SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O10372 Cluster: Occlusion-derived virus envelope protei...    98   2e-19
UniRef50_Q462F3 Cluster: Orf13; n=14; Nucleopolyhedrovirus|Rep: ...    79   1e-13
UniRef50_Q0ILA6 Cluster: Odv-e27; n=2; Nucleopolyhedrovirus|Rep:...    68   2e-10
UniRef50_Q6QXM7 Cluster: ORF87; n=8; Granulovirus|Rep: ORF87 - A...    41   0.024
UniRef50_A6ED10 Cluster: Putative uncharacterized protein; n=1; ...    34   3.7  
UniRef50_Q231T7 Cluster: Putative uncharacterized protein; n=1; ...    33   4.9  
UniRef50_Q7RLQ5 Cluster: Putative uncharacterized protein PY0248...    33   6.5  
UniRef50_Q6JPA5 Cluster: Occlusion-derived virus envelope/capsid...    33   8.6  

>UniRef50_O10372 Cluster: Occlusion-derived virus envelope protein
           E27; n=12; Nucleopolyhedrovirus|Rep: Occlusion-derived
           virus envelope protein E27 - Orgyia pseudotsugata
           multicapsid polyhedrosis virus (OpMNPV)
          Length = 297

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 45/62 (72%), Positives = 54/62 (87%), Gaps = 1/62 (1%)
 Frame = -2

Query: 682 KADTRQIAAVVFSTLAFIHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEG-VC 506
           +ADTRQI AVV +T+ F+HNRF+PLVT+FTNKMEFV TET +T IPGEPILFTEN+G + 
Sbjct: 74  RADTRQIVAVVQATMGFVHNRFNPLVTHFTNKMEFVTTETAETIIPGEPILFTENDGALL 133

Query: 505 CA 500
           CA
Sbjct: 134 CA 135



 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 42/64 (65%), Positives = 51/64 (79%)
 Frame = -3

Query: 255 QHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKINS 76
           +HAYLHYYIFKNYG  EY KSL DHSLF NKLRS+ + K  NLLLSKF+FT+E+ DK +S
Sbjct: 225 EHAYLHYYIFKNYGALEYSKSLMDHSLFVNKLRSSTNAKMHNLLLSKFRFTVEESDKTSS 284

Query: 75  NSVT 64
            + +
Sbjct: 285 GTTS 288



 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 49/95 (51%), Positives = 65/95 (68%), Gaps = 8/95 (8%)
 Frame = -1

Query: 515 GGVLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDD-YESNK 339
           G +LC++DRPSIVKMLSREFD       +  N  V +AKT  ++KRK  + +D+ YE  K
Sbjct: 130 GALLCAIDRPSIVKMLSREFDLSVAAEPQTSNREVLVAKTLVSNKRKRRSSNDEGYEFIK 189

Query: 338 QP----DYD--MD-LSDFSITEVEATQYLTLLLIV 255
           +P    +Y+  MD LSDF++TE+E TQYL LLLIV
Sbjct: 190 RPRTFSEYNQCMDALSDFNVTEIETTQYLLLLLIV 224


>UniRef50_Q462F3 Cluster: Orf13; n=14; Nucleopolyhedrovirus|Rep:
           Orf13 - Trichoplusia ni SNPV
          Length = 296

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 32/62 (51%), Positives = 46/62 (74%)
 Frame = -3

Query: 255 QHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKINS 76
           +HAY HYYI KNYG++ Y +SL DH++FT K + +++   +NLLLSKFKFT+E+ +   S
Sbjct: 211 EHAYGHYYILKNYGIYNYTQSLLDHTIFTQKYKPSLNVNFANLLLSKFKFTVEESEGNRS 270

Query: 75  NS 70
            S
Sbjct: 271 KS 272



 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 33/66 (50%), Positives = 45/66 (68%)
 Frame = -2

Query: 673 TRQIAAVVFSTLAFIHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEGVCCAPS 494
           TR+I  VV ++L F+HNR +PLV NF  KMEF++ E+ + +IPGEPILF  NE       
Sbjct: 80  TREIVTVVLASLGFVHNRVNPLVNNFNRKMEFIIVESKNLTIPGEPILFRHNENEDIVCI 139

Query: 493 TDRLSL 476
            DR+S+
Sbjct: 140 IDRVSI 145



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (0%)
 Frame = -1

Query: 533 FVYRKRGGVLCSVDRPSIVKMLSREFDTEALV-NFENDNCNVRIAKTFGASKRKNTTRSD 357
           F + +   ++C +DR SIVKML ++FDT+  V N   ++  +++ K+F + K++ +   D
Sbjct: 128 FRHNENEDIVCIIDRVSIVKMLEKQFDTDMNVSNIIQEHQKLKLIKSFTSVKKRKS--FD 185

Query: 356 DYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIIIFLKITGCLN 204
           D +++             + E+EATQY TLL I+         LK  G  N
Sbjct: 186 DQDNSFY---------IKLNEIEATQYTTLLFIMEHAYGHYYILKNYGIYN 227


>UniRef50_Q0ILA6 Cluster: Odv-e27; n=2; Nucleopolyhedrovirus|Rep:
           Odv-e27 - Leucania separata nuclear polyhedrosis virus
           (LsNPV)
          Length = 284

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 30/58 (51%), Positives = 42/58 (72%)
 Frame = -3

Query: 255 QHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKI 82
           +HAY+HY + +NY V  Y ++L+DHS+F  K  +  ST  +NLL+SKFKFTIED D +
Sbjct: 215 EHAYIHYNVLRNYDVNNYTRTLSDHSIFGQKAANFHST-FNNLLMSKFKFTIEDHDNL 271



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/67 (40%), Positives = 42/67 (62%)
 Frame = -2

Query: 670 RQIAAVVFSTLAFIHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEGVCCAPST 491
           R+I  +V ++LAF+H R +P+V +F N+ME+VVT   + SIPGEP  F        +  T
Sbjct: 76  REIVQIVHNSLAFVHQRANPMVNSF-NRMEYVVTNEINHSIPGEPFFF----ATTVSDDT 130

Query: 490 DRLSLKC 470
           D  +++C
Sbjct: 131 DEETIRC 137



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = -1

Query: 509 VLCSVDRPSIVKMLSREFDTEALVNFENDNCNV---RIAKTFGASKRKNTTRSDDYESNK 339
           + C +DRP+I K L ++ DT   V+ E D   +   ++A  F  S  K   R+DDY    
Sbjct: 135 IRCYIDRPTIAKTLEKQIDTHVHVS-ELDATRIGQNKLANAFRGSAEKRR-RTDDYY--- 189

Query: 338 QPDYDMDLSDFSITEVEATQYLTLLLIV 255
              YD + +D  ++EV+ T+YLTLLL++
Sbjct: 190 ---YDDNFADIKLSEVDVTRYLTLLLMI 214


>UniRef50_Q6QXM7 Cluster: ORF87; n=8; Granulovirus|Rep: ORF87 -
           Agrotis segetum granulosis virus (AsGV) (Agrotis
           segetumgranulovirus)
          Length = 298

 Score = 41.1 bits (92), Expect = 0.024
 Identities = 18/46 (39%), Positives = 30/46 (65%)
 Frame = -2

Query: 664 IAAVVFSTLAFIHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILF 527
           I ++V+ +LAF++ +  P  T F + M F++T     +IPGEPI+F
Sbjct: 88  ILSLVYHSLAFVNTQMFPHSTRFVD-MRFIITSERKFAIPGEPIVF 132



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 3/87 (3%)
 Frame = -1

Query: 509 VLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASK-RKNTTRSDDYESNKQP 333
           V+C VDRP I+++L +  D   +   END  N  + K F   K  ++    + YE     
Sbjct: 144 VVCFVDRPGILRVLEKPVDVNVVFE-ENDCKNEYMTKLFDRIKSTEHAAPVNPYERFITN 202

Query: 332 DY--DMDLSDFSITEVEATQYLTLLLI 258
           ++  +++ S+  + E   TQ++ LL++
Sbjct: 203 EFVCNLNESNLKMDEGYITQFVILLIL 229


>UniRef50_A6ED10 Cluster: Putative uncharacterized protein; n=1;
           Pedobacter sp. BAL39|Rep: Putative uncharacterized
           protein - Pedobacter sp. BAL39
          Length = 383

 Score = 33.9 bits (74), Expect = 3.7
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -3

Query: 252 HAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKINSN 73
           H   +Y  FK+YG     + +T+H L   K      TK +N + +K  +T E F K NS+
Sbjct: 161 HPEYYYSFFKDYGFETSYQQITNH-LAVRKPFPERFTKIANWVANKPGYTFEHFSKKNSD 219


>UniRef50_Q231T7 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1044

 Score = 33.5 bits (73), Expect = 4.9
 Identities = 20/71 (28%), Positives = 34/71 (47%)
 Frame = -1

Query: 350 ESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIIIFLKITGCLNIASR*RTIRFL 171
           ++NK   +  ++  F+I      QY+ L+L+ N  I +  F K+  CL    + +   FL
Sbjct: 361 QTNKDQPFTQNILQFTIDLSFQIQYMLLVLLSNKKISLFEFPKLQQCLKQMCQGKAFFFL 420

Query: 170 PTNCDRQ*AQK 138
               +RQ  QK
Sbjct: 421 NNLMNRQEHQK 431


>UniRef50_Q7RLQ5 Cluster: Putative uncharacterized protein PY02485;
           n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY02485 - Plasmodium yoelii yoelii
          Length = 1091

 Score = 33.1 bits (72), Expect = 6.5
 Identities = 12/53 (22%), Positives = 27/53 (50%)
 Frame = -1

Query: 485 SIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQPDY 327
           S+V+   +E D E  + ++N+N   +I++ +    +    R+  Y + K P +
Sbjct: 229 SLVETSEKESDFEEFIKYDNNNIQTKISEMYKNGNKNGNIRNSVYYNKKSPSF 281


>UniRef50_Q6JPA5 Cluster: Occlusion-derived virus envelope/capsid
           protein; n=3; Nucleopolyhedrovirus|Rep:
           Occlusion-derived virus envelope/capsid protein -
           Neodiprion lecontii NPV
          Length = 262

 Score = 32.7 bits (71), Expect = 8.6
 Identities = 18/61 (29%), Positives = 35/61 (57%)
 Frame = -3

Query: 255 QHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKINS 76
           +H+++H YI  N    +   S+ DH+++   L   +S+K   LL+S F++ IE  + +N 
Sbjct: 197 EHSFVHLYIHVNENEKKNALSMIDHTVYF-ALGKGVSSK---LLMSTFRYKIEQDNTVNK 252

Query: 75  N 73
           +
Sbjct: 253 H 253


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 566,547,193
Number of Sequences: 1657284
Number of extensions: 10358703
Number of successful extensions: 28859
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 27832
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28843
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53305790091
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -