG 127

Query: 485 LTQKLTVATQILRKQ 529
           L  KL V  ++ +KQ
Sbjct: 128 LATKLKVEQELSKKQ 142


>UniRef50_A6NWY1 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 153

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           LI +SG+  L++ SKLP   + + W+  EV+P +   G Y
Sbjct: 68  LINESGLYSLVLSSKLPKAKQFRRWVTSEVLPSIRKHGAY 107


>UniRef50_A3VVX0 Cluster: Hypothetical BRO family protein; n=1;
           Roseovarius sp. 217|Rep: Hypothetical BRO family protein
           - Roseovarius sp. 217
          Length = 163

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVI 469
           V++T+SG+ +L+M+S  P     Q+W+   V+P +   G Y      D  DV+
Sbjct: 101 VIVTESGLYKLVMRSDKPEAKAFQDWVTGTVLPSIRKDGGYIMGEGDDRPDVL 153


>UniRef50_Q7Y4K9 Cluster: Gp15; n=9; root|Rep: Gp15 - Streptococcus
           phage SM1
          Length = 239

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query: 263 DSVAKQGDPLYLHPHTVLI-TKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +   KQG P       +LI  +SG+  LI+ SKLP   E + W+  EV+P +   G +
Sbjct: 48  EDALKQGIPTSGGTQDMLIINESGLYSLILSSKLPQAREFKRWVTSEVLPAIRKQGGF 105


>UniRef50_UPI0000397D5D Cluster: COG3617: Prophage antirepressor;
           n=1; Actinobacillus pleuropneumoniae serovar 1 str.
           4074|Rep: COG3617: Prophage antirepressor -
           Actinobacillus pleuropneumoniae serovar 1 str. 4074
          Length = 215

 Score = 37.1 bits (82), Expect = 0.30
 Identities = 14/40 (35%), Positives = 25/40 (62%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           I +  + ++I +S     I+ Q W+ EEV+PQ+  TG+Y+
Sbjct: 15  INEPNLYRIIFRSNKSQAIDFQNWVFEEVLPQIRKTGQYS 54


>UniRef50_Q8FRD3 Cluster: Putative uncharacterized protein; n=1;
           Corynebacterium efficiens|Rep: Putative uncharacterized
           protein - Corynebacterium efficiens
          Length = 262

 Score = 37.1 bits (82), Expect = 0.30
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA--PAVE---MDTNDVIAKI 478
           +IT+SG+   I++S+ P   E + W+  EV+P +   G Y   P +E    D + +I   
Sbjct: 65  VITESGLYSCILRSRKPEAKEFKRWVTREVLPSIRRHGGYLTDPKIEEILTDPDTIIKLA 124

Query: 479 DDLTQK 496
            DL Q+
Sbjct: 125 TDLKQE 130


>UniRef50_Q6NK48 Cluster: Putative anti-repressor protein; n=3;
           Corynebacterium|Rep: Putative anti-repressor protein -
           Corynebacterium diphtheriae
          Length = 272

 Score = 37.1 bits (82), Expect = 0.30
 Identities = 13/47 (27%), Positives = 29/47 (61%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMD 454
           ++ +SG+ +L+ +S++P   E + W+  EV+P++   G YA    ++
Sbjct: 67  VVNESGLYELLFQSRVPQAKEFRRWVTGEVLPEIRRHGMYATTATVE 113


>UniRef50_Q5F6A8 Cluster: Putative uncharacterized protein; n=2;
           Neisseria gonorrhoeae FA 1090|Rep: Putative
           uncharacterized protein - Neisseria gonorrhoeae (strain
           ATCC 700825 / FA 1090)
          Length = 332

 Score = 37.1 bits (82), Expect = 0.30
 Identities = 14/41 (34%), Positives = 26/41 (63%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           + I +  + ++I +S+    ++ Q+W+ EEVIPQ+  TG Y
Sbjct: 117 LFINEPNLYRVIFRSRKAEAVKFQDWIFEEVIPQIRKTGGY 157


>UniRef50_A6NXW4 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 309

 Score = 37.1 bits (82), Expect = 0.30
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = +2

Query: 266 SVAKQGDPLYLHPHTV-LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           ++ K+  P+     ++  I +  V +LI++SKLP   + + W+ +EVIP +  TG Y
Sbjct: 107 AITKRSTPISGKVQSINFIPEGDVYRLIIRSKLPAAEKFELWVFDEVIPTIRKTGGY 163


>UniRef50_A3DI85 Cluster: BRO-like protein; n=1; Clostridium
           thermocellum ATCC 27405|Rep: BRO-like protein -
           Clostridium thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 248

 Score = 37.1 bits (82), Expect = 0.30
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 308 TVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           T ++ ++G+  LI+ S+     E + W+  EVIPQ+  TG YA
Sbjct: 67  TYVVNEAGLYNLILGSRKQEAKEFKRWITHEVIPQIRKTGIYA 109


>UniRef50_Q9PYY1 Cluster: ORF62; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF62 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 211

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 16/48 (33%), Positives = 24/48 (50%)
 Frame = +2

Query: 257 APDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEE 400
           +P S      P++   +T+ I K G+I LI  S LP   E + W L +
Sbjct: 78  SPCSPGPNNQPIHWQSNTLFINKDGIISLINNSTLPVAHEFKRWFLAQ 125


>UniRef50_Q8QNG2 Cluster: EsV-1-117; n=1; Ectocarpus siliculosus
           virus 1|Rep: EsV-1-117 - Ectocarpus siliculosus virus 1
          Length = 524

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +2

Query: 308 TVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           TV +T+ GV +LIM+S+ P     Q+W+  EV+  +   GKY
Sbjct: 68  TVFVTEKGVYKLIMRSRKPVAKPFQDWVF-EVLKTIRKRGKY 108


>UniRef50_Q8G2Q7 Cluster: BRO family protein; n=3; Brucella|Rep: BRO
           family protein - Brucella suis
          Length = 140

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = +2

Query: 293 YLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVE 448
           +  P  + +++SG+ +LIM+S+ P   + Q W+ + V+P +   G Y    E
Sbjct: 70  FRQPSLLSVSESGLYKLIMRSRKPEAKKFQNWVTQVVLPAIRKDGMYVRGEE 121


>UniRef50_Q84IK9 Cluster: Antirepressor protein; n=1; Clostridium
           sordellii|Rep: Antirepressor protein - Clostridium
           sordellii
          Length = 187

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = +2

Query: 275 KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMD 454
           K GD +        I +  + +LI+KSKL    + + W+ EEV+P +   G+Y   +  D
Sbjct: 63  KSGDAIMQFVSKKFIDEGNLYRLILKSKLKKVRKFEMWVFEEVLPTIRKHGEY---INED 119

Query: 455 TNDVIAKIDDLTQKLT 502
             D +     L +KLT
Sbjct: 120 IIDEVLDDPILLRKLT 135


>UniRef50_A0VJ08 Cluster: BRO-like; n=1; Delftia acidovorans
           SPH-1|Rep: BRO-like - Delftia acidovorans SPH-1
          Length = 270

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY-APAVEMDTNDVIAKIDDL 487
           ++I +SG+   I+KS+       ++W+  EV+P +  TG Y  PA +     +  ++D  
Sbjct: 67  IVINESGLYSAILKSERQEAKRFKKWVTSEVLPSIRRTGSYTGPAAQQMAAPLRDQVDAG 126

Query: 488 TQKLTVATQILRKQPIA 538
              L  A + L+  P A
Sbjct: 127 ILLLRAAAEDLKFAPSA 143


>UniRef50_Q1A0E0 Cluster: Gp77; n=1; Mycobacterium phage Che12|Rep:
           Gp77 - Mycobacterium phage Che12
          Length = 280

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 4/84 (4%)
 Frame = +2

Query: 299 HPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTG--KYAPA--VEMDTNDV 466
           H   ++I ++G+ +LIM+S +P     Q+W+   V+P +  TG    AP     +D  D 
Sbjct: 81  HRDMLVINEAGLYRLIMRSNVPAAAPFQDWVTAVVLPTIRKTGGAYIAPGSKAALDLMDS 140

Query: 467 IAKIDDLTQKLTVATQILRKQPIA 538
              ++ + + + +A +   K  +A
Sbjct: 141 STALEAIKKAVAIAEEAQAKLVVA 164


>UniRef50_A6N1W8 Cluster: Putative uncharacterized protein; n=1;
           Microbacterium phage Min1|Rep: Putative uncharacterized
           protein - Microbacterium phage Min1
          Length = 250

 Score = 36.7 bits (81), Expect = 0.40
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA---PAVEMDTNDVIAKI 478
           +I +  +++LI  S+LP     + W  EEV+P V+ TG Y    PA+     D + ++
Sbjct: 65  VIGEPDLLRLITGSRLPQAERFERWAFEEVLPTVIRTGSYTAPPPALPQSYADALREL 122



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 20/44 (45%), Positives = 27/44 (61%)
 Frame = +3

Query: 81  FGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDG 212
           FG D   +R VL +  P RFVA+D+AS+L Y +   AI+ H  G
Sbjct: 4   FGFDGHHVRVVLVEGLP-RFVARDVASALGYTDPTSAIKQHCRG 46


>UniRef50_Q8W644 Cluster: Putative uncharacterized protein; n=2;
           root|Rep: Putative uncharacterized protein -
           Enterobacteria phage phiP27
          Length = 274

 Score = 36.3 bits (80), Expect = 0.53
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           +L+ +SG+  LI+KS+       + W+  EVIP +  TG Y
Sbjct: 72  LLVNESGLYALIIKSRKKQARRFKRWITSEVIPSIRKTGNY 112


>UniRef50_A5YK15 Cluster: Gp47; n=3; unclassified Siphoviridae|Rep:
           Gp47 - Mycobacterium phage Tweety
          Length = 334

 Score = 35.9 bits (79), Expect = 0.70
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLT 490
           V +T++GV  L+M S+ P     + W+  EV+P +  TG Y+    +DTN  +     L 
Sbjct: 141 VAVTEAGVWSLLMISRSPKVKPFKRWMTHEVLPSIRKTGGYS---AVDTNIALPDRKTLA 197

Query: 491 Q 493
           Q
Sbjct: 198 Q 198


>UniRef50_A4KXE7 Cluster: Bro9; n=1; Heliothis virescens ascovirus
           3e|Rep: Bro9 - Heliothis virescens ascovirus 3e
          Length = 521

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 12/47 (25%), Positives = 27/47 (57%)
 Frame = +2

Query: 293 YLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           Y+   +  I ++G+ +LI  S++P  +E + W+   ++P++   G Y
Sbjct: 74  YVQAKSKFINRAGLFELIQASRMPKALEFKNWINSVLLPKLCDDGSY 120


>UniRef50_Q47D43 Cluster: BRO family protein; n=1; Dechloromonas
           aromatica RCB|Rep: BRO family protein - Dechloromonas
           aromatica (strain RCB)
          Length = 58

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 11/40 (27%), Positives = 27/40 (67%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           L+ +SG+ +++++S+     + Q+W+ +EV+P +  TG +
Sbjct: 12  LLAESGLYKMVLRSRTQQAQKFQDWVTKEVLPSIRKTGSF 51


>UniRef50_A3DG82 Cluster: BRO-like protein; n=1; Clostridium
           thermocellum ATCC 27405|Rep: BRO-like protein -
           Clostridium thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 254

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           I +  + +LI+KSKLP     + W+ +EV+P +   G YA
Sbjct: 68  IPEGDLYRLIVKSKLPKAERFERWVFDEVLPSIRKHGIYA 107


>UniRef50_Q91FW9 Cluster: 201R; n=2; Invertebrate iridescent virus
           6|Rep: 201R - Chilo iridescent virus (CIV) (Insect
           iridescent virus type 6)
          Length = 419

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 14/53 (26%), Positives = 29/53 (54%)
 Frame = +2

Query: 278 QGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           Q +  Y    ++ I + G+  LIM S+ P+  + Q+ + E+++P +   G Y+
Sbjct: 87  QNELSYHEGKSIYINEPGLYNLIMSSEAPFAEQFQDMVYEKILPSIRKYGSYS 139


>UniRef50_Q4ZAE4 Cluster: ORF018; n=4; Staphylococcus phage 53 sensu
           lato|Rep: ORF018 - Staphylococcus phage 92
          Length = 245

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = +3

Query: 75  FKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKST--FEHADQI 248
           F F E    +R V  + +P  FV KDIA  L Y   + AIR HVD + K T  F  + Q 
Sbjct: 7   FNFKE--LPVRTVEIENEPY-FVGKDIAEILGYARADNAIRNHVDSEDKLTHQFSASGQN 63

Query: 249 QHMLQI 266
           ++M+ I
Sbjct: 64  RNMIII 69


>UniRef50_Q9YVP6 Cluster: ORF MSV196 ALI motif gene family protein;
           n=2; Melanoplus sanguinipes entomopoxvirus|Rep: ORF
           MSV196 ALI motif gene family protein - Melanoplus
           sanguinipes entomopoxvirus (MsEPV)
          Length = 202

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 13/22 (59%), Positives = 17/22 (77%)
 Frame = +2

Query: 293 YLHPHTVLITKSGVIQLIMKSK 358
           Y+HPHTV I   G+I+LI+K K
Sbjct: 54  YIHPHTVFINNFGLIELILKHK 75


>UniRef50_Q8JM96 Cluster: Putative uncharacterized protein; n=1;
           Mamestra configurata NPV-B|Rep: Putative uncharacterized
           protein - Mamestra configurata NPV-B
          Length = 134

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEE 400
           P+   P+T  I K G+I LI  S LP   E ++W L +
Sbjct: 11  PIPWRPNTWFINKDGIISLINNSTLPVAHEFKKWFLAQ 48


>UniRef50_Q4KT10 Cluster: BRO-C; n=1; Chrysodeixis chalcites
           nucleopolyhedrovirus|Rep: BRO-C - Chrysodeixis chalcites
           nucleopolyhedrovirus
          Length = 268

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 13/42 (30%), Positives = 27/42 (64%)
 Frame = +2

Query: 308 TVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           T+ +  +GV++LI  S++   I+L++WL   V+ ++   G+Y
Sbjct: 85  TIFVNLAGVLELIKGSQIQKAIDLRQWLASTVLIKLCTDGQY 126


>UniRef50_A3M6B7 Cluster: Putative uncharacterized protein; n=1;
           Acinetobacter baumannii ATCC 17978|Rep: Putative
           uncharacterized protein - Acinetobacter baumannii
           (strain ATCC 17978 / NCDC KC 755)
          Length = 220

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 12/39 (30%), Positives = 23/39 (58%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           + +  + ++I +S  P   + Q+W+  EV+P +  TGKY
Sbjct: 23  VNEPNLYRIIFRSNKPEAKQFQDWVFNEVLPTIRKTGKY 61


>UniRef50_A3DFZ3 Cluster: BRO-like protein; n=1; Clostridium
           thermocellum ATCC 27405|Rep: BRO-like protein -
           Clostridium thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 265

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 14/40 (35%), Positives = 25/40 (62%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           I +  + +LI+KS+LP     ++W+ +EV+P +   G YA
Sbjct: 71  IPEGDLFRLIVKSQLPAAERFEKWVFDEVLPTIRKYGVYA 110


>UniRef50_Q8SDX0 Cluster: Anti-repressor; n=19; root|Rep:
           Anti-repressor - Bacteriophage phi-11
          Length = 274

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = +3

Query: 75  FKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKST--FEHADQI 248
           F F E    +R V  + +P  FV KDIA  L Y   + AIR HVD + K T  F  + Q 
Sbjct: 18  FNFKE--LPVRTVEIENEPY-FVGKDIAEILGYARSDNAIRNHVDSEDKLTHQFSASGQN 74

Query: 249 QHMLQI 266
           ++M+ I
Sbjct: 75  RNMIII 80


>UniRef50_A7IY79 Cluster: Putative antirepressor; n=1;
           Corynebacterium phage P1201|Rep: Putative antirepressor
           - Corynebacterium phage P1201
          Length = 307

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 16/59 (27%), Positives = 33/59 (55%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQ 493
           +++SG+  +I+ S+ P   E + W+  EVIP +   G Y  + +++  +V+   D + Q
Sbjct: 113 VSESGLYDVILDSRKPEAKEFRRWITSEVIPSIRKHGAYLTSEKIE--EVLLNPDAIIQ 169


>UniRef50_Q6BTQ2 Cluster: Similar to sp|P53971 Saccharomyces
           cerevisiae YNL023c; n=1; Debaryomyces hansenii|Rep:
           Similar to sp|P53971 Saccharomyces cerevisiae YNL023c -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 990

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
 Frame = -1

Query: 312 TVCGC-KYSGSPCFATLSGACAGFGRHAQTSIC--TCRRRGHVLPVHNLHI 169
           TVC   K  G PC    S  C     HA +++C   CR+R ++ P H  H+
Sbjct: 590 TVCKVLKNCGHPCMRVCSSDCTKRNTHASSTLCQSACRKRRNICP-HYCHL 639


>UniRef50_Q9YVP7 Cluster: ORF MSV195 ALI motif gene family protein;
           n=1; Melanoplus sanguinipes entomopoxvirus|Rep: ORF
           MSV195 ALI motif gene family protein - Melanoplus
           sanguinipes entomopoxvirus (MsEPV)
          Length = 87

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +3

Query: 102 LRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEH 236
           +  V+ +   V F AK+ A  LKY N  +AIR HV  K++ +F++
Sbjct: 13  IHIVIDNNNKVLFKAKNCAEILKYTNPLKAIRDHVRQKHQISFKN 57


>UniRef50_Q0IL00 Cluster: Bro-f; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: Bro-f - Leucania separata
           nuclear polyhedrosis virus (LsNPV)
          Length = 245

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 272 AKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGK 430
           AK   PL  HP+  L+ + GV  L+M+S         +WL+  ++P++  T +
Sbjct: 79  AKDEVPLNWHPNMWLLHEVGVYALVMRSNTTVARVFVQWLIGAILPELRKTDR 131


>UniRef50_Q6AC67 Cluster: Prophage antirepressor protein; n=2;
           Leifsonia xyli subsp. xyli|Rep: Prophage antirepressor
           protein - Leifsonia xyli subsp. xyli
          Length = 260

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           L+ + G+  LI++S+       + W+  EV+PQ+  TG Y+
Sbjct: 69  LVNEPGLYSLILRSRKTEARAFKRWVTHEVLPQIRRTGSYS 109


>UniRef50_A3X9C1 Cluster: Putative uncharacterized protein; n=1;
           Roseobacter sp. MED193|Rep: Putative uncharacterized
           protein - Roseobacter sp. MED193
          Length = 150

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCT 424
           LI++SG+ +LI +S  P     QEW+  +V+P V  T
Sbjct: 95  LISESGLYKLITRSDKPEAKPFQEWVTRDVLPSVRLT 131


>UniRef50_A0QB24 Cluster: Gp54 protein; n=2; Mycobacterium avium
           104|Rep: Gp54 protein - Mycobacterium avium (strain 104)
          Length = 263

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 15/60 (25%), Positives = 33/60 (55%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQ 493
           ++ +SG+  LI +S      +++ W+  EV+P +  TG Y   V +  ++++ +   +TQ
Sbjct: 75  VVNESGMYALIFQSNKDRARDVRRWVTSEVLPSIRKTGSYGAPV-LTEDEIVHRALTITQ 133


>UniRef50_Q58M49 Cluster: Putative uncharacterized protein; n=1;
           Cyanophage P-SSM2|Rep: Putative uncharacterized protein
           - Cyanophage P-SSM2
          Length = 355

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = -2

Query: 539 ERSVASAKSAWPPSIFASDRQFWQ*HH-LYPFQRPARTCPC 420
           E  +   +  WP   F SD   W+ H  +Y F+   R CPC
Sbjct: 262 ENVIYGIRGIWPSMCFNSDHYGWEMHPPVYGFETATRCCPC 302


>UniRef50_Q54HZ6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1219

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = -1

Query: 300 CKYSGSPCFATLSGACAGFGR-HAQTSICTC 211
           C  S   C+A+    C+GFG  + QT +CTC
Sbjct: 606 CDMSSGTCYASCPNDCSGFGTCNNQTGVCTC 636


>UniRef50_Q91BW9 Cluster: Bro-a; n=3; Nucleopolyhedrovirus|Rep:
           Bro-a - Helicoverpa armigera NPV
          Length = 244

 Score = 33.5 bits (73), Expect = 3.7
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +2

Query: 287 PLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWL 391
           P  + P+T  I ++GV +LIM S++ Y  + + WL
Sbjct: 76  PRNMKPNTKFINRAGVFELIMSSQMEYARQFRYWL 110


>UniRef50_Q63HM1 Cluster: Probable arylformamidase; n=21;
           Amniota|Rep: Probable arylformamidase - Homo sapiens
           (Human)
          Length = 308

 Score = 33.5 bits (73), Expect = 3.7
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)
 Frame = +2

Query: 380 QEWLLEEVIP-QVLCTGKY-APAVEMDTNDVIAKIDDLTQKLTVATQILRK 526
           Q W   +V+P Q LC G++ A   E+   D    +++LTQK  V TQI+ K
Sbjct: 254 QSWEFYQVLPVQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILK 304


>UniRef50_Q8QLL0 Cluster: BRO-b; n=2; Nucleopolyhedrovirus|Rep:
           BRO-b - Mamestra configurata NPV-A
          Length = 372

 Score = 33.1 bits (72), Expect = 4.9
 Identities = 12/39 (30%), Positives = 25/39 (64%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           I ++G+ +LI  SK+P   E + W+  +++ ++  TG+Y
Sbjct: 120 INRAGLFELIQASKMPKAQEFRNWINSDLLVKLCDTGEY 158


>UniRef50_Q197E1 Cluster: Putative uncharacterized protein; n=1;
           Aedes taeniorhynchus iridescent virus|Rep: Putative
           uncharacterized protein - Aedes taeniorhynchus
           iridescent virus
          Length = 406

 Score = 33.1 bits (72), Expect = 4.9
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +2

Query: 293 YLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKY 433
           Y     + I + G+  LIM S  P+  E Q+ + E+++P +   G Y
Sbjct: 94  YNEGKAIYINEPGLYALIMHSNAPFAEEFQDLVYEQILPSIRKYGSY 140


>UniRef50_Q65943 Cluster: E1B protein, large T-antigen; n=3; Canine
           adenovirus|Rep: E1B protein, large T-antigen - Canine
           adenovirus 1 (strain CLL) (CAdV-1)
          Length = 444

 Score = 33.1 bits (72), Expect = 4.9
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)
 Frame = -1

Query: 222 ICTCRRRG-HVLPVHNLHILNCWRCPWP 142
           +CTC   G HV+P+ N+H  +    PWP
Sbjct: 306 LCTCEGNGSHVVPLGNIHFASNREAPWP 333


>UniRef50_Q6NEV9 Cluster: Putative DNA-binding bacteriophage
           protein; n=2; Actinomycetales|Rep: Putative DNA-binding
           bacteriophage protein - Corynebacterium diphtheriae
          Length = 264

 Score = 32.7 bits (71), Expect = 6.5
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +3

Query: 81  FGEDTF-TLRYVLGDEQPVRFVAKDIASSLKYVNCERAIRVH 203
           F  D F T+R +  D Q + F  KD+A++L YVN  +A++ H
Sbjct: 8   FTNDVFGTIRTITTDVQ-MPFCGKDVATALGYVNASKAVQDH 48



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 317 ITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYA 436
           IT+  + +LI+ SKL    + + W+ +EV+P +   G YA
Sbjct: 70  ITEGDLYRLIISSKLSAAQKFEAWVFDEVLPTIRRHGVYA 109


>UniRef50_A5C2N5 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 246

 Score = 32.7 bits (71), Expect = 6.5
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -1

Query: 321 VMSTVCGCKYSGSPCFATLSGACAGFGRH 235
           V  ++CG K+ G PC+    GAC G G+H
Sbjct: 182 VTCSICGKKHWGKPCYKEF-GACFGCGKH 209


>UniRef50_Q8YHA3 Cluster: PHAGE-RELATED DNA BINDING PROTEIN; n=4;
           Brucella|Rep: PHAGE-RELATED DNA BINDING PROTEIN -
           Brucella melitensis
          Length = 191

 Score = 32.3 bits (70), Expect = 8.6
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = +2

Query: 311 VLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVE 448
           V+++++ + +LIM+S  P   + Q W+   V+P +L  G Y    E
Sbjct: 90  VIVSEARLYKLIMRSTKPEAKKFQNWVTGTVLPAILKDGLYVRGEE 135


>UniRef50_Q3JTQ5 Cluster: BRO family, N-terminal domain protein;
           n=1; Burkholderia pseudomallei 1710b|Rep: BRO family,
           N-terminal domain protein - Burkholderia pseudomallei
           (strain 1710b)
          Length = 239

 Score = 32.3 bits (70), Expect = 8.6
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = +2

Query: 314 LITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTGKYAPAVE 448
           ++++SG+  LIM+S+ P     ++W+   V+P +   G Y    E
Sbjct: 65  VVSESGLYALIMRSRKPQARAFRKWVTSVVLPAIRKDGSYVMGEE 109


>UniRef50_Q0VTH4 Cluster: Transcriptional regulator, GntR family;
           n=2; Alcanivorax borkumensis|Rep: Transcriptional
           regulator, GntR family - Alcanivorax borkumensis (strain
           SK2 / ATCC 700651 / DSM 11573)
          Length = 234

 Score = 32.3 bits (70), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +2

Query: 371 IELQEWLLEEVIPQVLCTGKYAPAVEMDTNDVIAKIDDLTQKLTVATQILRKQPI 535
           + L E +   +  Q++ TG+ AP   +  ND+  ++D  T  L  A ++L KQ I
Sbjct: 19  VSLSEQIARHLSEQII-TGELAPGSRLPENDLAKQLDVSTNSLREAFRLLEKQHI 72


>UniRef50_Q0LDQ8 Cluster: Von Willebrand factor, type A precursor;
           n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Von
           Willebrand factor, type A precursor - Herpetosiphon
           aurantiacus ATCC 23779
          Length = 831

 Score = 32.3 bits (70), Expect = 8.6
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = -2

Query: 431 TCPCIALEE*PPPKAILVILCRKAIWTSLSVES 333
           TCPC+ + + PPP  + + L +K +W   S+ +
Sbjct: 342 TCPCVDVPQPPPPPEVKLALDQKLVWYLPSINT 374


>UniRef50_Q05W40 Cluster: Putative uncharacterized protein; n=1;
           Synechococcus sp. RS9916|Rep: Putative uncharacterized
           protein - Synechococcus sp. RS9916
          Length = 162

 Score = 32.3 bits (70), Expect = 8.6
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +2

Query: 209 RQVQIDV*AC-RPNPAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKL 361
           R++Q+   AC R N A   D   K  DPL  HP      K  + +L+  +K+
Sbjct: 64  REIQLQAYACSRENTAEFCDRTVKLADPLMDHPRLPAACKDTIWELLQNAKV 115


>UniRef50_Q55YG4 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1002

 Score = 32.3 bits (70), Expect = 8.6
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = -3

Query: 262 WSMCWIWSACSNVDLYLPSTWTRIARSQFTYFKLLAMSLA 143
           W   WIW+  S   LYL S+  RIAR Q  + +L   S A
Sbjct: 667 WCKLWIWNVGSPYSLYLGSS-ARIARLQADHMRLCLNSFA 705


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 616,887,307
Number of Sequences: 1657284
Number of extensions: 13196543
Number of successful extensions: 35010
Number of sequences better than 10.0: 114
Number of HSP's better than 10.0 without gapping: 33923
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35000
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 40404161459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -