SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;...   110   4e-23
UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep: ...    65   1e-09
UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9; Nucl...    58   3e-07
UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6; Nucleopolyh...    51   2e-05
UniRef50_A1YRA1 Cluster: Late expression factor-10; n=2; Nucleop...    50   4e-05
UniRef50_Q9PYM1 Cluster: ORF175; n=2; Granulovirus|Rep: ORF175 -...    49   1e-04
UniRef50_Q91ER7 Cluster: ORF138 VP1054; n=5; Granulovirus|Rep: O...    45   0.002
UniRef50_Q8JRT3 Cluster: VP1054; n=1; Phthorimaea operculella gr...    44   0.004
UniRef50_Q6QXI7 Cluster: ORF127; n=1; Agrotis segetum granulovir...    44   0.004
UniRef50_Q9DVR8 Cluster: PxORF115 peptide; n=1; Plutella xyloste...    42   0.015
UniRef50_P40041 Cluster: Uncharacterized protein YER064C; n=3; S...    36   1.00 
UniRef50_O42926 Cluster: Vacuolar protein sorting-associated pro...    36   1.3  
UniRef50_A3J6M7 Cluster: Putative uncharacterized protein; n=1; ...    33   5.3  
UniRef50_A2FVG2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.3  
UniRef50_Q54JB3 Cluster: Putative heme A:farnesyltransferase; n=...    33   7.0  
UniRef50_P33151 Cluster: Cadherin-5 precursor; n=34; Tetrapoda|R...    33   7.0  

>UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 42.5 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 378

 Score =  110 bits (264), Expect = 4e-23
 Identities = 42/91 (46%), Positives = 71/91 (78%)
 Frame = +3

Query: 243 SSRGRKTILNADDVYECVLIKPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADDE 422
           ++  R+  LNA  V++C+L++P  +EHF+S++EAGE NM  L+ I+ T+  ++G++A  E
Sbjct: 87  AAAARRAFLNAGQVHDCLLLEPAPSEHFKSIEEAGETNMSTLRTILATLTSFLGRVASTE 146

Query: 423 YILIADRMYVDLIYSEFRAIILPQSAYIIKE 515
           Y LI DR+++DL+YSEFRA++LPQ AY++++
Sbjct: 147 YFLIVDRLFIDLVYSEFRAVVLPQHAYVLQQ 177



 Score =  100 bits (239), Expect = 4e-20
 Identities = 48/91 (52%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query: 1   KKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTV 180
           KK + L+ C SVKL P +P+R  K MQCW+HPRRA C+V R R+ Y D  NE+ +LHMTV
Sbjct: 5   KKLVTLNPCTSVKLVPHRPIRATK-MQCWMHPRRATCRVQRLRDAYHDERNESSLLHMTV 63

Query: 181 LNSVFLNEHAKLYYRHLL--RNDQAEAEKQF 267
            + +FL+E A+ YYR LL  R D A A + F
Sbjct: 64  YSDIFLDERARPYYRQLLRKRTDAAAARRAF 94



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 9/70 (12%)
 Frame = +2

Query: 527 SDSESGQSVDVCNELKYPWNLITANSFIVSTDE---------SRQSQYIYRTFLLYNTVL 679
           +D++S         ++ PWN I   + + +             RQSQYIY+TFL+Y T+L
Sbjct: 180 ADTDSSDEEPCERGVEPPWNQIVVAAHVAAAHRHEGARYNEWQRQSQYIYQTFLVYATLL 239

Query: 680 TAILKQNNPF 709
           T ILKQ+NPF
Sbjct: 240 TTILKQSNPF 249


>UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep:
           Vp1054 - Ecotropis obliqua NPV
          Length = 366

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 1/102 (0%)
 Frame = +3

Query: 207 RKIVLSALVAQRSSRGRKTILNADDVYECVLIKPIRT-EHFRSVDEAGEHNMGVLKIIID 383
           +K   S L++ +    R   +NADD+Y  V +  I + E F  +DE GE  M +L ++I 
Sbjct: 92  KKPYYSVLISPQDIAKRGIYMNADDLYAYVHLNQIDSDEQFFGIDENGERQMQILTMVIK 151

Query: 384 TVIKYIGKLADDEYILIADRMYVDLIYSEFRAIILPQSAYII 509
           ++I  + + +    IL  D + +DL+YS +R ++LPQ  Y I
Sbjct: 152 SIIDCLNQCSQ-YVILCVDELMIDLLYSSYRIVVLPQKLYAI 192



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 22/35 (62%), Positives = 28/35 (80%)
 Frame = +2

Query: 608 IVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           + +TD+   SQ +YRTFL+YNTVL+ ILKQ NPFN
Sbjct: 209 VPTTDDCVTSQNVYRTFLVYNTVLSMILKQRNPFN 243



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 18/96 (18%)
 Frame = +1

Query: 1   KKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPR-NNYSDPDNENDML--- 168
           K  +K   C S KLT FKP++ P    C  HP RANC+  +   +N  +  +E++ +   
Sbjct: 5   KNVVKFKQCVSEKLTVFKPLKRPPRTVCRFHPLRANCRAIKQHDDNLQNALDESESVFDE 64

Query: 169 --------------HMTVLNSVFLNEHAKLYYRHLL 234
                         H T++N+ +LN   K YY  L+
Sbjct: 65  ATLLVDQYLSKYFYHETIINTFYLNYKKKPYYSVLI 100


>UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9;
           Nucleopolyhedrovirus|Rep: ORF105 vp1054 virion protein -
           Spodoptera exigua MNPV
          Length = 346

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 30/75 (40%), Positives = 48/75 (64%)
 Frame = +1

Query: 10  IKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNS 189
           ++L+ CAS KLTPF+P++     QC IH  RANCKV +  +  +D + +N   H+T+LN 
Sbjct: 10  VRLNRCASEKLTPFRPIKVTS-TQCPIHLFRANCKVIKRYDAENDTNFDN---HLTILNG 65

Query: 190 VFLNEHAKLYYRHLL 234
           V+ N + + +Y  L+
Sbjct: 66  VYQNYNREPFYLALV 80



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 RKTILNADDVYECVLIKPIRT-EHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADDEYIL 431
           R    NA+D+   V +  +   E F  +D AGE N+  ++ +I  ++      AD  YIL
Sbjct: 89  RGVYTNANDMVLYVELHRLDDDERFFGIDAAGERNVATIRNVIKMIMDAFAVCAD-RYIL 147

Query: 432 IADRMYVDLIYSEFRAIILPQ 494
           + D + VDL+YS FR+IILPQ
Sbjct: 148 MIDELQVDLVYSIFRSIILPQ 168



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/32 (68%), Positives = 28/32 (87%)
 Frame = +2

Query: 617 TDESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           T+ + +SQ IYRTFL+YNTVLT +LKQ+NPFN
Sbjct: 193 TEAAFESQLIYRTFLMYNTVLTMLLKQSNPFN 224


>UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6;
           Nucleopolyhedrovirus|Rep: VP1054 virion protein -
           Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 352

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/64 (35%), Positives = 41/64 (64%)
 Frame = +3

Query: 318 EHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADDEYILIADRMYVDLIYSEFRAIILPQS 497
           E F ++DEAGE +M  L+  + ++I+Y+       Y+L+ D   +D+IYS+ R ++LPQ 
Sbjct: 123 EKFFTIDEAGERDMVALRRTVKSLIEYMHSSIRG-YVLMFDEPQIDVIYSQLRTVLLPQR 181

Query: 498 AYII 509
            Y++
Sbjct: 182 MYML 185



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/35 (60%), Positives = 26/35 (74%)
 Frame = +2

Query: 608 IVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           +  TD S +SQ IY+TFL+YNT LT +L Q NPFN
Sbjct: 204 VPDTDASVESQNIYKTFLVYNTTLTMMLNQRNPFN 238



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/74 (35%), Positives = 35/74 (47%)
 Frame = +1

Query: 13  KLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNSV 192
           K + C S K   FKP+   K  QC IHP RANC+V +    + + D +  + H T +   
Sbjct: 18  KYNQCVSEKSVSFKPITFRKS-QCPIHPLRANCRVIK---TFDEDDGKEIVYHFTFIEGY 73

Query: 193 FLNEHAKLYYRHLL 234
           F       YY  LL
Sbjct: 74  FKQYDGTPYYMRLL 87


>UniRef50_A1YRA1 Cluster: Late expression factor-10; n=2;
           Nucleopolyhedrovirus|Rep: Late expression factor-10 -
           Maruca vitrata MNPV
          Length = 78

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/42 (59%), Positives = 28/42 (66%)
 Frame = +3

Query: 3   ETDQVRPLCLGEINXXXXXXXXXXXXMLDTSSTSELQSNAST 128
           E DQ+R +CLGEI+            MLDTSSTSELQSNAST
Sbjct: 37  EKDQIRSMCLGEIDTFQTDATAEANAMLDTSSTSELQSNAST 78


>UniRef50_Q9PYM1 Cluster: ORF175; n=2; Granulovirus|Rep: ORF175 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 323

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/50 (42%), Positives = 36/50 (72%)
 Frame = +2

Query: 563 NELKYPWNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           ++++ P N I  +  +  T+E+  SQ IY++F++YNTVLT +L++ NPFN
Sbjct: 170 DDVEPPLNSIFNHETLPDTEEATASQDIYKSFVVYNTVLTMMLREANPFN 219



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/85 (29%), Positives = 47/85 (55%)
 Frame = +3

Query: 255 RKTILNADDVYECVLIKPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADDEYILI 434
           RK +L    +   V  K +  E F ++ EAGE +  +++++     +++   A+   +L+
Sbjct: 84  RKNLLTVGAMICGVQFKEMPPETFYAITEAGERDSELIRMVCRQAYRFVYNHANRLVLLL 143

Query: 435 ADRMYVDLIYSEFRAIILPQSAYII 509
            D +YVD +YS+ + +ILPQ  Y I
Sbjct: 144 KD-LYVDCLYSQRQCVILPQELYCI 167



 Score = 34.7 bits (76), Expect = 2.3
 Identities = 23/81 (28%), Positives = 35/81 (43%)
 Frame = +1

Query: 31  SVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNSVFLNEHA 210
           S + TPF P+   +  +C  HP R NC++T+         N     H T +   ++N  A
Sbjct: 15  SERSTPFVPLTVART-RCRFHPSRVNCRLTKILGL-----NSVSYEHFTFVAVCYVNTDA 68

Query: 211 KLYYRHLLRNDQAEAEKQFST 273
           + Y+  LL  D     K   T
Sbjct: 69  RPYFEMLLGADSDGLRKNLLT 89


>UniRef50_Q91ER7 Cluster: ORF138 VP1054; n=5; Granulovirus|Rep:
           ORF138 VP1054 - Cydia pomonella granulosis virus (CpGV)
           (Cydia pomonellagranulovirus)
          Length = 332

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 18/31 (58%), Positives = 25/31 (80%)
 Frame = +2

Query: 620 DESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           ++S  SQ+IY+ FL+YNTVLT +L + NPFN
Sbjct: 197 EDSVASQHIYKAFLVYNTVLTMMLSEKNPFN 227



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 15/87 (17%)
 Frame = +3

Query: 318 EHFRSVDEAGEHNMGVLKIIIDTVIKYI--------GKLADD------EYILIADRMYVD 455
           E  RS++EAGE+++ ++K ++  V +Y+        G   DD      +  L+   MYV 
Sbjct: 98  EELRSLEEAGEYDVQIVKKVLRFVYEYLNSDRGALNGHAKDDIVHEDAKVYLLFKEMYVQ 157

Query: 456 LIYSEFRAIILPQSAY-IIKEITQKAI 533
            +YS  + IILPQ  Y + KE  + A+
Sbjct: 158 CLYSHLQCIILPQEMYCLYKEGEEPAL 184



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 19/78 (24%), Positives = 37/78 (47%)
 Frame = +1

Query: 19  DLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNSVFL 198
           +L  ++ +  ++P+   +  QC +HP R NC + + +       N     H+T L++ + 
Sbjct: 5   ELVTALSIAVYQPVHVARK-QCRLHPNRTNCALLQTKGL-----NRIYCEHITTLDARYC 58

Query: 199 NEHAKLYYRHLLRNDQAE 252
           + +   YY  L  ND  E
Sbjct: 59  STNGDPYYEWLTLNDNNE 76


>UniRef50_Q8JRT3 Cluster: VP1054; n=1; Phthorimaea operculella
           granulovirus|Rep: VP1054 - Phthorimaea operculella
           granulovirus
          Length = 328

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 17/31 (54%), Positives = 25/31 (80%)
 Frame = +2

Query: 620 DESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           +++  SQ +Y+TF++YNTVLT +LK  NPFN
Sbjct: 194 EDATLSQDVYKTFIVYNTVLTMMLKSENPFN 224



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 14/87 (16%)
 Frame = +3

Query: 291 CVLIKPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADD--------------EYI 428
           CV  +    +  R+V++AGE+N  +++ ++  + +Y+  +  D               Y+
Sbjct: 87  CVQFEDNVDDKLRAVEKAGEYNFEIIRHVLKYINQYVYNVCGDLNSHAKTETKKTEQVYV 146

Query: 429 LIADRMYVDLIYSEFRAIILPQSAYII 509
           L+ D MYV  +YS  R IILP   Y I
Sbjct: 147 LLTD-MYVQCLYSPTRCIILPIQMYCI 172


>UniRef50_Q6QXI7 Cluster: ORF127; n=1; Agrotis segetum
           granulovirus|Rep: ORF127 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 331

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/43 (48%), Positives = 28/43 (65%)
 Frame = +2

Query: 584 NLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           N I   S +    E+  SQ IY++FL YNTVLT +L++ NPFN
Sbjct: 185 NKIFTFSSLPEFTEATASQDIYKSFLTYNTVLTMLLQEKNPFN 227



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 15/82 (18%)
 Frame = +3

Query: 309 IRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADD---------------EYILIADR 443
           +  E   S+ EAGE NM  +K+++ +V K++     D                Y+L+   
Sbjct: 95  VHGEKLGSIKEAGERNMSSVKLVLKSVYKFLNNDRTDLNGNARDASARDGNKTYVLLKS- 153

Query: 444 MYVDLIYSEFRAIILPQSAYII 509
           MYVD +YS+ + IILPQ  Y I
Sbjct: 154 MYVDCLYSDIQCIILPQEMYCI 175


>UniRef50_Q9DVR8 Cluster: PxORF115 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF115 peptide - Plutella xylostella
           granulovirus
          Length = 311

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 20/45 (44%), Positives = 28/45 (62%)
 Frame = +2

Query: 578 PWNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFN 712
           P N + ++  +   DES  SQ IY+ F++YNTVLT +L   N FN
Sbjct: 169 PINRLLSHFTVPECDESVVSQQIYKNFIVYNTVLTMMLNGPNMFN 213



 Score = 35.9 bits (79), Expect = 1.00
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 312 RTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADDEYILIADRMYVDLIYSEFRAIILP 491
           R + +  V   G      +K++   V  ++ K     YIL+ + M+VD +YS+   IILP
Sbjct: 97  RYDKYYCVCNGGSREYAQIKLVFKAVYNFLYKNNSSLYILL-NTMFVDCLYSDLDCIILP 155

Query: 492 -QSAYIIKEITQKAI 533
            +   I KE T   I
Sbjct: 156 LEMVCIYKEGTAPPI 170


>UniRef50_P40041 Cluster: Uncharacterized protein YER064C; n=3;
           Saccharomyces|Rep: Uncharacterized protein YER064C -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 505

 Score = 35.9 bits (79), Expect = 1.00
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -3

Query: 439 SAIKMYSSSASL-PMYLMTVSMMIFKTPMLCSPASSTLLKCSVRIGLINTHSYTSSALRI 263
           S +K Y   ASL P+  +   M + + P++CS   S  ++      +++ HS T  A   
Sbjct: 387 SLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNKQSNPMRPHSTSEVLSAHSSTKDASTP 446

Query: 262 -VFLPRLDRCATSADNTIL 209
               PR+ R +TSAD+TI+
Sbjct: 447 GKEEPRVTRSSTSADSTII 465


>UniRef50_O42926 Cluster: Vacuolar protein sorting-associated protein
            13b; n=1; Schizosaccharomyces pombe|Rep: Vacuolar protein
            sorting-associated protein 13b - Schizosaccharomyces
            pombe (Fission yeast)
          Length = 3131

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +3

Query: 402  GKLADDEYILIADRMYVDLIYSEFRAIILPQSAYIIKEITQKAIVKAGKVSTFVMNSNIL 581
            GK A DEY+  A+   VD++Y   +  I+  S YI+K       +   +VS   +NS+ L
Sbjct: 2904 GKYAFDEYLYHAEIQNVDILYISTKHFIITGSNYIVKIAVPVKQISGLRVSEHDLNSSCL 2963


>UniRef50_A3J6M7 Cluster: Putative uncharacterized protein; n=1;
           Flavobacteria bacterium BAL38|Rep: Putative
           uncharacterized protein - Flavobacteria bacterium BAL38
          Length = 404

 Score = 33.5 bits (73), Expect = 5.3
 Identities = 16/65 (24%), Positives = 40/65 (61%), Gaps = 5/65 (7%)
 Frame = +3

Query: 399 IGKLADDEYILIADRMYVDLI-----YSEFRAIILPQSAYIIKEITQKAIVKAGKVSTFV 563
           +GKL + +   +A   ++DL+     YSEF+ ++  +   +I  I+ ++++K+GK++ ++
Sbjct: 213 VGKLLNYKAAFLAT--FIDLVTTKYKYSEFKQLLPVEKTKMIASISDESLLKSGKINDYL 270

Query: 564 MNSNI 578
            + N+
Sbjct: 271 QDYNV 275


>UniRef50_A2FVG2 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 450

 Score = 33.5 bits (73), Expect = 5.3
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 3/133 (2%)
 Frame = -3

Query: 586 IPRIFEFITNVDTLPAFTIAFCVISFIMYAL*GKIMALNSE*IKSTYMRSAIKMYSSSAS 407
           I ++       D +P +   FC    +++ L   I   NS+   +         YS+S+ 
Sbjct: 63  IKKLNNIFNKTDDMPYYAEEFCYSYNLLFHLKDYITPDNSDFSANILTLVCTICYSASSC 122

Query: 406 LPMYLMTVSMMIFKTPMLCSPASSTLLKCSVRI-GLINTHSYTSSAL--RIVFLPRLDRC 236
           +   L    +  F  PML    SS  +  S+RI G I   S  S+ +  +  FL +L + 
Sbjct: 123 IEQILEGNFLEAFLQPMLGEGFSSECVSLSIRIAGCIAADSQESAEVIKQYDFLEKLSKW 182

Query: 235 ATSADNTILRARL 197
               D  +L A L
Sbjct: 183 IDIGDQKLLDASL 195


>UniRef50_Q54JB3 Cluster: Putative heme A:farnesyltransferase; n=1;
           Dictyostelium discoideum AX4|Rep: Putative heme
           A:farnesyltransferase - Dictyostelium discoideum AX4
          Length = 449

 Score = 33.1 bits (72), Expect = 7.0
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = +1

Query: 130 NNYSDPDNENDMLHMTVLNSVFLNEH---AKLYYRHLLRNDQAEAEKQFSTPTTCTS 291
           NNYS+ +N N+ +   +LN  FLN+     K+ Y ++        ++ +ST TT TS
Sbjct: 48  NNYSNNNNNNNNI---ILNDKFLNKQQNDKKIIYNNIFEEKNQFLKRIYSTSTTTTS 101


>UniRef50_P33151 Cluster: Cadherin-5 precursor; n=34; Tetrapoda|Rep:
           Cadherin-5 precursor - Homo sapiens (Human)
          Length = 784

 Score = 33.1 bits (72), Expect = 7.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 507 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 566

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 567 -GTSTLTVAVCKCNE 580


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 625,165,624
Number of Sequences: 1657284
Number of extensions: 11828090
Number of successful extensions: 36368
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 34856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36342
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57851245060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -