SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P11138 Cluster: Trans-activating transcriptional regula...   144   3e-33
UniRef50_O10373 Cluster: Uncharacterized 11.0 kDa protein; n=13;...    75   1e-12
UniRef50_P41704 Cluster: Uncharacterized 22.9 kDa protein in IE0...    72   1e-11
UniRef50_O10375 Cluster: Uncharacterized 21.8 kDa protein; n=3; ...    45   0.002
UniRef50_Q0ILA5 Cluster: ORF14; n=2; Nucleopolyhedrovirus|Rep: O...    43   0.010
UniRef50_Q462F2 Cluster: Orf14; n=13; Nucleopolyhedrovirus|Rep: ...    42   0.023
UniRef50_P89258 Cluster: AcNPV ORF145 homolog; n=4; Granulovirus...    39   0.16 
UniRef50_Q580S7 Cluster: Putative uncharacterized protein; n=1; ...    36   0.85 
UniRef50_Q555X5 Cluster: MIZ type Zn finger-containing protein; ...    36   1.5  
UniRef50_Q22D27 Cluster: Response regulator receiver domain cont...    35   2.0  
UniRef50_Q6C054 Cluster: Similarity; n=1; Yarrowia lipolytica|Re...    35   2.0  
UniRef50_Q95PH9 Cluster: Histidine kinase DhkG; n=2; Dictyosteli...    34   3.4  
UniRef50_A6Q2P7 Cluster: Flagellar hook-associated protein 2 Fli...    33   7.9  
UniRef50_Q232N7 Cluster: Putative uncharacterized protein; n=1; ...    33   7.9  
UniRef50_Q1RL92 Cluster: Zinc finger protein; n=1; Ciona intesti...    33   7.9  

>UniRef50_P11138 Cluster: Trans-activating transcriptional
           regulatory protein; n=11; Nucleopolyhedrovirus|Rep:
           Trans-activating transcriptional regulatory protein -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 582

 Score =  144 bits (348), Expect = 3e-33
 Identities = 69/77 (89%), Positives = 73/77 (94%)
 Frame = +3

Query: 279 MTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAA 458
           MTQINFNASYTSA TPSRASFDN YSEFCDKQ PNDYL+YYN+PTPDGADTV+SDSETAA
Sbjct: 1   MTQINFNASYTSASTPSRASFDNSYSEFCDKQ-PNDYLSYYNHPTPDGADTVISDSETAA 59

Query: 459 ASNFLASVNSLTDDNDI 509
           ASNFLASVNSLT DND+
Sbjct: 60  ASNFLASVNSLT-DNDL 75



 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 42/59 (71%), Positives = 48/59 (81%)
 Frame = +1

Query: 598 EPSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF*QE*IEA*IQKSTI 774
           +PSPSSAY+AESFE S GVNQPSA GTKRKLDEYLD+SQ VVGQF +  +    +KSTI
Sbjct: 106 QPSPSSAYHAESFEHSAGVNQPSATGTKRKLDEYLDNSQGVVGQFNKIKLRPKYKKSTI 164



 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 27/34 (79%), Positives = 28/34 (82%)
 Frame = +2

Query: 509 MECLLKTTDNLGEAVSSAYYSESLELPVAENHRP 610
           +ECLLKTTDNL EAVSSAYYSESLE PV E   P
Sbjct: 76  VECLLKTTDNLEEAVSSAYYSESLEQPVVEQPSP 109


>UniRef50_O10373 Cluster: Uncharacterized 11.0 kDa protein; n=13;
           Nucleopolyhedrovirus|Rep: Uncharacterized 11.0 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 95

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 31/43 (72%), Positives = 36/43 (83%)
 Frame = +2

Query: 2   PHKVQMFCESNHEFDLDSASCKPIVYDRTGSGCAARMYRNLLL 130
           PHKV+MFC+  HEF+LDSA+C PI YD  GSGC AR+YRNLLL
Sbjct: 53  PHKVRMFCDPGHEFELDSATCVPIEYDCLGSGCTARLYRNLLL 95


>UniRef50_P41704 Cluster: Uncharacterized 22.9 kDa protein in
           IE0-IE1 intergenic region; n=9;
           Nucleopolyhedrovirus|Rep: Uncharacterized 22.9 kDa
           protein in IE0-IE1 intergenic region - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 201

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 31/34 (91%), Positives = 33/34 (97%)
 Frame = -3

Query: 232 KKCRAHHKDIDIFKHLCPELQIDNSVVQLESHSS 131
           +KCRAHHKDIDIFKHLCPELQIDNSVVQLE+ SS
Sbjct: 168 QKCRAHHKDIDIFKHLCPELQIDNSVVQLETRSS 201


>UniRef50_O10375 Cluster: Uncharacterized 21.8 kDa protein; n=3;
           Nucleopolyhedrovirus|Rep: Uncharacterized 21.8 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 197

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = -3

Query: 232 KKCRAHHKDIDIFKHLCPELQIDNSVVQLE 143
           ++CRAHHKD+     LCP+L++D+SVVQ +
Sbjct: 159 QRCRAHHKDVAAMAMLCPDLRVDDSVVQFD 188


>UniRef50_Q0ILA5 Cluster: ORF14; n=2; Nucleopolyhedrovirus|Rep:
           ORF14 - Leucania separata nuclear polyhedrosis virus
           (LsNPV)
          Length = 95

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 2   PHKVQMFCESNHEFDLDSASCKPI-VYDRTGSGCAARMYRNLLL 130
           PH +   C+   +FDLD+ +C+P+ ++  T  GC  R+ RNLLL
Sbjct: 54  PHAIHFLCQPQEQFDLDTQTCQPVDLFLET--GCVGRLNRNLLL 95


>UniRef50_Q462F2 Cluster: Orf14; n=13; Nucleopolyhedrovirus|Rep:
           Orf14 - Trichoplusia ni SNPV
          Length = 93

 Score = 41.5 bits (93), Expect = 0.023
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = +2

Query: 2   PHKVQMFCESNHEFDLDSASCKPIVYDRTGSGCAARMYRNLLL 130
           P K   +C  N +FDL+  SC P   D     C AR YR+LLL
Sbjct: 53  PRKTHFYCPPNQQFDLEQQSCIP--NDLNDDSCMARKYRSLLL 93


>UniRef50_P89258 Cluster: AcNPV ORF145 homolog; n=4;
           Granulovirus|Rep: AcNPV ORF145 homolog - Xestia c-nigrum
           granulosis virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 99

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 18/43 (41%), Positives = 25/43 (58%)
 Frame = +2

Query: 2   PHKVQMFCESNHEFDLDSASCKPIVYDRTGSGCAARMYRNLLL 130
           P  ++++C+   EFD D  SC PI  D    GC +R+ R LLL
Sbjct: 60  PQGIKLYCDQGQEFDPDKCSCVPI--DEV-DGCYSRLMRRLLL 99


>UniRef50_Q580S7 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 487

 Score = 36.3 bits (80), Expect = 0.85
 Identities = 13/35 (37%), Positives = 24/35 (68%)
 Frame = +3

Query: 9   KCKCFVNQITNSTWTRPAASLSCTIARAAGVRLAC 113
           +C+ FV+ ++ S+  RP  +++CT+  A GV +AC
Sbjct: 150 RCRKFVDALSRSSLRRPEGNIACTLFAAVGVAVAC 184


>UniRef50_Q555X5 Cluster: MIZ type Zn finger-containing protein;
           n=3; Dictyostelium discoideum|Rep: MIZ type Zn
           finger-containing protein - Dictyostelium discoideum AX4
          Length = 834

 Score = 35.5 bits (78), Expect = 1.5
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 6/82 (7%)
 Frame = +3

Query: 264 NNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNY------YNNPTPDGA 425
           N+ TT T  N N++Y S+   S ++ +  Y+   +    N+Y NY      YNN   +  
Sbjct: 153 NSTTTTTTTNNNSNYNSSNNNSNSNNNFNYNNNNNNYNNNNYNNYNNYNNNYNNNNYNYN 212

Query: 426 DTVVSDSETAAASNFLASVNSL 491
            ++ S+    A++NF   V  L
Sbjct: 213 GSINSEHHNQASNNFQLQVQKL 234


>UniRef50_Q22D27 Cluster: Response regulator receiver domain
            containing protein; n=1; Tetrahymena thermophila
            SB210|Rep: Response regulator receiver domain containing
            protein - Tetrahymena thermophila SB210
          Length = 1468

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 19/74 (25%), Positives = 38/74 (51%)
 Frame = +3

Query: 354  SEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSLTDDNDIWNVCSRPL 533
            SE C++   N+YLNY+N+P  + +  V+S+           +     + ++   VC +P 
Sbjct: 1180 SELCNQVLKNNYLNYFNSPKQEESCDVMSE----------CTEKKFPNQSEKLKVCEKPQ 1229

Query: 534  IISEKQLVLLIIRN 575
             +  K+++L I +N
Sbjct: 1230 KLQRKKMILKIDQN 1243


>UniRef50_Q6C054 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep:
           Similarity - Yarrowia lipolytica (Candida lipolytica)
          Length = 331

 Score = 35.1 bits (77), Expect = 2.0
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = +3

Query: 309 TSAPTPSRAS--FDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASV 482
           + +P+P   S  FD   S   D   P D     +NP     D+ ++D+E +  +     V
Sbjct: 4   SESPSPGHDSDTFDRNGSPLSDVSSPADTNTSASNPAHPTDDSSLTDTEASLKAQLAGFV 63

Query: 483 NSLTDDNDI--WNVCSRPLI 536
             L DD +I   N CS  ++
Sbjct: 64  EGLVDDTNITDTNTCSATVV 83


>UniRef50_Q95PH9 Cluster: Histidine kinase DhkG; n=2; Dictyostelium
            discoideum|Rep: Histidine kinase DhkG - Dictyostelium
            discoideum (Slime mold)
          Length = 3432

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 22/108 (20%), Positives = 47/108 (43%), Gaps = 1/108 (0%)
 Frame = +3

Query: 261  VNNQTTMTQINFNASYTSAPTPSRASFDNGYS-EFCDKQQPNDYLNYYNNPTPDGADTVV 437
            +NN      IN N+S  +    +  + +N YS  + +    N+  N  NN   +  +   
Sbjct: 2284 INNNINNNNININSSGYNNTNKNDNNNNNNYSPAYNNNNNNNNNNNNNNNNNNNNNNNNN 2343

Query: 438  SDSETAAASNFLASVNSLTDDNDIWNVCSRPLIISEKQLVLLIIRNPL 581
            +++      N +   +S  +++  WN+C   +   ++ L  L+I N +
Sbjct: 2344 NNNNNKKQINEIIKNDSFNEEDGTWNMCLSMINYVKRTLTPLLITNAI 2391


>UniRef50_A6Q2P7 Cluster: Flagellar hook-associated protein 2 FliD;
           n=1; Nitratiruptor sp. SB155-2|Rep: Flagellar
           hook-associated protein 2 FliD - Nitratiruptor sp.
           (strain SB155-2)
          Length = 452

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 23/55 (41%), Positives = 31/55 (56%)
 Frame = -3

Query: 586 QLKGFRIISRTNCFSEIISGLEQTFHISLSSVNELTLAKKFEAAAVSLSDTTVSA 422
           +L G  I + TN FS+++SG+E T        + LT+AK F     SL DT VSA
Sbjct: 237 KLNGIIIENATNTFSDVLSGVEIT--AQEVGTSSLTVAKDFSDIENSL-DTIVSA 288


>UniRef50_Q232N7 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 469

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = +3

Query: 267 NQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDS 446
           N  +++Q+N  +   S   P+ +S  N  S    +++ N+Y+N +NN   + A TV  D 
Sbjct: 341 NFQSISQLNNLSQTYSQLKPALSSIQNNLSPLLIQKKNNNYINNFNNFNSNFASTVFQDD 400

Query: 447 E 449
           +
Sbjct: 401 Q 401


>UniRef50_Q1RL92 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 1089

 Score = 33.1 bits (72), Expect = 7.9
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query: 285 QINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYY-NNPTPDGA 425
           Q    +S +S P+PS+A++D+ YS+  D +  +D+ +Y    P  +G+
Sbjct: 112 QNRHQSSPSSIPSPSKATYDSKYSQSIDSEVDSDHRSYVAATPNKEGS 159


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 754,018,556
Number of Sequences: 1657284
Number of extensions: 15039576
Number of successful extensions: 43714
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 41769
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43685
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 65027411410
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -