SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q06372 Cluster: 33 kDa early protein; n=12; Nucleopolyh...   165   1e-39
UniRef50_P41481 Cluster: P18 protein; n=12; Nucleopolyhedrovirus...   124   3e-27
UniRef50_Q99GW8 Cluster: ORF83; n=12; Nucleopolyhedrovirus|Rep: ...   106   5e-22
UniRef50_Q0N421 Cluster: Ac92-like protein; n=7; Nucleopolyhedro...   100   4e-20
UniRef50_Q7T9T6 Cluster: ORF_79; n=3; Granulovirus|Rep: ORF_79 -...    66   8e-10
UniRef50_Q9PYU2 Cluster: ORF101; n=7; Granulovirus|Rep: ORF101 -...    66   1e-09
UniRef50_Q0N420 Cluster: Ac93-like protein; n=3; Nucleopolyhedro...    52   1e-05
UniRef50_Q6JKD6 Cluster: P33; n=3; Nucleopolyhedrovirus|Rep: P33...    48   2e-04
UniRef50_Q0IL20 Cluster: ORF99; n=14; Nucleopolyhedrovirus|Rep: ...    36   0.77 
UniRef50_A1HRZ7 Cluster: Diguanylate cyclase; n=1; Thermosinus c...    36   1.3  
UniRef50_Q9ZZN7 Cluster: 30S ribosomal protein S3; n=1; Cyanidio...    35   1.8  
UniRef50_Q0JQ81 Cluster: Os01g0176700 protein; n=4; Oryza sativa...    35   1.8  
UniRef50_A3I202 Cluster: Putative outer membrane protein probabl...    34   4.1  
UniRef50_Q6BG07 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_Q6BFI3 Cluster: Surface protein with furin-like cystein...    33   7.2  
UniRef50_Q22XX0 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_Q0U9T2 Cluster: Predicted protein; n=1; Phaeosphaeria n...    33   7.2  
UniRef50_Q55648 Cluster: Sll0314 protein; n=2; Synechocystis sp....    33   9.5  
UniRef50_Q4P1F7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  

>UniRef50_Q06372 Cluster: 33 kDa early protein; n=12;
           Nucleopolyhedrovirus|Rep: 33 kDa early protein - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 282

 Score =  165 bits (401), Expect = 1e-39
 Identities = 73/88 (82%), Positives = 81/88 (92%)
 Frame = +2

Query: 251 SSKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIEWAINASPDMDLQQFRIEFMD 430
           +SKSAHLT+LLS QATYLYHFACL+KYKD+QKYEVQQLIEWA +A PD+DLQQFR+EFMD
Sbjct: 28  ASKSAHLTRLLSLQATYLYHFACLIKYKDVQKYEVQQLIEWAASAPPDIDLQQFRVEFMD 87

Query: 431 KTTELNLRSCQPKSFTYTFTTIWDTMTF 514
            T ELNLRSCQPKSF YTFTTIWDT+ F
Sbjct: 88  NTAELNLRSCQPKSFMYTFTTIWDTIHF 115



 Score =  137 bits (332), Expect = 2e-31
 Identities = 61/72 (84%), Positives = 69/72 (95%)
 Frame = +1

Query: 511 FLSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHIE 690
           FLSLIIDDMV TR+KSSLDFV QQLKTMKVLFYN+FFILQCAMCRDHYMNVKG++IYHIE
Sbjct: 115 FLSLIIDDMVATREKSSLDFVAQQLKTMKVLFYNIFFILQCAMCRDHYMNVKGYIIYHIE 174

Query: 691 LIEIALDKEKYG 726
            I++AL+KE+YG
Sbjct: 175 RIDVALEKERYG 186



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 32/45 (71%), Positives = 33/45 (73%)
 Frame = +3

Query: 171 MIPLTPLFSRYKDSYLLYSFRLIDLLRALNRRTLPNCCLRKQLTY 305
           MIPLTPLFSRYKDSYLLY+FRLIDLLRA     L    L  Q TY
Sbjct: 1   MIPLTPLFSRYKDSYLLYAFRLIDLLRASKSAHLTR-LLSLQATY 44


>UniRef50_P41481 Cluster: P18 protein; n=12;
           Nucleopolyhedrovirus|Rep: P18 protein - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 161

 Score =  124 bits (298), Expect = 3e-27
 Identities = 57/57 (100%), Positives = 57/57 (100%)
 Frame = -3

Query: 172 MATSKTIVLYLCQAPATASLYVSADTDADEPIIYFENITECLTDDQCDKFTYFAELK 2
           MATSKTIVLYLCQAPATASLYVSADTDADEPIIYFENITECLTDDQCDKFTYFAELK
Sbjct: 1   MATSKTIVLYLCQAPATASLYVSADTDADEPIIYFENITECLTDDQCDKFTYFAELK 57


>UniRef50_Q99GW8 Cluster: ORF83; n=12; Nucleopolyhedrovirus|Rep:
           ORF83 - Helicoverpa zea SNPV
          Length = 254

 Score =  106 bits (255), Expect = 5e-22
 Identities = 50/108 (46%), Positives = 69/108 (63%), Gaps = 1/108 (0%)
 Frame = +2

Query: 194 FSLQRQLFVVFVSSHRPFA-SSKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIE 370
           FS  R  + +F   +     SS S  L  +LS + TYLYH ACL+ YKDIQ+ E+ QL E
Sbjct: 8   FSRYRDSYFLFTFRYMDLIRSSPSKELALILSKELTYLYHIACLITYKDIQEQEIDQLRE 67

Query: 371 WAINASPDMDLQQFRIEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTF 514
           W ++    M L+Q + EF +K  +LNLR+ QPK++ YTFTTIWD++ F
Sbjct: 68  WLLSLPQTMTLEQMKTEFSNKMEQLNLRAPQPKNYAYTFTTIWDSIHF 115



 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 40/72 (55%), Positives = 54/72 (75%)
 Frame = +1

Query: 511 FLSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHIE 690
           FL L+IDDMV +R+K   + + Q L+ MK +FYNVFF L C MCR+HY+ +KG+LI  +E
Sbjct: 115 FLCLLIDDMVESREKYDNELIRQHLRLMKPVFYNVFFKLNCPMCRNHYLTIKGYLIMQVE 174

Query: 691 LIEIALDKEKYG 726
            IE+AL +EKYG
Sbjct: 175 RIEVALYREKYG 186



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/45 (57%), Positives = 34/45 (75%)
 Frame = +3

Query: 171 MIPLTPLFSRYKDSYLLYSFRLIDLLRALNRRTLPNCCLRKQLTY 305
           MIPLTPLFSRY+DSY L++FR +DL+R+   + L    L K+LTY
Sbjct: 1   MIPLTPLFSRYRDSYFLFTFRYMDLIRSSPSKELA-LILSKELTY 44


>UniRef50_Q0N421 Cluster: Ac92-like protein; n=7;
           Nucleopolyhedrovirus|Rep: Ac92-like protein - Clanis
           bilineata nucleopolyhedrosis virus
          Length = 252

 Score =  100 bits (239), Expect = 4e-20
 Identities = 42/86 (48%), Positives = 62/86 (72%)
 Frame = +2

Query: 257 KSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIEWAINASPDMDLQQFRIEFMDKT 436
           KS HL  +L+++ TYLY+ AC++ YK+IQ+ EV+QL EWA+      DL+  +I F  K 
Sbjct: 30  KSKHLASILATELTYLYNIACIITYKEIQELEVEQLKEWALTLDDKFDLEHMKIVFHHKM 89

Query: 437 TELNLRSCQPKSFTYTFTTIWDTMTF 514
            ELNLR+ +PK+++YTFTTIW+ + F
Sbjct: 90  HELNLRAFEPKNYSYTFTTIWNVIHF 115



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 39/72 (54%), Positives = 53/72 (73%)
 Frame = +1

Query: 511 FLSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHIE 690
           FL+L  DDMV  R     +F++  L+ +K ++YN+FF L CAMCRDHY+NVKGFLI  IE
Sbjct: 115 FLALFTDDMVLNRQNLQYEFIVNHLRQLKAIYYNLFFKLDCAMCRDHYLNVKGFLIAAIE 174

Query: 691 LIEIALDKEKYG 726
            IEI L++E++G
Sbjct: 175 RIEIWLNRERFG 186



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 22/45 (48%), Positives = 31/45 (68%)
 Frame = +3

Query: 171 MIPLTPLFSRYKDSYLLYSFRLIDLLRALNRRTLPNCCLRKQLTY 305
           MIPLTPL + YKDS+ L++FR +D +R L  + L +  L  +LTY
Sbjct: 1   MIPLTPLLAEYKDSFFLFTFRHLDRMRVLKSKHLAS-ILATELTY 44


>UniRef50_Q7T9T6 Cluster: ORF_79; n=3; Granulovirus|Rep: ORF_79 -
           Adoxophyes orana granulovirus (AoGV)
          Length = 267

 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +2

Query: 194 FSLQRQLFVVFVSSHRPFAS-SKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIE 370
           F   +Q + +FV         + S +L  ++S Q  +LY   CL+ Y      +V  LI+
Sbjct: 25  FIKYKQSYALFVYRFLDLTRMAPSENLKNVISKQVQFLYELQCLLIYNKSYAEQVTILIQ 84

Query: 371 WAINASPDMDLQQFRIEFMDKTTELNLRSCQPKSFTYTFTTIWDTM 508
           WA +   D+ L+ F+  ++ K  +L+L+   P  +T+TFT IWD++
Sbjct: 85  WASHLGADIKLETFQNMYLSKLEQLDLQRLSPAHYTFTFTVIWDSI 130



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/71 (40%), Positives = 41/71 (57%)
 Frame = +1

Query: 514 LSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHIEL 693
           + L+ D+++  R   SLD VM  +  +K +FYN+F IL C +C  HY+ V  F  Y  E 
Sbjct: 133 MCLVSDNIISNRQSFSLDNVMLYMSNIKWVFYNMFLILFCPICAKHYLTVNIF-AYEFEK 191

Query: 694 IEIALDKEKYG 726
           IE AL +E  G
Sbjct: 192 IETALYREIMG 202


>UniRef50_Q9PYU2 Cluster: ORF101; n=7; Granulovirus|Rep: ORF101 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 251

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 26/80 (32%), Positives = 47/80 (58%)
 Frame = +2

Query: 269 LTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           L  LL S+  +LYH  C++ YK+ +  +V  L++W  +   D+ L+  +  +++K  EL 
Sbjct: 34  LKNLLYSEVRFLYHLNCVIVYKETRSTDVDALLQWFQSLDADLKLEDIKNLYINKLQELK 93

Query: 449 LRSCQPKSFTYTFTTIWDTM 508
           L    P+ + ++FTTIWD +
Sbjct: 94  LSQLDPQKYLFSFTTIWDAI 113



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +1

Query: 514 LSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHIEL 693
           ++ + DDMV  RD+   + VM   K +K +FYN+F IL C  C  H++ V  F  Y IE 
Sbjct: 116 MAYVGDDMVTKRDQLPHESVMAFFKNLKWVFYNIFIILFCPKCARHFLTVDVF-PYEIER 174

Query: 694 IEIALDKEKYG 726
           IE+AL +EK G
Sbjct: 175 IEVALYREKLG 185



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 171 MIPLTPLFSRYKDSYLLYSFRLIDLLRALNRRTLPN 278
           M+  TPL  RY +S+ L++FR++D++R      L N
Sbjct: 1   MLTYTPLVKRYINSFQLFNFRMLDMIRVAPAEKLKN 36


>UniRef50_Q0N420 Cluster: Ac93-like protein; n=3;
           Nucleopolyhedrovirus|Rep: Ac93-like protein - Clanis
           bilineata nucleopolyhedrosis virus
          Length = 171

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/58 (43%), Positives = 33/58 (56%)
 Frame = -3

Query: 175 IMATSKTIVLYLCQAPATASLYVSADTDADEPIIYFENITECLTDDQCDKFTYFAELK 2
           I     TI LYLC  P      +  D   D+ ++YFE+I EC  D+ CDKF++FA LK
Sbjct: 15  IQPQQHTIYLYLCDMPVG----LQNDKLDDDNVLYFESIIECFDDESCDKFSFFAALK 68


>UniRef50_Q6JKD6 Cluster: P33; n=3; Nucleopolyhedrovirus|Rep: P33 -
           Neodiprion sertifer NPV
          Length = 252

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/71 (30%), Positives = 41/71 (57%)
 Frame = +1

Query: 514 LSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHIEL 693
           LS ++DD+V  R K     V  +++ +  L  N++  L C++C +HY+ V+G L+  IE 
Sbjct: 109 LSFVVDDIVSKRHKYDYKLVDNKIQNLYRLIANIYVKLGCSVCVEHYLLVRGMLLEPIER 168

Query: 694 IEIALDKEKYG 726
           + +++  E  G
Sbjct: 169 LRVSMLLEYRG 179


>UniRef50_Q0IL20 Cluster: ORF99; n=14; Nucleopolyhedrovirus|Rep:
           ORF99 - Leucania separata nuclear polyhedrosis virus
           (LsNPV)
          Length = 168

 Score = 36.3 bits (80), Expect = 0.77
 Identities = 15/29 (51%), Positives = 19/29 (65%)
 Frame = -3

Query: 88  DEPIIYFENITECLTDDQCDKFTYFAELK 2
           D  +IYFE I E LT+  CDK + F E+K
Sbjct: 34  DCDVIYFEGIIESLTNSSCDKLSCFVEMK 62


>UniRef50_A1HRZ7 Cluster: Diguanylate cyclase; n=1; Thermosinus
           carboxydivorans Nor1|Rep: Diguanylate cyclase -
           Thermosinus carboxydivorans Nor1
          Length = 794

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +2

Query: 149 HDRFASRHDTADAAFFSLQRQLFVVFVSSHRPFASSKSAHLTKLLSSQATYLYHFACLMK 328
           H    SR+    A  FS    L  +F SSH PF  + SAHL K+LS        F  +++
Sbjct: 204 HPNHVSRNFLQMALIFSFLADLSYLF-SSHTPFVLNVSAHLCKVLSYYYLQRAIFVVVIQ 262

Query: 329 --YKDIQKYEVQQLIEWAINASPDMDLQQFR 415
             Y++I K++ +     A NA    + +Q R
Sbjct: 263 NPYEEIMKFKDEMEKLAANNAKLYQESEQQR 293


>UniRef50_Q9ZZN7 Cluster: 30S ribosomal protein S3; n=1;
           Cyanidioschyzon merolae|Rep: 30S ribosomal protein S3 -
           Cyanidioschyzon merolae (Red alga)
          Length = 282

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 24/93 (25%), Positives = 41/93 (44%)
 Frame = +1

Query: 409 VSHRIYGQNHRTQFAFVPAQEFYLHVYHHMGHHDFLSLIIDDMVYTRDKSSLDFVMQQLK 588
           +SH+I  +N+R  + F    ++Y H   ++ + +FL   +    Y       +F+     
Sbjct: 1   MSHKIRPENYRLGYLFDWKNDWYTH---NINYSNFLIKNLKISEYLNRILYKNFLFLGDL 57

Query: 589 TMKVLFYNVFFILQCAMCRDHYMNVKGFLIYHI 687
           T+K     V   L C  C+D Y N    LI H+
Sbjct: 58  TLKSNALKVLISLTCYPCKDSYKNTNWDLINHL 90


>UniRef50_Q0JQ81 Cluster: Os01g0176700 protein; n=4; Oryza
           sativa|Rep: Os01g0176700 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 477

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +1

Query: 388 PRHGLATVSHRIYGQNHRTQ---FAFVPAQEFYLHVYHHMGHHDFLSLII 528
           P +        IYG +  TQ    A V AQE+Y H +HH+ HH   + ++
Sbjct: 319 PEYATQAAGPAIYGAHPATQPHYTAAVAAQEYYHHHHHHLQHHPAAAALV 368


>UniRef50_A3I202 Cluster: Putative outer membrane protein probably
           involved in nutrient binding; n=1; Algoriphagus sp.
           PR1|Rep: Putative outer membrane protein probably
           involved in nutrient binding - Algoriphagus sp. PR1
          Length = 799

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = +2

Query: 365 IEWAINASPDMDLQQFRIEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTFSVSSSTIW 538
           I W + A  + DL+  +  F D    ++    +   FTY++ T +D   F+  ++  W
Sbjct: 285 INWFLGALKNPDLKNSQANFYDGNLVISAPVSEKNEFTYSYYTSYDDFAFASDTTVSW 342


>UniRef50_Q6BG07 Cluster: Putative uncharacterized protein; n=1;
           Paramecium tetraurelia|Rep: Putative uncharacterized
           protein - Paramecium tetraurelia
          Length = 2954

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 13/51 (25%), Positives = 28/51 (54%)
 Frame = +2

Query: 329 YKDIQKYEVQQLIEWAINASPDMDLQQFRIEFMDKTTELNLRSCQPKSFTY 481
           ++D  K++++   ++ +N++ D   +Q+ + F  K  E+   SC   SF Y
Sbjct: 812 HEDFWKWDIKAFYKYFVNSNEDHYFEQYGLNFNTKNFEIVCTSCFSDSFLY 862


>UniRef50_Q6BFI3 Cluster: Surface protein with furin-like cysteine
           repeats, putative; n=2; Paramecium tetraurelia|Rep:
           Surface protein with furin-like cysteine repeats,
           putative - Paramecium tetraurelia
          Length = 2993

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +2

Query: 326 KYKDIQKYEVQQLIEWAINASPDMDLQQFRIEFMDKTTELNLRSCQ 463
           KYKD  K+E++    + IN +     + + ++  D   E+N  SCQ
Sbjct: 854 KYKDYWKWEIKAFYSYFINQNGQHPFETYVVDSDDSEQEINCLSCQ 899


>UniRef50_Q22XX0 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1197

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 4/94 (4%)
 Frame = +2

Query: 203  QRQLFVVFVSSHRPFASSKSAHLTKLLSSQ-ATYLYHFA---CLMKYKDIQKYEVQQLIE 370
            ++QL + +VS ++P  S    HL KL + Q +T L  F     L K  DI  Y+V +L+ 
Sbjct: 825  RQQLQIYYVSKYQP--SQNLQHLRKLPAFQLSTPLKPFGEEHNLQKISDINLYKVIELMN 882

Query: 371  WAINASPDMDLQQFRIEFMDKTTELNLRSCQPKS 472
            +    S    L Q +   +DK T +      P+S
Sbjct: 883  YPQTLSDTTFLDQIKYCIIDKYTAIPYLLLYPQS 916


>UniRef50_Q0U9T2 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 538

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = -3

Query: 142 LCQAPATASLYVSADTDADEPIIYFENITECLTDDQ 35
           LCQAP   SLY + D +  E I Y++ I E   +D+
Sbjct: 201 LCQAPGRMSLYKTFDGEQPECIPYYDKILEKFKEDE 236


>UniRef50_Q55648 Cluster: Sll0314 protein; n=2; Synechocystis sp.
           PCC 6803|Rep: Sll0314 protein - Synechocystis sp.
           (strain PCC 6803)
          Length = 314

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 125 GRRLTQIQHDRFASRHDTADAAFFSLQRQLFVVFVSSHRPFASSKSAHLTKLLSSQATYL 304
           G+  T  +H   AS  +  D    +L R    +F+S + PF+ S+         +   YL
Sbjct: 152 GKTGTVFEHLDKASAINPNDPEL-NLLRGYLDLFLSRYTPFSQSEQVISRFEQYAAPDYL 210

Query: 305 YHFACLMKYKDIQKYEVQQL-IEWAINASPD-MDLQQFRIEFM 427
            + A    Y+D++KY++    I+ A+  +PD  +LQ  + +F+
Sbjct: 211 RYRALATTYRDLEKYDLAMANIDRALAITPDNPELQYLKGQFL 253


>UniRef50_Q4P1F7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 880

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)
 Frame = +2

Query: 128 RRLTQIQHDRFASRHDTADAAFFSLQRQLFVVFVSSHRPFASSKSAH--LTKLLSSQAT 298
           RRLT++     ASR+    A    L ++L    +SS RPF+S  S++  LTK  SSQA+
Sbjct: 304 RRLTRVA----ASRNGAMGATIAELTKKLGQQSISSPRPFSSRSSSNTSLTKSSSSQAS 358


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 708,649,765
Number of Sequences: 1657284
Number of extensions: 14126639
Number of successful extensions: 37672
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 36251
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37638
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 59090914597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -