SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P10768 Cluster: S-formylglutathione hydrolase; n=136; c...   120   5e-26
UniRef50_Q17MG9 Cluster: S-formylglutathione hydrolase, putative...   116   7e-25
UniRef50_P44556 Cluster: Uncharacterized protein HI0184; n=70; B...   110   4e-23
UniRef50_Q8YTB5 Cluster: S-formylglutathione hydrolase; n=42; ce...   109   7e-23
UniRef50_Q4T3M9 Cluster: Chromosome undetermined SCAF9983, whole...   106   7e-22
UniRef50_A0TB97 Cluster: Esterase-like; n=1; Burkholderia ambifa...   103   5e-21
UniRef50_Q223C0 Cluster: Carboxylesterase; n=5; Bacteria|Rep: Ca...   100   3e-20
UniRef50_A1W9L7 Cluster: Carboxylesterase; n=40; cellular organi...    99   6e-20
UniRef50_A4QSP1 Cluster: Putative uncharacterized protein; n=1; ...    98   2e-19
UniRef50_Q8LAS8 Cluster: S-formylglutathione hydrolase; n=24; ce...    98   2e-19
UniRef50_Q987D2 Cluster: Esterase; n=48; cellular organisms|Rep:...    94   4e-18
UniRef50_Q5QXA5 Cluster: Predicted esterase; n=5; Bacteria|Rep: ...    90   6e-17
UniRef50_A6WV68 Cluster: S-formylglutathione hydrolase; n=1; Och...    89   1e-16
UniRef50_A5P8Q8 Cluster: Esterase D; n=6; Bacteria|Rep: Esterase...    89   1e-16
UniRef50_Q54RL8 Cluster: Putative uncharacterized protein; n=1; ...    81   2e-14
UniRef50_A2WYX1 Cluster: Putative uncharacterized protein; n=2; ...    80   7e-14
UniRef50_Q0FE48 Cluster: S-formylglutathione hydrolase, putative...    77   4e-13
UniRef50_Q5K7P6 Cluster: Carboxylesterase, putative; n=1; Filoba...    75   1e-12
UniRef50_P40363 Cluster: S-formylglutathione hydrolase; n=7; Sac...    75   1e-12
UniRef50_A5WCZ7 Cluster: S-formylglutathione hydrolase; n=3; Psy...    69   1e-10
UniRef50_A4S7A8 Cluster: Predicted protein; n=13; cellular organ...    66   7e-10
UniRef50_Q6LH00 Cluster: Putative uncharacterized protein SMU.11...    55   2e-06
UniRef50_UPI0000660A78 Cluster: S-formylglutathione hydrolase (E...    46   0.001
UniRef50_A7HJ67 Cluster: Putative esterase; n=2; Thermotogaceae|...    36   0.84 
UniRef50_A0E374 Cluster: Chromosome undetermined scaffold_76, wh...    36   0.84 
UniRef50_Q6G430 Cluster: Putative uncharacterized protein; n=2; ...    34   4.5  
UniRef50_Q4XN50 Cluster: Putative uncharacterized protein; n=2; ...    34   4.5  
UniRef50_Q7UMH7 Cluster: Probable endo-1,4-beta-xylanase 1; n=2;...    33   5.9  
UniRef50_A3QDI5 Cluster: Putative esterase precursor; n=2; Shewa...    33   5.9  
UniRef50_Q4N6I3 Cluster: Putative uncharacterized protein; n=1; ...    33   5.9  

>UniRef50_P10768 Cluster: S-formylglutathione hydrolase; n=136;
           cellular organisms|Rep: S-formylglutathione hydrolase -
           Homo sapiens (Human)
          Length = 282

 Score =  120 bits (288), Expect = 5e-26
 Identities = 54/104 (51%), Positives = 69/104 (66%)
 Frame = +1

Query: 178 EFFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGV 357
           +F    PP    G C     +  +  TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG 
Sbjct: 31  KFAVYLPPKAETGKCPALYWLSGL--TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGC 88

Query: 358 KIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
            I G+D SWDFG  AGFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 89  NIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLI 132



 Score =  108 bits (260), Expect = 1e-22
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 138 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 197

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 198 KWKAYDATHLVKSYPGSQLDILIDQ 222



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 33/54 (61%), Positives = 40/54 (74%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  SSNK FGG QKV+ H S EL CKM F++YLPP+AE G  K P LY+LSG
Sbjct: 2   ALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG--KCPALYWLSG 53


>UniRef50_Q17MG9 Cluster: S-formylglutathione hydrolase, putative;
           n=11; cellular organisms|Rep: S-formylglutathione
           hydrolase, putative - Aedes aegypti (Yellowfever
           mosquito)
          Length = 283

 Score =  116 bits (279), Expect = 7e-25
 Identities = 50/82 (60%), Positives = 63/82 (76%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+E NFI K+G QRYA+E G+IVV PDTSPRGV + G+D SWDFG  AGFY+DAT +PW
Sbjct: 56  TCNETNFIQKAGAQRYASEQGLIVVCPDTSPRGVNLPGEDDSWDFGSGAGFYVDATKDPW 115

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
           + +Y+M SY+  EL D+I   F
Sbjct: 116 SKHYKMFSYVTQELIDVINNNF 137



 Score =  104 bits (250), Expect = 2e-21
 Identities = 45/69 (65%), Positives = 53/69 (76%), Gaps = 1/69 (1%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGED-KSKWAEWDATELVKKYNG 737
           AL+  L+NPG YKSVSAFA I NP+ CPWG+KAF GY GED K +W  WDA+ELV  YNG
Sbjct: 156 ALICALKNPGLYKSVSAFAPISNPTKCPWGLKAFGGYFGEDSKDEWKNWDASELVADYNG 215

Query: 738 PPLTLLLDR 764
           PPL L +D+
Sbjct: 216 PPLELYVDQ 224



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 35/64 (54%), Positives = 45/64 (70%)
 Frame = +2

Query: 86  MDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSGQLVV 265
           M  + L SSNK FGG QK+YSH S EL C+M F+I+LP  A  G  KLP++Y+LSG L  
Sbjct: 1   MTVITLISSNKCFGGLQKIYSHKSKELDCEMKFAIFLPAAASDG--KLPVVYWLSG-LTC 57

Query: 266 NKTS 277
           N+T+
Sbjct: 58  NETN 61


>UniRef50_P44556 Cluster: Uncharacterized protein HI0184; n=70;
           Bacteria|Rep: Uncharacterized protein HI0184 -
           Haemophilus influenzae
          Length = 275

 Score =  110 bits (264), Expect = 4e-23
 Identities = 51/78 (65%), Positives = 62/78 (79%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+EQNFITKSGFQRYAAEH VIVV PDTSPRG ++  +D+++D G  AGFYL+AT +PW
Sbjct: 53  TCTEQNFITKSGFQRYAAEHQVIVVAPDTSPRGEQVP-NDAAYDLGQGAGFYLNATEQPW 111

Query: 436 NNNYRMGSYLNVELYDLI 489
             NY+M  Y+  EL DLI
Sbjct: 112 ATNYQMYDYILNELPDLI 129



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 32/56 (57%), Positives = 43/56 (76%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKK 728
           ALV  LRN  +Y+SVSAF+ I +PS  PWG KAFS YLGED+ KW ++DA+ L+++
Sbjct: 151 ALVLALRNRERYQSVSAFSPILSPSLVPWGEKAFSAYLGEDREKWQQYDASSLIQQ 206



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 21/53 (39%), Positives = 37/53 (69%)
 Frame = +2

Query: 95  LQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           ++L   ++IFGG Q+V++H +  L+C+M F++YLP   E  +  L ++Y+LSG
Sbjct: 1   MKLIEQHQIFGGSQQVWAHNAQTLQCEMKFAVYLPNNPE--NRPLGVIYWLSG 51


>UniRef50_Q8YTB5 Cluster: S-formylglutathione hydrolase; n=42;
           cellular organisms|Rep: S-formylglutathione hydrolase -
           Anabaena sp. (strain PCC 7120)
          Length = 282

 Score =  109 bits (262), Expect = 7e-23
 Identities = 47/82 (57%), Positives = 61/82 (74%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+E+NF+ K+G QRYAAE+G+I+V PDTSPR   I G+D  WDFG  AGFY+DAT +PW
Sbjct: 56  TCTEENFMAKAGAQRYAAEYGLILVAPDTSPRNTGIAGEDDEWDFGTGAGFYVDATEKPW 115

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
            ++Y+M SY+  EL  LI   F
Sbjct: 116 RSHYQMYSYIVQELPALIAANF 137



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 37/68 (54%), Positives = 47/68 (69%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           ALV  LRNP  +KSVSAFA I  P  CPWG KAFS YLG +++ W  +DA+ELVK+  G 
Sbjct: 156 ALVCALRNPHIFKSVSAFAPIVTPMGCPWGQKAFSRYLGNNQASWLAYDASELVKQL-GY 214

Query: 741 PLTLLLDR 764
              +L+D+
Sbjct: 215 HSQILIDQ 222



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 26/56 (46%), Positives = 36/56 (64%)
 Frame = +2

Query: 86  MDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           M++L+L S  + FGG    YSH SS    +M F++Y PPQA   +  LP+LY+LSG
Sbjct: 1   MNNLKLISEYQSFGGKLGFYSHPSSTCNGEMRFAVYQPPQA--AEKPLPVLYFLSG 54


>UniRef50_Q4T3M9 Cluster: Chromosome undetermined SCAF9983, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF9983,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 288

 Score =  106 bits (254), Expect = 7e-22
 Identities = 46/84 (54%), Positives = 57/84 (67%)
 Frame = +3

Query: 513 DPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSK 692
           DP+R            ALV  L+NPG+YK+VSAFA ICNP+ CPWG KAFS YLG D+S 
Sbjct: 145 DPSRVSISGHSMGGHGALVCALKNPGKYKAVSAFAPICNPTQCPWGQKAFSSYLGNDRSA 204

Query: 693 WAEWDATELVKKYNGPPLTLLLDR 764
           W  +DAT L   Y+GPPL +L+D+
Sbjct: 205 WEAYDATALAAAYSGPPLDVLIDQ 228



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 23/39 (58%), Positives = 31/39 (79%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQA 208
           +L+L SSNK  GG+QKV+ H SSELKCKM F+++L  +A
Sbjct: 7   TLKLVSSNKCAGGFQKVFEHDSSELKCKMKFAVFLASEA 45


>UniRef50_A0TB97 Cluster: Esterase-like; n=1; Burkholderia ambifaria
           MC40-6|Rep: Esterase-like - Burkholderia ambifaria
           MC40-6
          Length = 153

 Score =  103 bits (247), Expect = 5e-21
 Identities = 42/74 (56%), Positives = 55/74 (74%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+E+ F  K G Q+YAA+HG+ +V PDTSPRG  + G+  +WDFGV AGFY+DAT  PW
Sbjct: 37  TCTEETFAIKGGAQQYAAQHGLALVMPDTSPRGANVPGEADAWDFGVGAGFYVDATQAPW 96

Query: 436 NNNYRMGSYLNVEL 477
           + +YRM SY+  EL
Sbjct: 97  STHYRMESYVTGEL 110


>UniRef50_Q223C0 Cluster: Carboxylesterase; n=5; Bacteria|Rep:
           Carboxylesterase - Rhodoferax ferrireducens (strain DSM
           15236 / ATCC BAA-621 / T118)
          Length = 288

 Score =  100 bits (240), Expect = 3e-20
 Identities = 44/81 (54%), Positives = 57/81 (70%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+E+ F+ K+G QR AAE G+ ++ PDTSPRG  + G+  SWDFGV AGFYLDAT  PW
Sbjct: 56  TCTEETFMAKAGAQRVAAELGLALIAPDTSPRGAGVPGEAESWDFGVGAGFYLDATQAPW 115

Query: 436 NNNYRMGSYLNVELYDLILKA 498
           + +YRM + L  EL  L+  A
Sbjct: 116 SRHYRMETCLISELLPLLAPA 136



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 40/89 (44%), Positives = 53/89 (59%), Gaps = 2/89 (2%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VD  R            AL   LR+PG +KSVSAFA IC P+ CPWG KAF+ YLG D +
Sbjct: 139 VDAQRLGISGHSMGGHGALTLALRHPGLFKSVSAFAPICAPTQCPWGHKAFAAYLGADTT 198

Query: 690 KWAEWDATELVKKYN-GP-PLTLLLDREL 770
           +WA  DA+ L+ + +  P P  +L+D+ L
Sbjct: 199 QWAAHDASALMSECSTAPYPAGILIDQGL 227



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/63 (41%), Positives = 36/63 (57%)
 Frame = +2

Query: 86  MDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSGQLVV 265
           M +L+L S +  FGG Q+ Y H S+ +   M FS+YLPPQA    V  P + YL+G    
Sbjct: 1   MAALELLSEHACFGGVQRFYRHVSTVIGLPMRFSVYLPPQARSQTV--PAVMYLAGLTCT 58

Query: 266 NKT 274
            +T
Sbjct: 59  EET 61


>UniRef50_A1W9L7 Cluster: Carboxylesterase; n=40; cellular
           organisms|Rep: Carboxylesterase - Acidovorax sp. (strain
           JS42)
          Length = 294

 Score =   99 bits (238), Expect = 6e-20
 Identities = 44/81 (54%), Positives = 57/81 (70%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+E+ F  K+G QR AAE G+ ++ PDTSPRG  + G+  +WDFGV AGFYLDAT  PW
Sbjct: 62  TCTEETFPIKAGAQRLAAELGLALITPDTSPRGAGVAGEADAWDFGVGAGFYLDATQAPW 121

Query: 436 NNNYRMGSYLNVELYDLILKA 498
           + ++RM SYL  EL  L+  A
Sbjct: 122 STHWRMESYLLEELLPLVTNA 142



 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 2/72 (2%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL   LR+PG++KS+SAFA IC P+ CPWG KAF+GYLG D+S W + DAT L++     
Sbjct: 162 ALTLALRHPGRFKSLSAFAPICAPTRCPWGEKAFTGYLGPDRSSWGQHDATVLMENQPLA 221

Query: 741 PLT--LLLDREL 770
           P    +L+D+ L
Sbjct: 222 PYPGGILIDQGL 233



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 3/65 (4%)
 Frame = +2

Query: 89  DSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQ---AEGGDVKLPLLYYLSGQL 259
           D+L+  S++  FGG Q+ Y HAS  +   M F++YLPP+   AE  D K+P L YL+G  
Sbjct: 3   DTLEQLSAHACFGGEQRFYRHASHAVGLPMRFAVYLPPRALAAESADRKVPALLYLAGLT 62

Query: 260 VVNKT 274
              +T
Sbjct: 63  CTEET 67


>UniRef50_A4QSP1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 256

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 41/84 (48%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TCS +N   K  FQ  A++HG+ V  PDTSPRG+ + G+D SWDFG +A FY+DA  +PW
Sbjct: 55  TCSPENCTEKGFFQHGASKHGIAVAYPDTSPRGLGLPGEDESWDFGSAASFYVDAKQDPW 114

Query: 436 NNNYRMGSYLNVELYDLILKAFCN 507
             NYRM +Y+  EL  L+ + F +
Sbjct: 115 KGNYRMETYITEELPRLLYEGFAD 138



 Score = 40.7 bits (91), Expect = 0.039
 Identities = 22/44 (50%), Positives = 27/44 (61%)
 Frame = +2

Query: 122 FGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           FGG     SH SS    +M  ++YLPPQA     K+PLL+YLSG
Sbjct: 12  FGGRLLKLSHQSSVTGTEMAVNLYLPPQA--NKQKVPLLFYLSG 53


>UniRef50_Q8LAS8 Cluster: S-formylglutathione hydrolase; n=24;
           cellular organisms|Rep: S-formylglutathione hydrolase -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 284

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 44/82 (53%), Positives = 60/82 (73%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+++NFI KSG QR A+ HG+ +V PDTSPRG+ ++G+  S+DFGV AGFYL+AT E W
Sbjct: 58  TCTDENFIIKSGAQRAASTHGIALVAPDTSPRGLNVEGEADSYDFGVGAGFYLNATQEKW 117

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
             N+RM  Y+  EL  L+ + F
Sbjct: 118 -KNWRMYDYVVKELPKLLSENF 138



 Score = 83.4 bits (197), Expect = 6e-15
 Identities = 38/68 (55%), Positives = 48/68 (70%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL   LRN  +YKSVSAFA I NP  C WG KAF+ YLG++K+ W E+DAT L+ KYN  
Sbjct: 158 ALTIYLRNLDKYKSVSAFAPITNPINCAWGQKAFTNYLGDNKAAWEEYDATCLISKYNNL 217

Query: 741 PLTLLLDR 764
             T+L+D+
Sbjct: 218 SATILIDQ 225



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/48 (54%), Positives = 29/48 (60%)
 Frame = +2

Query: 110 SNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           S K+F GY K Y H S  L C M FSIY PP A     K P+LY+LSG
Sbjct: 10  STKMFDGYNKRYKHFSETLGCSMTFSIYFPPSASSSH-KSPVLYWLSG 56


>UniRef50_Q987D2 Cluster: Esterase; n=48; cellular organisms|Rep:
           Esterase - Rhizobium loti (Mesorhizobium loti)
          Length = 290

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 49/107 (45%), Positives = 61/107 (57%)
 Frame = +1

Query: 181 FFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVK 360
           F    PP  R   C +   +  +  TC+  N + K  ++R AAE G+IVV PDTSPRG  
Sbjct: 34  FAVFVPPQAREKPCPVVWYLSGL--TCTHANVMDKGEYRRMAAELGLIVVCPDTSPRGGD 91

Query: 361 IDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLILKAF 501
           I  +  +W FG  AGFYLDAT  P+  NYRM SY+  EL  LI K F
Sbjct: 92  IPDEKDNWQFGSGAGFYLDATQAPYATNYRMYSYVTEELPALIAKVF 138



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVK 725
           AL   L+NP ++KS SAFA I  PS   W   A   YLG D++ W  +DAT L++
Sbjct: 157 ALTIALKNPERFKSCSAFAPIVQPSTAGWSRPALEKYLGADEASWRSYDATLLIE 211



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +2

Query: 89  DSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           D ++  SS +  GG Q VYSHAS    C M F++++PPQA   +   P+++YLSG
Sbjct: 3   DLMKTISSARSHGGVQGVYSHASDACACDMVFAVFVPPQAR--EKPCPVVWYLSG 55


>UniRef50_Q5QXA5 Cluster: Predicted esterase; n=5; Bacteria|Rep:
           Predicted esterase - Idiomarina loihiensis
          Length = 278

 Score = 89.8 bits (213), Expect = 6e-17
 Identities = 39/79 (49%), Positives = 56/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKI-DGDDSSWDFGVSAGFYLDATNEP 432
           TC+++NF TK+G QR A E G+ ++ PDTSPRG  + D  D ++D G+ AGFY++AT EP
Sbjct: 53  TCTDENFSTKAGAQRVATELGIALIVPDTSPRGDNVADDPDGAYDLGLGAGFYVNATQEP 112

Query: 433 WNNNYRMGSYLNVELYDLI 489
           W N+Y+M  Y+  EL  L+
Sbjct: 113 WKNHYQMYDYIVKELPKLV 131



 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 35/70 (50%), Positives = 49/70 (70%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           ALV  LRN  +Y S+SAF+ I NP+ CPWG KAFS YLG+D+ +W ++DA E++K   G 
Sbjct: 153 ALVIGLRNSDRYSSISAFSPITNPTQCPWGEKAFSAYLGDDREQWKQYDAVEIIKS-KGQ 211

Query: 741 PLTLLLDREL 770
            L + +D+ L
Sbjct: 212 TLPIRVDQGL 221



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 22/49 (44%), Positives = 30/49 (61%)
 Frame = +2

Query: 107 SSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           S  + FGG Q  + H S  L C M FS++LP +AE    K+P +Y+LSG
Sbjct: 5   SETRCFGGRQLRFEHDSEVLNCAMQFSVFLPLRAEKS--KVPAVYFLSG 51


>UniRef50_A6WV68 Cluster: S-formylglutathione hydrolase; n=1;
           Ochrobactrum anthropi ATCC 49188|Rep:
           S-formylglutathione hydrolase - Ochrobactrum anthropi
           (strain ATCC 49188 / DSM 6882 / NCTC 12168)
          Length = 293

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 39/82 (47%), Positives = 55/82 (67%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+ QN + K  +++ AAE G+ V+ PDTSPRG  I  +  +W FG  AGFY++AT EP+
Sbjct: 68  TCTHQNVMDKGEYRQMAAELGIAVICPDTSPRGDDIPDEPDNWQFGKGAGFYVNATQEPF 127

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
             NY+M SY+  EL DL+ + F
Sbjct: 128 AKNYQMYSYITKELTDLVGREF 149



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           S++  S+ K F G Q VY H S   +C M F+++LPPQA+ G V  P+L+YLSG
Sbjct: 15  SMKTISTAKCFDGTQGVYRHKSETNQCDMTFAVFLPPQAKDGPV--PVLWYLSG 66



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/55 (41%), Positives = 31/55 (56%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVK 725
           AL   L+NP ++KS SAFA I   S   W   A   YLG ++  W  +DAT L++
Sbjct: 168 ALTIALKNPDRFKSASAFAPIVQSSTADWSRPALEKYLGPEERAWRAYDATLLIE 222


>UniRef50_A5P8Q8 Cluster: Esterase D; n=6; Bacteria|Rep: Esterase D
           - Erythrobacter sp. SD-21
          Length = 279

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 40/78 (51%), Positives = 49/78 (62%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+  N   K  ++   A+HGVI V PDTSPRG  +   D  +DFG  AGFY+DAT EPW
Sbjct: 55  TCTHANVTEKGEYRAACADHGVIFVAPDTSPRGETVPDADDEYDFGKGAGFYVDATQEPW 114

Query: 436 NNNYRMGSYLNVELYDLI 489
             +YRM SY+  EL  LI
Sbjct: 115 AQHYRMRSYIEDELPALI 132



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/55 (54%), Positives = 38/55 (69%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVK 725
           AL   LRNP +++SVSAFA I  PS  PWG KA S YLGED+  W ++DA  L++
Sbjct: 155 ALTIALRNPERFRSVSAFAPIVAPSRVPWGEKALSHYLGEDREAWGQYDAVALIE 209



 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 27/54 (50%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L   S NK FGG Q V SH S     +M FS+Y+PP   G   KLP+L+YLSG
Sbjct: 2   TLDYLSQNKAFGGDQFVLSHQSEATGTEMTFSVYVPPHEAG--AKLPVLWYLSG 53


>UniRef50_Q54RL8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 285

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/93 (39%), Positives = 64/93 (68%), Gaps = 3/93 (3%)
 Frame = +1

Query: 232 TSILFVWS--TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDF-GVSA 402
           +S+L+  S  TC+++NFI KSG  +YA+++ + +V PDTSPRG+ I+  +  W   G  A
Sbjct: 45  SSVLWFLSGLTCTDENFIQKSGAIQYASQNNIFLVCPDTSPRGITIENAEDKWQGPGFGA 104

Query: 403 GFYLDATNEPWNNNYRMGSYLNVELYDLILKAF 501
           G+YL++T + +  +++M +Y+  EL++LI K F
Sbjct: 105 GYYLNSTTDKYKAHFQMFTYITKELFELINKEF 137



 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)
 Frame = +3

Query: 576 LRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLG-EDKSKWAEWDATELVKKYNGPPLTL 752
           ++  GQYKSVSAF+ I NP  C W + +F  YLG E+K  W ++D   L+K Y+G P  L
Sbjct: 163 IKTNGQYKSVSAFSPISNPVNCDWSLHSFKEYLGTENKEAWLQYDPCHLLKNYDGKPFDL 222

Query: 753 LLDR 764
           L+D+
Sbjct: 223 LVDQ 226



 Score = 41.1 bits (92), Expect = 0.030
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +2

Query: 86  MDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           M ++ L S +K F G  + YSH S+ L C M F +Y+P ++        +L++LSG
Sbjct: 1   MTNISLLSKSKSFNGEVRRYSHKSTSLSCDMKFHVYVPSKS---STPSSVLWFLSG 53


>UniRef50_A2WYX1 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 211

 Score = 79.8 bits (188), Expect = 7e-14
 Identities = 37/68 (54%), Positives = 46/68 (67%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL   L+N  +YKSVSAF+ + NP  CPWG KAFS YLG  KS W E+DAT L+KK N  
Sbjct: 37  ALTIYLKNTDKYKSVSAFSPVVNPINCPWGQKAFSNYLGPAKSDWEEYDATCLIKKCNKI 96

Query: 741 PLTLLLDR 764
              +L+D+
Sbjct: 97  STPILIDQ 104


>UniRef50_Q0FE48 Cluster: S-formylglutathione hydrolase, putative;
           n=11; Alphaproteobacteria|Rep: S-formylglutathione
           hydrolase, putative - alpha proteobacterium HTCC2255
          Length = 278

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 33/82 (40%), Positives = 53/82 (64%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+ +N + K+  Q +AAE+G+ ++ PDTSPRG  +   D  +D G  AGFY++AT + W
Sbjct: 53  TCTHENAMVKATAQGWAAENGIALIFPDTSPRGENVPNHD-DYDLGQGAGFYVNATTDKW 111

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
           + N++M  Y+ + L  LI + F
Sbjct: 112 SENFQMWDYITIALPKLIFENF 133



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/56 (51%), Positives = 36/56 (64%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKK 728
           AL   +  P QY+SVSAFA I NP+   WG K F  YLGED + W + DAT L++K
Sbjct: 152 ALTMAMTLPDQYQSVSAFAPIGNPTKSEWGQKQFKEYLGEDTTTWEKHDATILMQK 207



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/65 (41%), Positives = 40/65 (61%)
 Frame = +2

Query: 107 SSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSGQLVVNKTSSLN 286
           S N  FGG Q V+ H S   KC M F++YLPPQA+    K+P+L+YLSG    ++ + + 
Sbjct: 5   SENFCFGGTQGVFKHYSESCKCDMTFAVYLPPQAKMN--KVPVLWYLSGLTCTHENAMVK 62

Query: 287 LVSRG 301
             ++G
Sbjct: 63  ATAQG 67


>UniRef50_Q5K7P6 Cluster: Carboxylesterase, putative; n=1;
           Filobasidiella neoformans|Rep: Carboxylesterase,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 280

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 31/81 (38%), Positives = 47/81 (58%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+E     K GF   A + G+ +V PDTSPRG  ++G+D  W  G  AGFY++A  + W
Sbjct: 57  TCTEDTGAQKGGFFNTAGKEGIALVFPDTSPRGAGVEGEDDDWQLGTGAGFYINAETDKW 116

Query: 436 NNNYRMGSYLNVELYDLILKA 498
             +Y M   +  EL +++ +A
Sbjct: 117 RKHYNMYDLIVKELPEVLKEA 137



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 31/65 (47%), Positives = 41/65 (63%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL   L+NPG +KS SAFA ICNP+A PWG+ AFS YL    S W   D++ L+ ++   
Sbjct: 158 ALSIYLKNPGLFKSASAFAPICNPAAVPWGINAFSNYL-SSSSSWLAHDSSALLPQFADE 216

Query: 741 PLTLL 755
           P  L+
Sbjct: 217 PKILV 221



 Score = 36.3 bits (80), Expect = 0.84
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +2

Query: 86  MDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSGQLVV 265
           M  L+  SSNK  G +   Y   S+ L     F++++P  A   D   P+L+YL+G    
Sbjct: 1   MVQLEKLSSNKAAGSFLTKYKFPSASLALPTQFNVFVPSSASP-DSPAPVLFYLAGLTCT 59

Query: 266 NKTSS 280
             T +
Sbjct: 60  EDTGA 64


>UniRef50_P40363 Cluster: S-formylglutathione hydrolase; n=7;
           Saccharomycetales|Rep: S-formylglutathione hydrolase -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 299

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGD-DSSWDFGVSAGFYLDATNEP 432
           TC+  N   K+ +Q  A ++G  +V PDTSPRG ++  D + SWDFG  AGFYL+AT EP
Sbjct: 59  TCTPDNASEKAFWQFQADKYGFAIVFPDTSPRGDEVANDPEGSWDFGQGAGFYLNATQEP 118

Query: 433 WNNNYRMGSYLNVEL 477
           +  +Y+M  Y++ EL
Sbjct: 119 YAQHYQMYDYIHKEL 133



 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 27/45 (60%), Positives = 33/45 (73%)
 Frame = +3

Query: 591 QYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVK 725
           +YKS SAFA I NPS  PWG KAF GYLGE+K++W  +D   L+K
Sbjct: 179 RYKSCSAFAPIVNPSNVPWGQKAFKGYLGEEKAQWEAYDPCLLIK 223


>UniRef50_A5WCZ7 Cluster: S-formylglutathione hydrolase; n=3;
           Psychrobacter|Rep: S-formylglutathione hydrolase -
           Psychrobacter sp. PRwf-1
          Length = 284

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 31/82 (37%), Positives = 49/82 (59%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TCS  N   K+ FQ+  +E G+I + PDTSP+G  +  D+  +  G  A +Y++AT + W
Sbjct: 57  TCSPDNVTHKAHFQQKCSELGMIFIAPDTSPKGESVPNDE-RYFVGQGASYYVNATEDKW 115

Query: 436 NNNYRMGSYLNVELYDLILKAF 501
           + ++ M SY+  E Y+LI   F
Sbjct: 116 SKHFNMHSYIIDEFYELIRSQF 137



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/56 (46%), Positives = 34/56 (60%)
 Frame = +2

Query: 86  MDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           M +L L S N+ F G Q  Y+H S+  + +M+FSIYLP +A  G    P L YLSG
Sbjct: 1   MSTLTLTSKNRCFNGEQYYYTHQSAVTQTEMSFSIYLPDEALAGQT-CPALLYLSG 55



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLG-EDKSKWAEWDATELVKKYNG 737
           AL+   + P ++ SVSA A IC  S   WG  AFS Y G E +  WA++DA  +V+K   
Sbjct: 154 ALMFGFKYPSKFISVSAIAPICVASESDWGRAAFSEYFGAESEQTWAQFDAVNIVEKAGK 213

Query: 738 PPLTLLLDR 764
               +L+D+
Sbjct: 214 QYPHILVDQ 222


>UniRef50_A4S7A8 Cluster: Predicted protein; n=13; cellular
           organisms|Rep: Predicted protein - Ostreococcus
           lucimarinus CCE9901
          Length = 296

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 31/74 (41%), Positives = 43/74 (58%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+++N   K     +     V +V PDTSPRG     DD +WD G  AGFY+DA+  PW
Sbjct: 60  TCTDENVAQKGCAFEHCHARRVAMVMPDTSPRGDDA-ADDEAWDLGKGAGFYVDASAAPW 118

Query: 436 NNNYRMGSYLNVEL 477
           + +Y+  SY+  EL
Sbjct: 119 SRHYKTYSYVTKEL 132



 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 33/58 (56%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSA--CPWGVKAFSGYLGE-DKSKWAEWDATELVK 725
           AL   LRNP  Y S SAFA I NP+A  CPWG KA   YLG  D  +    DATELVK
Sbjct: 162 ALTLALRNPNAYASASAFAPIANPTASDCPWGQKALKAYLGSADCDEAKSHDATELVK 219


>UniRef50_Q6LH00 Cluster: Putative uncharacterized protein SMU.118C;
           n=1; Photobacterium profundum|Rep: Putative
           uncharacterized protein SMU.118C - Photobacterium
           profundum (Photobacterium sp. (strain SS9))
          Length = 84

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/59 (44%), Positives = 38/59 (64%)
 Frame = +2

Query: 74  QKSNMDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLS 250
           Q+    +++  S NK FGG+ K YSH S+ L C M F+I+ PPQ   G  K+P++Y+LS
Sbjct: 2   QRDRKMTIENISVNKSFGGWHKQYSHYSNILNCTMQFAIFFPPQVVCGK-KVPVIYWLS 59


>UniRef50_UPI0000660A78 Cluster: S-formylglutathione hydrolase (EC
           3.1.2.12) (FGH) (Esterase D).; n=1; Takifugu
           rubripes|Rep: S-formylglutathione hydrolase (EC
           3.1.2.12) (FGH) (Esterase D). - Takifugu rubripes
          Length = 268

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/30 (66%), Positives = 22/30 (73%)
 Frame = +1

Query: 400 AGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
           AGFY+DAT EPW  NYRM SY+  EL  LI
Sbjct: 25  AGFYVDATQEPWRTNYRMYSYVTEELPRLI 54


>UniRef50_A7HJ67 Cluster: Putative esterase; n=2;
           Thermotogaceae|Rep: Putative esterase - Fervidobacterium
           nodosum Rt17-B1
          Length = 379

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +2

Query: 125 GGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSGQLVVNKTSSLN 286
           G  + +    S EL  K N  IYLPP  E  + + P+LY   GQ + + ++S +
Sbjct: 129 GNIKLIKDFYSPELGNKRNIIIYLPPNYESSNDRYPVLYMHDGQNIFDASTSFS 182


>UniRef50_A0E374 Cluster: Chromosome undetermined scaffold_76, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_76,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 581

 Score = 36.3 bits (80), Expect = 0.84
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 10/99 (10%)
 Frame = +2

Query: 20  RGK*WLQDNCEYNFSGAHQKSNMDSLQLESSNKIFGG--YQKVYSHASSELKCKM--NFS 187
           R K W +D C Y    AH+K     +QL+  N   GG  + K++S    +LK ++     
Sbjct: 407 RIKIWNRDKCFYTIEDAHKKIVRTIIQLDDDNFASGGDCFIKIWSAFKGQLKYELAHGDD 466

Query: 188 IY----LPPQ--AEGGDVKLPLLYYLSGQLVVNKTSSLN 286
           +Y    LP Q  A GG  ++ +++ L G    +K  + N
Sbjct: 467 VYCLKELPNQMLASGGADRIIIIWNLRGGFKAHKLQAHN 505


>UniRef50_Q6G430 Cluster: Putative uncharacterized protein; n=2;
            Bartonella henselae|Rep: Putative uncharacterized protein
            - Bartonella henselae (Rochalimaea henselae)
          Length = 1291

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%)
 Frame = +1

Query: 343  SPRGVKIDGDDSSWDFGVS--AGFYLDATNEPWNNNYRMGSYLNVE 474
            S  G+ I+G+ + W  G S  AG+  + T   W   Y   S+L VE
Sbjct: 1129 STNGIAIEGNYNQWGLGTSFEAGYRFETTKSSWMQPYAQLSWLQVE 1174


>UniRef50_Q4XN50 Cluster: Putative uncharacterized protein; n=2;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 895

 Score = 33.9 bits (74), Expect = 4.5
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +1

Query: 361 IDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDL 486
           ++GD++      ++G+Y D  N   NNN  MG Y+N+  YD+
Sbjct: 339 LNGDNNGMPIDSNSGYY-DPANIMNNNNGNMGMYMNMNNYDI 379


>UniRef50_Q7UMH7 Cluster: Probable endo-1,4-beta-xylanase 1; n=2;
           Planctomycetaceae|Rep: Probable endo-1,4-beta-xylanase 1
           - Rhodopirellula baltica
          Length = 331

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = +2

Query: 155 SSELKCKMNFSIYLPPQAEGGDV--KLPLLYYLSGQLVVNKTSSLNLV 292
           S  L C + ++I +PP    GD   + P++YYL G    +++ S+ LV
Sbjct: 77  SPSLNCDVGYAILMPPGYSDGDAGKRFPVVYYLHGGRPGSESKSIALV 124


>UniRef50_A3QDI5 Cluster: Putative esterase precursor; n=2;
           Shewanella|Rep: Putative esterase precursor - Shewanella
           loihica (strain BAA-1088 / PV-4)
          Length = 445

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 19/61 (31%), Positives = 27/61 (44%)
 Frame = +2

Query: 107 SSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSGQLVVNKTSSLN 286
           S N I  G++  +SH SSE K    + + LP    G     P+LY +         S+L 
Sbjct: 59  SDNAIIAGHE--FSHDSSEFKTPRRYMVSLPEGYHGNTRHYPVLYVVDADFQFQHVSALA 116

Query: 287 L 289
           L
Sbjct: 117 L 117


>UniRef50_Q4N6I3 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 755

 Score = 33.5 bits (73), Expect = 5.9
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = -1

Query: 341 VSGPTTITPCSAAYLWKPDLVMKF-CSLQVDQTNNIEVVISHHPLLPEGGD 192
           V GP T+T  +  + W+ D + +  C   +   N+   V+SHH L  + GD
Sbjct: 423 VMGPDTVTQMTGVF-WRKDYIHRIVCKRTIQLHNHKLYVLSHHTLSTQSGD 472


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 814,381,355
Number of Sequences: 1657284
Number of extensions: 17084729
Number of successful extensions: 41623
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 39816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41595
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 64615845515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -