SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P11042 Cluster: Early 39 kDa protein; n=5; Nucleopolyhe...   180   4e-44
UniRef50_Q05121 Cluster: Early 39 kDa protein; n=7; Nucleopolyhe...   119   6e-26
UniRef50_P21288 Cluster: Late expression factor 11; n=6; Nucleop...   103   4e-21
UniRef50_Q91BX9 Cluster: 39K Protein; n=4; Nucleopolyhedrovirus|...    95   2e-18
UniRef50_Q80LT3 Cluster: 39K protein; n=1; Adoxophyes honmai NPV...    95   2e-18
UniRef50_Q0N475 Cluster: 39K/PP31; n=1; Clanis bilineata nucleop...    89   8e-17
UniRef50_A0EYS7 Cluster: 39K; n=1; Ecotropis obliqua NPV|Rep: 39...    88   2e-16
UniRef50_Q4KT52 Cluster: 39K/pp31; n=2; Nucleopolyhedrovirus|Rep...    88   2e-16
UniRef50_Q9J817 Cluster: ORF120 39K / pp31; n=3; Nucleopolyhedro...    86   7e-16
UniRef50_Q8QL84 Cluster: 39k/pp31; n=2; Nucleopolyhedrovirus|Rep...    83   9e-15
UniRef50_O55584 Cluster: 39K; n=2; Leucania separata nuclear pol...    83   9e-15
UniRef50_Q9IK80 Cluster: 39k protein; n=1; Spodoptera litura NPV...    80   6e-14
UniRef50_Q9YMT0 Cluster: Ld-39K/pp31; n=1; Lymantria dispar MNPV...    65   1e-09
UniRef50_Q91GM8 Cluster: Late expression factor 11; n=5; Nucleop...    55   2e-06
UniRef50_Q7TLW3 Cluster: Late expression factor 11; n=1; Chorist...    54   4e-06
UniRef50_Q9LKV1 Cluster: F21B23.8 protein; n=3; Arabidopsis thal...    42   0.020
UniRef50_Q9PYY8 Cluster: ORF55; n=2; Granulovirus|Rep: ORF55 - X...    40   0.047
UniRef50_Q9DVY7 Cluster: PxORF45 peptide; n=1; Plutella xylostel...    39   0.11 
UniRef50_Q6KIG7 Cluster: Ribonuclease; n=1; Mycoplasma mobile|Re...    37   0.58 
UniRef50_Q7REA2 Cluster: Putative uncharacterized protein PY0516...    35   1.8  
UniRef50_Q41556 Cluster: Transcription factor HBP-1a; n=4; BEP c...    35   2.3  
UniRef50_A2DYN8 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_A0E7M0 Cluster: Chromosome undetermined scaffold_81, wh...    35   2.3  
UniRef50_Q8II59 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_Q8I5B0 Cluster: Putative uncharacterized protein; n=2; ...    34   3.1  
UniRef50_UPI0001509CE2 Cluster: Calpain family cysteine protease...    34   4.1  
UniRef50_Q8KUD0 Cluster: EF0012; n=1; Enterococcus faecalis|Rep:...    33   5.4  
UniRef50_Q4Y1A1 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_A6Q7W3 Cluster: Glutathionylspermidine synthase; n=27; ...    33   7.2  
UniRef50_Q24GN9 Cluster: Cyclic nucleotide-binding domain contai...    33   7.2  
UniRef50_Q248B2 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_UPI0000499666 Cluster: protein kinase; n=2; Entamoeba h...    33   9.5  
UniRef50_Q2S0A6 Cluster: TrkH potassium uptake protein; n=1; Sal...    33   9.5  
UniRef50_Q9JPC7 Cluster: Hypothetical membrane protein; n=1; Rub...    33   9.5  
UniRef50_A0DL70 Cluster: Chromosome undetermined scaffold_55, wh...    33   9.5  
UniRef50_A0CPI6 Cluster: Chromosome undetermined scaffold_23, wh...    33   9.5  
UniRef50_Q7N2H1 Cluster: Succinylglutamate desuccinylase; n=1; P...    33   9.5  

>UniRef50_P11042 Cluster: Early 39 kDa protein; n=5;
           Nucleopolyhedrovirus|Rep: Early 39 kDa protein -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 275

 Score =  180 bits (437), Expect = 4e-44
 Identities = 81/86 (94%), Positives = 84/86 (97%)
 Frame = +3

Query: 261 IVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAM 440
           IVNFLE+KNINYILNV+PVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAM
Sbjct: 41  IVNFLERKNINYILNVVPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAM 100

Query: 441 WDLVKNTPELADFVFIFDHTEKMVKK 518
           WDLVKN PELADFVFIFDHTEK+ KK
Sbjct: 101 WDLVKNKPELADFVFIFDHTEKLGKK 126



 Score =  128 bits (310), Expect = 1e-28
 Identities = 63/75 (84%), Positives = 66/75 (88%)
 Frame = +2

Query: 503 KDGKKMADRXXXXXXXDNAAIPASKKRQTAVLTNANLAELKESCEMRDKLYSEFYSLLNE 682
           K GKKMADR       +NAAIPASKKRQT VLTNANLAELKESCEMRDKLYSEFYSLLNE
Sbjct: 122 KLGKKMADRSTSSSSSENAAIPASKKRQTVVLTNANLAELKESCEMRDKLYSEFYSLLNE 181

Query: 683 TFNNNVAPLLSSIYD 727
           TFN+NVAPLLS+IYD
Sbjct: 182 TFNHNVAPLLSNIYD 196



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 36/42 (85%), Positives = 39/42 (92%)
 Frame = +1

Query: 139 MVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLLLL 264
           MVN+PEQQS  ETAAVCKNEKLLNKLESSSYNKSNMDQL ++
Sbjct: 1   MVNVPEQQSP-ETAAVCKNEKLLNKLESSSYNKSNMDQLAVI 41


>UniRef50_Q05121 Cluster: Early 39 kDa protein; n=7;
           Nucleopolyhedrovirus|Rep: Early 39 kDa protein - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 261

 Score =  119 bits (287), Expect = 6e-26
 Identities = 51/84 (60%), Positives = 66/84 (78%)
 Frame = +3

Query: 264 VNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMW 443
           +NF EKK++NY +  +P   DERK SKR K+V N+N YILFNS+YTKI++PEWP+SP MW
Sbjct: 41  INFFEKKSVNYTVVALPCSGDERKASKRPKRVNNHNMYILFNSFYTKIRRPEWPNSPTMW 100

Query: 444 DLVKNTPELADFVFIFDHTEKMVK 515
           D VK   EL+DFV +FDHT+K+ K
Sbjct: 101 DTVKAHKELSDFVRVFDHTQKLGK 124



 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 32/50 (64%), Positives = 41/50 (82%)
 Frame = +2

Query: 578 KRQTAVLTNANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           KR+ +V+TN  +AE++E+C+ RDKLYSEFYSLLNETF   VAP  S+IYD
Sbjct: 142 KRRRSVITN--VAEVQENCDQRDKLYSEFYSLLNETFKTGVAPATSNIYD 189


>UniRef50_P21288 Cluster: Late expression factor 11; n=6;
           Nucleopolyhedrovirus|Rep: Late expression factor 11 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 112

 Score =  103 bits (247), Expect = 4e-21
 Identities = 46/47 (97%), Positives = 46/47 (97%)
 Frame = +2

Query: 2   FTVITDKCSKRKVCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW 142
           FTVITDKCSKRKVCLHHKRIARLLGIKKIYHQEYKRVVSKVYK QTW
Sbjct: 66  FTVITDKCSKRKVCLHHKRIARLLGIKKIYHQEYKRVVSKVYKKQTW 112


>UniRef50_Q91BX9 Cluster: 39K Protein; n=4;
           Nucleopolyhedrovirus|Rep: 39K Protein - Helicoverpa
           armigera NPV
          Length = 312

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 41/87 (47%), Positives = 63/87 (72%)
 Frame = +3

Query: 255 IAIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSP 434
           + ++N  EK+ I Y ++VMP + D++K+SK+ KK+ +NNKYILFN++ +KIKQ  WPSS 
Sbjct: 27  VNVINLFEKQKIGYQVHVMPTIADDKKLSKKIKKITSNNKYILFNTFISKIKQSGWPSSS 86

Query: 435 AMWDLVKNTPELADFVFIFDHTEKMVK 515
            +W+LVK   +   F+ IFD+ EK+ K
Sbjct: 87  HLWNLVKVHNQSDAFLHIFDYMEKIGK 113



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/43 (51%), Positives = 30/43 (69%)
 Frame = +2

Query: 599 TNANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           ++ NL E+KES E R K+Y+EF ++L  T+ NN AP  S IYD
Sbjct: 154 SDLNLDEIKESNEKRSKVYTEFNNILIYTYTNNKAPATSIIYD 196


>UniRef50_Q80LT3 Cluster: 39K protein; n=1; Adoxophyes honmai
           NPV|Rep: 39K protein - Adoxophyes honmai
           nucleopolyhedrovirus
          Length = 261

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 43/84 (51%), Positives = 59/84 (70%)
 Frame = +3

Query: 264 VNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMW 443
           +N  EKK + Y+L   P+  D++K +KR KK I+NNKYILFNSWY KIK+  +PSS  MW
Sbjct: 30  INMYEKKKVPYVLLTSPLYTDDKKSAKRAKKPISNNKYILFNSWYHKIKEDHYPSSSQMW 89

Query: 444 DLVKNTPELADFVFIFDHTEKMVK 515
           +L+KN  +  +FV +FD  EK+ K
Sbjct: 90  NLMKN--KSTEFVNLFDFVEKVGK 111



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +2

Query: 608 NLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIY 724
           N  E+  S   R +LY+EFY LLN T  N+ AP     Y
Sbjct: 132 NETEVINSNTKRMQLYNEFYKLLNNTLENDSAPATHQFY 170


>UniRef50_Q0N475 Cluster: 39K/PP31; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: 39K/PP31 - Clanis
           bilineata nucleopolyhedrosis virus
          Length = 281

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 48/134 (35%), Positives = 68/134 (50%)
 Frame = +3

Query: 258 AIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPA 437
           A +   EKK + Y   V  V   ++K  K+ KK+INNNKYILFNSWYTKI++  W +S  
Sbjct: 30  AKIKLFEKKKVAYRFKVSEVFNMDKKSVKKVKKIINNNKYILFNSWYTKIRKSNWLNSHD 89

Query: 438 MWDLVKNTPELADFVFIFDHTEKMVKKWPTDRHRRLQATTQQFQRAKKDRLRCLPTQIWQ 617
           MW+L+K++     FV IFD  EK+       +       T      K  ++     +I +
Sbjct: 90  MWNLMKDSLLAKPFVDIFDFMEKLASNTVVSKKHSSVDETSSDGEIKPKKVEFDSDEIKE 149

Query: 618 N*KRAAKCAISFIR 659
           N +R  K    F R
Sbjct: 150 NNERRVKLYEEFYR 163



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/37 (59%), Positives = 26/37 (70%)
 Frame = +2

Query: 617 ELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           E+KE+ E R KLY EFY +LN TF  + AP  SSIYD
Sbjct: 146 EIKENNERRVKLYEEFYRVLNVTFATDTAPPSSSIYD 182


>UniRef50_A0EYS7 Cluster: 39K; n=1; Ecotropis obliqua NPV|Rep: 39K -
           Ecotropis obliqua NPV
          Length = 293

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 39/87 (44%), Positives = 55/87 (63%)
 Frame = +3

Query: 255 IAIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSP 434
           +A +   EKK + Y + V  +   +RK+ KR KK+I NNKYILFNSWYTK ++  W SS 
Sbjct: 29  VAKIKLFEKKKMTYNITVNEIHNYDRKIVKRGKKMITNNKYILFNSWYTKNRKSHWLSSH 88

Query: 435 AMWDLVKNTPELADFVFIFDHTEKMVK 515
            MW+ +KN      F+ +FD+ EK+ K
Sbjct: 89  DMWNYMKNNAACKTFISLFDYIEKLSK 115



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = +2

Query: 608 NLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           NL E+KES   R K+Y EFY +L   F     P  S +YD
Sbjct: 159 NLEEIKESNNKRIKMYDEFYRVLTTAFKTGAPPTCSFLYD 198


>UniRef50_Q4KT52 Cluster: 39K/pp31; n=2; Nucleopolyhedrovirus|Rep:
           39K/pp31 - Chrysodeixis chalcites nucleopolyhedrovirus
          Length = 317

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 44/102 (43%), Positives = 61/102 (59%), Gaps = 13/102 (12%)
 Frame = +3

Query: 264 VNFLEKKNINYILNVMPVMQD-------------ERKMSKRKKKVINNNKYILFNSWYTK 404
           +  LEKK I Y + +MPV  D             +++ +K+ KK+I+NNKYILFNSWYTK
Sbjct: 36  IQLLEKKKIKYRITMMPVYGDNGLEFTVAIILLHDKRTAKKTKKMISNNKYILFNSWYTK 95

Query: 405 IKQPEWPSSPAMWDLVKNTPELADFVFIFDHTEKMVKKWPTD 530
            KQ  WP+S  MW+++K+   +  FV IFD  EK+ K    D
Sbjct: 96  NKQSVWPNSHMMWNIMKSHSNIKPFVLIFDFMEKLGKSIEVD 137



 Score = 33.5 bits (73), Expect = 5.4
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +2

Query: 605 ANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           A  +++  S   R +LY+EFY ++NETF +   P  S +Y+
Sbjct: 161 AESSKIDASNAKRAELYNEFYRVMNETFADGSTPNQSFLYE 201


>UniRef50_Q9J817 Cluster: ORF120 39K / pp31; n=3;
           Nucleopolyhedrovirus|Rep: ORF120 39K / pp31 - Spodoptera
           exigua MNPV
          Length = 317

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 47/103 (45%), Positives = 60/103 (58%), Gaps = 13/103 (12%)
 Frame = +3

Query: 258 AIVNFLEKKNINYILNVMP-------------VMQDERKMSKRKKKVINNNKYILFNSWY 398
           A++N LEKK I Y +  MP             V+  ++K +KR KK I+NNKYILFNSWY
Sbjct: 35  AVINTLEKKKIKYKIIPMPMCGEDGLEITFAIVIMVDKKNAKRNKKSISNNKYILFNSWY 94

Query: 399 TKIKQPEWPSSPAMWDLVKNTPELADFVFIFDHTEKMVKKWPT 527
           TK + P WP+S  MW+L+K       FV IFD  EK+ K   T
Sbjct: 95  TKNRNPSWPNSHTMWNLIKTQFLAKPFVDIFDFMEKIGKSITT 137



 Score = 38.7 bits (86), Expect = 0.14
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +2

Query: 599 TNANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           T+AN+ +++     R KLY EFY +   TF +NVAP  S IYD
Sbjct: 149 TDANVDDVENH---RYKLYDEFYKITTHTFIHNVAPTSSFIYD 188


>UniRef50_Q8QL84 Cluster: 39k/pp31; n=2; Nucleopolyhedrovirus|Rep:
           39k/pp31 - Mamestra configurata NPV-A
          Length = 287

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 41/99 (41%), Positives = 62/99 (62%), Gaps = 13/99 (13%)
 Frame = +3

Query: 258 AIVNFLEKKNINYILNVMPV-------------MQDERKMSKRKKKVINNNKYILFNSWY 398
           A++++LE+K I + L  MPV               +++K +++ KK+I+ NKYILFNSWY
Sbjct: 30  AVISYLERKKIKHNLFSMPVKDNDTVQMVHGIIFNNDKKNARKNKKMISYNKYILFNSWY 89

Query: 399 TKIKQPEWPSSPAMWDLVKNTPELADFVFIFDHTEKMVK 515
           TK +Q  WP+S  MW+++K+ P    FV IFD  EK+ K
Sbjct: 90  TKNRQETWPNSHTMWNIMKSQPVAKPFVDIFDFMEKLGK 128



 Score = 37.1 bits (82), Expect = 0.44
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 617 ELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           +++E  E R K+Y+EFY + + TF  + AP  S IYD
Sbjct: 153 DVEEGNEKRSKIYNEFYRITSITFETHSAPSSSFIYD 189


>UniRef50_O55584 Cluster: 39K; n=2; Leucania separata nuclear
           polyhedrosis virus|Rep: 39K - Leucania separata nuclear
           polyhedrosis virus (LsNPV)
          Length = 324

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 35/81 (43%), Positives = 57/81 (70%)
 Frame = +3

Query: 276 EKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVK 455
           EK  I Y  ++ P+ QD++K +K+ KK+ ++NKYILFN++ +KIKQP WP+S ++W+  K
Sbjct: 33  EKSKIPYHASINPMPQDDKKTNKKPKKITSSNKYILFNTFVSKIKQPGWPNSYSLWNSTK 92

Query: 456 NTPELADFVFIFDHTEKMVKK 518
             P  A F+ IF++ E + K+
Sbjct: 93  ADPTNATFLKIFNYIETITKQ 113


>UniRef50_Q9IK80 Cluster: 39k protein; n=1; Spodoptera litura
           NPV|Rep: 39k protein - Spodoptera litura multicapsid
           nucleopolyhedrovirus (SpltMNPV)
          Length = 322

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 38/103 (36%), Positives = 60/103 (58%)
 Frame = +3

Query: 276 EKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVK 455
           EK  + Y + V  +  DE+K  ++ KK+I++NKYILFN++ +KIKQP WPSS  +W+  K
Sbjct: 62  EKMKVPYYIGVTALPCDEKKTHRKPKKIISSNKYILFNTFVSKIKQPGWPSSYRLWNDTK 121

Query: 456 NTPELADFVFIFDHTEKMVKKWPTDRHRRLQATTQQFQRAKKD 584
           +      F+ +F+H E ++KK    +        QQ Q  K +
Sbjct: 122 SDSRNDKFLQMFNHVEDLIKKIVITKSVNGDGEPQQNQSKKNN 164



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 14/50 (28%), Positives = 27/50 (54%)
 Frame = +2

Query: 578 KRQTAVLTNANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           K+    +T+  + +++ES   R++ Y+EF  +L   +    AP  S +YD
Sbjct: 161 KKNNGAITSLLVDDVEESNRKRNEYYNEFIGVLKHVYEKGRAPSNSLVYD 210


>UniRef50_Q9YMT0 Cluster: Ld-39K/pp31; n=1; Lymantria dispar
           MNPV|Rep: Ld-39K/pp31 - Lymantria dispar multicapsid
           nuclear polyhedrosis virus (LdMNPV)
          Length = 264

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 35/86 (40%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query: 264 VNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWY--TKIKQPEWPSSPA 437
           +   EKK I+Y + V  V   ++K  KR KK  +NNKYILFNSWY   K ++    SS  
Sbjct: 35  IRLFEKKKISYRIKVSEVYGPDKKTVKRGKKNNHNNKYILFNSWYNSNKERRDNALSSHD 94

Query: 438 MWDLVKNTPELADFVFIFDHTEKMVK 515
           MW+ +K+    A  + +FD+ EK+ K
Sbjct: 95  MWNHIKSHSSAALVIGLFDYMEKLGK 120



 Score = 41.1 bits (92), Expect = 0.027
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = +2

Query: 566 PASKKRQTAVLTNANLAELKESCEMRDKLYSEFYSLLNETFNNNVAPLLSSIYD 727
           P  KKR  +     +  + K + + R  LY EFY +L   F +  AP  SSIYD
Sbjct: 128 PTPKKRGGSPCVEVDAEQAKRTNDKRSGLYDEFYRVLTVAFKSGSAPAASSIYD 181


>UniRef50_Q91GM8 Cluster: Late expression factor 11; n=5;
           Nucleopolyhedrovirus|Rep: Late expression factor 11 -
           Epiphyas postvittana nucleopolyhedrovirus (EppoMNPV)
          Length = 126

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 27/47 (57%), Positives = 30/47 (63%)
 Frame = +2

Query: 2   FTVITDKCSKRKVCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW 142
           FTVIT KCSKRKVC H KRIAR L ++K    EY   V+ VY    W
Sbjct: 80  FTVITGKCSKRKVCHHDKRIARTLHLEKNLVDEYACSVTHVYSAPKW 126


>UniRef50_Q7TLW3 Cluster: Late expression factor 11; n=1;
           Choristoneura fumiferana MNPV|Rep: Late expression
           factor 11 - Choristoneura fumiferana nuclear
           polyhedrosis virus (CfMNPV)
          Length = 107

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 25/47 (53%), Positives = 30/47 (63%)
 Frame = +2

Query: 2   FTVITDKCSKRKVCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW 142
           FTVIT KCSKRKVC HH+RI R L +      EY   V+ VY++  W
Sbjct: 61  FTVITGKCSKRKVCNHHRRIKRTLELNLNLVNEYACSVTDVYRSPKW 107


>UniRef50_Q9LKV1 Cluster: F21B23.8 protein; n=3; Arabidopsis
           thaliana|Rep: F21B23.8 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 576

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +3

Query: 306 VMPVMQDERKMSKRKKKVINNNKYI-LFNSWYTKIKQPEWPSSPAMWDLV--KNTPELAD 476
           + P   DE +   RK K+++ NK + L+ S Y    + EW     + D+V      ELAD
Sbjct: 336 IFPKQSDEERGVARKHKLVDKNKILELYRSEYND--ELEWMKDEKLRDIVFCVRDNELAD 393

Query: 477 FVFIFDHTEKMVKKW 521
            V ++D  EK++ +W
Sbjct: 394 GVSVYDPLEKIIPRW 408


>UniRef50_Q9PYY8 Cluster: ORF55; n=2; Granulovirus|Rep: ORF55 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 295

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 2/48 (4%)
 Frame = +3

Query: 330 RKMSKRKKKVI--NNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPE 467
           +K S +KKK +  +NNKYILF    +++K  EW SS  MW L+   P+
Sbjct: 79  KKSSLKKKKPLLYSNNKYILFTQLISRLKL-EWKSSNKMWSLMGVNPD 125


>UniRef50_Q9DVY7 Cluster: PxORF45 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF45 peptide - Plutella xylostella
           granulovirus
          Length = 252

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 252 AIAIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSS 431
           ++A+ N L+KK  +  + +  V   +  + K+   + +NN YILF   ++K+K   W +S
Sbjct: 36  SVALNNLLKKKMFDIKMKLEMVPIKKSNLKKKLPSLYSNNTYILFTQLFSKLKL-TWKAS 94

Query: 432 PAMW 443
             MW
Sbjct: 95  NKMW 98


>UniRef50_Q6KIG7 Cluster: Ribonuclease; n=1; Mycoplasma mobile|Rep:
           Ribonuclease - Mycoplasma mobile
          Length = 227

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 15/42 (35%), Positives = 27/42 (64%)
 Frame = +3

Query: 264 VNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFN 389
           +NFLE+K+ N    ++    DE+ + K  +K++NN K++L N
Sbjct: 98  INFLEQKHQNIDYVIIDAFSDEKNIDKYIEKLVNNKKFMLQN 139


>UniRef50_Q7REA2 Cluster: Putative uncharacterized protein PY05163;
           n=1; Plasmodium yoelii yoelii|Rep: Putative
           uncharacterized protein PY05163 - Plasmodium yoelii
           yoelii
          Length = 301

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 5/44 (11%)
 Frame = +3

Query: 282 KNINYILNVMPVMQ-DERKMSKRKKKVINNN----KYILFNSWY 398
           KN+N+  N + ++  D+ K S + KK  NNN     YILFN +Y
Sbjct: 14  KNVNFFKNALALLNVDDNKNSMKSKKSTNNNVELDNYILFNLFY 57


>UniRef50_Q41556 Cluster: Transcription factor HBP-1a; n=4; BEP
           clade|Rep: Transcription factor HBP-1a - Triticum
           aestivum (Wheat)
          Length = 381

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 24/71 (33%), Positives = 35/71 (49%)
 Frame = +3

Query: 243 HGPAIAIVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEW 422
           HG A+A        N   I+   PV+QDER++ K+K+K   +N+     S     KQ EW
Sbjct: 272 HGKAVAAPTSAPSSNSRDIVLSDPVIQDEREVKKQKRK--QSNRESARRSRLR--KQAEW 327

Query: 423 PSSPAMWDLVK 455
               +  DL+K
Sbjct: 328 EEVASRADLLK 338


>UniRef50_A2DYN8 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 391

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 82  KNISSRIQAGRFKGLQK-SNMVNMPEQQSSTETAAVCKNEKLLNKLESS--SYNKSNMDQ 252
           +NIS+     R+K L K     N+P ++   ET  + KN KLL K ES+   Y+K+ M++
Sbjct: 255 RNISN--SENRYKVLSKLPKNNNLPNEEIEMETDQLIKNLKLLQKRESNRIKYSKAEMEE 312

Query: 253 L 255
           L
Sbjct: 313 L 313


>UniRef50_A0E7M0 Cluster: Chromosome undetermined scaffold_81, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_81,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1600

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +3

Query: 351 KKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELADFVF 485
           KK+INN KY LFN  Y  +K+ ++P + A+   +    +L  F F
Sbjct: 9   KKLINNTKYKLFNVVYLILKRQQYPLNVAIISTIIQMAQLLYFSF 53


>UniRef50_Q8II59 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 985

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 7/54 (12%)
 Frame = +3

Query: 225 LLQQIQHGPAIAIVNFLEKK------NINYILNVMPVMQDERKMSKR-KKKVIN 365
           L++ + H   I I+N   K+      N+NYI N++P++  E K+SKR  KK++N
Sbjct: 55  LMKNVIHNDIIKILNKNSKEFMSLPANLNYIENMIPILDKEIKISKRFVKKLLN 108


>UniRef50_Q8I5B0 Cluster: Putative uncharacterized protein; n=2;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium falciparum (isolate 3D7)
          Length = 988

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/43 (41%), Positives = 30/43 (69%), Gaps = 4/43 (9%)
 Frame = +3

Query: 273 LEKKNINYIL---NVMPVMQDERKMSKRKKKV-INNNKYILFN 389
           +E KN+N ++   N+  V+ +E+K  KRK+K+ I+ NK+IL N
Sbjct: 375 VEAKNMNNLVIEQNIEKVIVEEKKKRKRKEKINIDENKHILIN 417


>UniRef50_UPI0001509CE2 Cluster: Calpain family cysteine protease
            containing protein; n=1; Tetrahymena thermophila
            SB210|Rep: Calpain family cysteine protease containing
            protein - Tetrahymena thermophila SB210
          Length = 1315

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +3

Query: 285  NINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKN-T 461
            +INY++ +  + Q+E++  KR+    N+   I+ N W     Q +W  +P   D V+   
Sbjct: 993  SINYLMQLDYINQEEKENHKRENPHQNHRILIVRNPWGYGEWQLKWSENPDYIDKVQQYM 1052

Query: 462  PELADFVFIFDHTEKMVKK 518
            P++  F   FD  E   KK
Sbjct: 1053 PKINKF---FDDQETRCKK 1068


>UniRef50_Q8KUD0 Cluster: EF0012; n=1; Enterococcus faecalis|Rep:
           EF0012 - Enterococcus faecalis (Streptococcus faecalis)
          Length = 653

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 6/57 (10%)
 Frame = +3

Query: 270 FLEKKNINYILNVMPVMQDE----RKMSKRKKKVINNNKYILFNSWYTKIKQP--EW 422
           ++E K I Y++N  P + +     +  SK +KK +N    +   + YTKI  P  EW
Sbjct: 468 YMESKRIQYLVNFPPFLPNRIWKNQNPSKGRKKTLNKYTALKVGNLYTKINNPVAEW 524


>UniRef50_Q4Y1A1 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 69

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 4/53 (7%)
 Frame = +3

Query: 264 VNFLEKKNINYILNVMPVMQDE--RKMSKRKKKVINN-NKYILF-NSWYTKIK 410
           + F   K INY+LN   +   +  ++M ++K+K+ NN N YI F  + Y K+K
Sbjct: 7   IPFFILKQINYLLNFSNITTKKVCKQMFEKKRKIFNNTNSYIFFIYNLYKKVK 59


>UniRef50_A6Q7W3 Cluster: Glutathionylspermidine synthase; n=27;
           Epsilonproteobacteria|Rep: Glutathionylspermidine
           synthase - Sulfurovum sp. (strain NBC37-1)
          Length = 392

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 21/65 (32%), Positives = 31/65 (47%)
 Frame = +3

Query: 324 DERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELADFVFIFDHTE 503
           +E  ++     +I   K I+FN  YT + Q +      +WDL  N P L +  F   H +
Sbjct: 246 EESDLAMLLTNIIKKQKAIIFNPAYTLMFQSKGMLK-ILWDLYPNHPFLLETSFDPLHGK 304

Query: 504 KMVKK 518
           K VKK
Sbjct: 305 KQVKK 309


>UniRef50_Q24GN9 Cluster: Cyclic nucleotide-binding domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: Cyclic
            nucleotide-binding domain containing protein -
            Tetrahymena thermophila SB210
          Length = 1504

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query: 270  FLEKKNINYILNVMPVMQ-DERKMSKRKKKVINNNKYILFNSWYT 401
            F    NI  +LN + +MQ ++RKM K+K+      + ILF+ +YT
Sbjct: 1411 FFPHNNIESVLNKLKIMQLEQRKMKKQKQINKPRRQNILFSRFYT 1455


>UniRef50_Q248B2 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1951

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = -2

Query: 506 LFSVIKNEHKICQFG-RVFHQIPHGRATRPLGLLDLSVPTVKQNVFIVVNHLLLAFGHFA 330
           +F +I NEH+  +   RV HQ  +G+         LS   +KQN+  + ++  +A  ++ 
Sbjct: 172 IFYLIYNEHQTVESHLRVLHQNSNGQTQNQNETNSLSTYRIKQNITFLFDN--IASVYYQ 229

Query: 329 FVLHDRHYVEDIVNVLFFQEIYN 261
            VL    +V  I +V  F EIYN
Sbjct: 230 LVL----FVFYIPSVQIFSEIYN 248


>UniRef50_UPI0000499666 Cluster: protein kinase; n=2; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 863

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 4/72 (5%)
 Frame = +3

Query: 219 IELLQQIQHGPAIAIVNFLEKKN--INYILNVMPVMQDERKMSKRKKKVINNNKYIL--F 386
           IEL+    +G   + V   +KK   I  ++    V  +E K   R    INNNKYI+  +
Sbjct: 15  IELIGSGSYGKVYSAVRNDDKKKYAIKVLITTGEVRMEEVKNEIRSLACINNNKYIVRYY 74

Query: 387 NSWYTKIKQPEW 422
           ++W  ++ + ++
Sbjct: 75  DTWIERLSEEDY 86


>UniRef50_Q2S0A6 Cluster: TrkH potassium uptake protein; n=1;
           Salinibacter ruber DSM 13855|Rep: TrkH potassium uptake
           protein - Salinibacter ruber (strain DSM 13855)
          Length = 499

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = -2

Query: 464 GRVFHQIPHGRATRP--LGLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYV 303
           GR   Q+ H  + RP  LG   +  P V+  + +++ +LLL  G   F+  D H V
Sbjct: 375 GRELFQMIHPSSVRPMWLGRRTVKEPVVRGILIVILTYLLLVVGGTGFIAVDAHRV 430


>UniRef50_Q9JPC7 Cluster: Hypothetical membrane protein; n=1;
           Rubrivivax gelatinosus|Rep: Hypothetical membrane
           protein - Rhodocyclus gelatinosus (Rhodopseudomonas
           gelatinosa)
          Length = 408

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = -2

Query: 461 RVFHQIPH-GRATRPLGLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNV 285
           R++H +P  GR   PL +L         +V ++V +LLL  G  A+VLH R   E+ V  
Sbjct: 121 RIWHMLPVVGRFNWPLSML-------AWDVVVLVGYLLLNLGLPAYVLHARWRGEEPVTA 173

Query: 284 LFFQEIYNSNSWSM 243
            +F  +  +  W++
Sbjct: 174 RYFPVVIVAIFWAV 187


>UniRef50_A0DL70 Cluster: Chromosome undetermined scaffold_55, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_55,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 800

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 2/90 (2%)
 Frame = +3

Query: 300 LNVMPVMQD-ERKMSKRKKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELAD 476
           LN+ P   D   K  ++K+K++   +       Y KI  P   + P   DL+K+ P+L  
Sbjct: 617 LNLKPKELDISAKKQQKKQKMLEEQEKQRVPVDYRKITYPFRKNHPKHLDLIKSQPKLD- 675

Query: 477 FVFIFDHTEKMVKK-WPTDRHRRLQATTQQ 563
            V I+D  + ++ K +  ++ R LQA   Q
Sbjct: 676 -VSIYDEEKTILDKLFQKEKERYLQAQRAQ 704


>UniRef50_A0CPI6 Cluster: Chromosome undetermined scaffold_23, whole
            genome shotgun sequence; n=6; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_23, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 3787

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 8/118 (6%)
 Frame = +3

Query: 93   IKNTSGSFQRFTK---IKHGKHAGATIFYRNCGRVQK*KVVE*TGIELLQQIQHGPAIAI 263
            I  ++G   +FT+   +       A  + +N  R Q  K+++ T   L++QI++     +
Sbjct: 2721 ISKSNGIISKFTRSYPLFIDPQLQANTWIKNTYRDQNLKIIKSTQEGLVKQIENAIQTGV 2780

Query: 264  VNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWY-----TKIKQPEW 422
               LE       +++ PV+  +   S RKK +   +K I F+S +     TK+  P++
Sbjct: 2781 PLLLEDAQEQLDISLDPVLLRQANPSNRKKNIKIGDKEIEFDSNFKLFICTKLSNPQF 2838


>UniRef50_Q7N2H1 Cluster: Succinylglutamate desuccinylase; n=1;
           Photorhabdus luminescens subsp. laumondii|Rep:
           Succinylglutamate desuccinylase - Photorhabdus
           luminescens subsp. laumondii
          Length = 325

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -2

Query: 440 HGRATRPLGLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLF 279
           HG  T P+ +L   +  + +    + N++L+ FG+   +  +R Y+ D +N +F
Sbjct: 51  HGNETAPIEILIQLLAQLAEGTLALKNNVLIIFGNLPAMRTNRRYLHDDLNRMF 104


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 728,164,244
Number of Sequences: 1657284
Number of extensions: 15236895
Number of successful extensions: 46531
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 43910
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46489
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 58853922985
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -