SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;...   108   1e-22
UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9; Nucl...   102   1e-20
UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep: ...    99   1e-19
UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6; Nucleopolyh...    93   8e-18
UniRef50_Q9PYM1 Cluster: ORF175; n=2; Granulovirus|Rep: ORF175 -...    70   7e-11
UniRef50_Q6QXI7 Cluster: ORF127; n=1; Agrotis segetum granulovir...    68   3e-10
UniRef50_Q8JRT3 Cluster: VP1054; n=1; Phthorimaea operculella gr...    62   2e-08
UniRef50_Q91ER7 Cluster: ORF138 VP1054; n=5; Granulovirus|Rep: O...    59   1e-07
UniRef50_Q9DVR8 Cluster: PxORF115 peptide; n=1; Plutella xyloste...    57   4e-07
UniRef50_Q6JP84 Cluster: Viral capsid associated protein; n=3; N...    40   0.083
UniRef50_Q19481 Cluster: Putative uncharacterized protein; n=1; ...    39   0.14 
UniRef50_Q4E1T7 Cluster: Putative uncharacterized protein; n=2; ...    34   3.1  
UniRef50_Q6KIK2 Cluster: Expressed protein; n=1; Mycoplasma mobi...    33   7.2  
UniRef50_Q6F1P7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_A7P245 Cluster: Chromosome chr19 scaffold_4, whole geno...    33   9.5  
UniRef50_Q5D8J8 Cluster: SJCHGC02032 protein; n=9; Schistosoma j...    33   9.5  

>UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 42.5 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 378

 Score =  108 bits (260), Expect = 1e-22
 Identities = 48/86 (55%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +3

Query: 255 GIPPGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSEA--GGASASLRENVNNQ 428
           G PPGH+MCPPR I KK++ Y  W  NP+K +RYS LIAR S+A  G  S  LRENV+  
Sbjct: 283 GAPPGHLMCPPRAIVKKIYRYVNWASNPHKDQRYSALIARPSDAATGAGSGDLRENVDGN 342

Query: 429 LHARDASQLHLLDWENFMGEFSSYFG 506
           LHA D + L LLDW+NF+     YFG
Sbjct: 343 LHADDITPLILLDWDNFVSALMDYFG 368



 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 39/63 (61%), Positives = 53/63 (84%)
 Frame = +1

Query: 73  RQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRVKCCDLNY 252
           RQSQYIY+TFL+Y T+LT ILKQ+NPF +I+EN+S S+++R LG CP+N +RV CC L+Y
Sbjct: 223 RQSQYIYQTFLVYATLLTTILKQSNPF-IISENSSASVVLRTLGKCPDNPERVNCCKLSY 281

Query: 253 GAS 261
           G +
Sbjct: 282 GGA 284


>UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9;
           Nucleopolyhedrovirus|Rep: ORF105 vp1054 virion protein -
           Spodoptera exigua MNPV
          Length = 346

 Score =  102 bits (244), Expect = 1e-20
 Identities = 50/84 (59%), Positives = 62/84 (73%), Gaps = 1/84 (1%)
 Frame = +1

Query: 61  TDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRVKCC 240
           T+ + +SQ IYRTFL+YNTVLT +LKQ+NPFN  A+N  IS+I+R LG CPNNKDRVKCC
Sbjct: 193 TEAAFESQLIYRTFLMYNTVLTMLLKQSNPFNENAKN--ISVILRTLGKCPNNKDRVKCC 250

Query: 241 DLNYGASR-RDMSCARRVRLPKRF 309
           DL YGA+    + C  R  + K F
Sbjct: 251 DLQYGANAPGHIMCPPREMIKKIF 274



 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 39/85 (45%), Positives = 53/85 (62%), Gaps = 3/85 (3%)
 Frame = +3

Query: 264 PGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSEAG---GASASLRENVNNQLH 434
           PGH+MCPPRE+ KK+FHYAKW R PN Y+RY ELI  QS        +    ++ NN  +
Sbjct: 259 PGHIMCPPREMIKKIFHYAKWSRTPNNYRRYFELIVAQSVPNRRFDENIDDDDDDNNNNY 318

Query: 435 ARDASQLHLLDWENFMGEFSSYFGL 509
             + + L  +DW NF+ +F  YFG+
Sbjct: 319 RNNNTSLIKMDWYNFIDDFRRYFGI 343


>UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep:
           Vp1054 - Ecotropis obliqua NPV
          Length = 366

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 52/99 (52%), Positives = 64/99 (64%), Gaps = 1/99 (1%)
 Frame = +1

Query: 52  IVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRV 231
           + +TD+   SQ +YRTFL+YNTVL+ ILKQ NPFN +++N  ISII RNLG CP N+DRV
Sbjct: 209 VPTTDDCVTSQNVYRTFLVYNTVLSMILKQRNPFNEVSKN--ISIIFRNLGKCPQNRDRV 266

Query: 232 KCCDLNYGA-SRRDMSCARRVRLPKRFFITQSGLETPTS 345
           KCC L YG      + CA R  L KR F       TP +
Sbjct: 267 KCCTLRYGGHPPGHVMCAPRNML-KRIFHYAKWARTPNN 304



 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 52/119 (43%), Positives = 67/119 (56%), Gaps = 7/119 (5%)
 Frame = +3

Query: 183 NYSQEFGQLSK-QQRSSKVLRSQLR--GIPPGHVMCPPREITKKVFHYAKWVRNPNKYKR 353
           N S  F  L K  Q   +V    LR  G PPGHVMC PR + K++FHYAKW R PN YKR
Sbjct: 248 NISIIFRNLGKCPQNRDRVKCCTLRYGGHPPGHVMCAPRNMLKRIFHYAKWARTPNNYKR 307

Query: 354 YSELIARQ---SEAGGASASLRENVNNQLHARDASQLH-LLDWENFMGEFSSYFGLTHT 518
           Y ELI +     +  G + + R+  N   +A   +  H L+DW NFM +F +YFG+  T
Sbjct: 308 YYELITQPVIIEQNFGENINARD-TNQIQNAESNNTSHVLMDWYNFMFDFRTYFGIETT 365


>UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6;
           Nucleopolyhedrovirus|Rep: VP1054 virion protein -
           Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 352

 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 49/100 (49%), Positives = 62/100 (62%), Gaps = 2/100 (2%)
 Frame = +1

Query: 52  IVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRV 231
           +  TD S +SQ IY+TFL+YNT LT +L Q NPFN  A + +ISI+ RNLG CPNN  RV
Sbjct: 204 VPDTDASVESQNIYKTFLVYNTTLTMMLNQRNPFN--AHDKNISIVFRNLGVCPNNSMRV 261

Query: 232 KCCDLNYG--ASRRDMSCARRVRLPKRFFITQSGLETPTS 345
           KCCDL YG  AS     C  R  + +R F     ++ P +
Sbjct: 262 KCCDLKYGGNASPGHFMCPTR-EIVRRVFKYNKWVKNPNN 300



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 39/81 (48%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query: 264 PGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIAR--QSEAGGASASLRENVNNQLHA 437
           PGH MCP REI ++VF Y KWV+NPN YKRY ELI +  Q E        R    N    
Sbjct: 274 PGHFMCPTREIVRRVFKYNKWVKNPNNYKRYFELILKPVQRERRFDDGPTRRTFAN---- 329

Query: 438 RDASQLHLLDWENFMGEFSSY 500
            DA    +LDW NFM +F +Y
Sbjct: 330 LDAI---ILDWYNFMEDFKTY 347


>UniRef50_Q9PYM1 Cluster: ORF175; n=2; Granulovirus|Rep: ORF175 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 323

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 24/38 (63%), Positives = 33/38 (86%)
 Frame = +3

Query: 261 PPGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIAR 374
           PP HVMCPP+E+ K+++HYAKWV +PN ++RY+ELI R
Sbjct: 257 PPNHVMCPPKEMVKRIYHYAKWVESPNNWRRYNELIVR 294



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 36/119 (30%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = +1

Query: 7   NELKYPWNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISI 186
           ++++ P N I  +  +  T+E+  SQ IY++F++YNTVLT +L++ NPFN   +   IS 
Sbjct: 170 DDVEPPLNSIFNHETLPDTEEATASQDIYKSFVVYNTVLTMMLREANPFN---DQRVISK 226

Query: 187 IVRNLGNCP----NNKDRVKCCDLNYGASR--RDMSCARRVRLPKRFFITQSGLETPTS 345
           I+ ++G C       ++ +K C+LN+G       + C  +  + KR +     +E+P +
Sbjct: 227 IIESVGTCTGGHGTKRNYIKVCELNFGGDSPPNHVMCPPK-EMVKRIYHYAKWVESPNN 284


>UniRef50_Q6QXI7 Cluster: ORF127; n=1; Agrotis segetum
           granulovirus|Rep: ORF127 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 331

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 23/39 (58%), Positives = 32/39 (82%)
 Frame = +3

Query: 267 GHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSE 383
           GH+MCPP+++ K+++HYAKW  NPN YKRY +LI R S+
Sbjct: 269 GHIMCPPKDMVKRIYHYAKWTHNPNNYKRYIDLILRDSK 307



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 33/83 (39%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +1

Query: 28  NLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGN 207
           N I   S +    E+  SQ IY++FL YNTVLT +L++ NPFN   +   IS I+ N+G 
Sbjct: 185 NKIFTFSSLPEFTEATASQDIYKSFLTYNTVLTMLLQEKNPFN--DKKKVISKIIENVGT 242

Query: 208 C-----PNNKDRVKCCDLNYGAS 261
           C        K  +K C+L +G S
Sbjct: 243 CNRGIEGGKKSYIKICELKFGNS 265


>UniRef50_Q8JRT3 Cluster: VP1054; n=1; Phthorimaea operculella
           granulovirus|Rep: VP1054 - Phthorimaea operculella
           granulovirus
          Length = 328

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 20/47 (42%), Positives = 33/47 (70%)
 Frame = +3

Query: 231 KVLRSQLRGIPPGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIA 371
           K+   +  G PPGH+ CPP+++ +K++ Y+KW  NP  Y+RY E++A
Sbjct: 253 KICELEFGGEPPGHIFCPPKDMVRKIYKYSKWRLNPKNYRRYFEILA 299



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = +1

Query: 64  DESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPN-----NKDR 228
           +++  SQ +Y+TF++YNTVLT +LK  NPFN       IS I+ ++G C        ++R
Sbjct: 194 EDATLSQDVYKTFIVYNTVLTMMLKSENPFN--DRTKVISKIIESVGTCNGGIDGAKRNR 251

Query: 229 VKCCDLNYG 255
           +K C+L +G
Sbjct: 252 IKICELEFG 260


>UniRef50_Q91ER7 Cluster: ORF138 VP1054; n=5; Granulovirus|Rep:
           ORF138 VP1054 - Cydia pomonella granulosis virus (CpGV)
           (Cydia pomonellagranulovirus)
          Length = 332

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 5/71 (7%)
 Frame = +1

Query: 64  DESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNC-----PNNKDR 228
           ++S  SQ+IY+ FL+YNTVLT +L + NPFN   ++ ++S ++ ++G C        + R
Sbjct: 197 EDSVASQHIYKAFLVYNTVLTMMLSEKNPFN--DKSRAVSKVIESVGTCNGGMEGGKRSR 254

Query: 229 VKCCDLNYGAS 261
           +K C+L +G S
Sbjct: 255 IKVCELKFGTS 265



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +3

Query: 261 PPGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELI 368
           P  HVMCPP+E+ K ++ YAKW   P  Y RY  ++
Sbjct: 268 PANHVMCPPKEMVKLIYRYAKWHLKPKNYSRYYTML 303


>UniRef50_Q9DVR8 Cluster: PxORF115 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF115 peptide - Plutella xylostella
           granulovirus
          Length = 311

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 20/38 (52%), Positives = 30/38 (78%)
 Frame = +3

Query: 270 HVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSE 383
           HVMCPP E+ K ++HYAKWV+ PNKY +Y +L+ + ++
Sbjct: 252 HVMCPPVEMVKIIYHYAKWVQGPNKYAKYYKLMVKNTK 289



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 5/81 (6%)
 Frame = +1

Query: 22  PWNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNL 201
           P N + ++  +   DES  SQ IY+ F++YNTVLT +L   N FN       IS I+  L
Sbjct: 169 PINRLLSHFTVPECDESVVSQQIYKNFIVYNTVLTMMLNGPNMFN--DRKKPISKIIECL 226

Query: 202 GNC-----PNNKDRVKCCDLN 249
           G C      N K+R+K C+LN
Sbjct: 227 GKCDGGTGDNKKNRIKMCELN 247


>UniRef50_Q6JP84 Cluster: Viral capsid associated protein; n=3;
           Nucleopolyhedrovirus|Rep: Viral capsid associated
           protein - Neodiprion lecontii NPV
          Length = 313

 Score = 39.5 bits (88), Expect = 0.083
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 2/86 (2%)
 Frame = +1

Query: 88  IYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRVKCCDLNYG--AS 261
           IY + L+ NT++T  L + NP +   +  S + IVR +  CP NK+ +  C  N+     
Sbjct: 178 IYYSLLIINTIMTMCLNEKNPLSDAGK--SYAKIVRIVKPCPFNKNNLGMCTRNFANHEF 235

Query: 262 RRDMSCARRVRLPKRFFITQSGLETP 339
           + +      ++L K+F + Q  + TP
Sbjct: 236 KNNHLFDMPLKLLKQFLVFQKIVLTP 261


>UniRef50_Q19481 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 453

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +1

Query: 103 LLYNTVLTAILKQNNPFNVIAENTSISIIVRNLGNCPNNKDRVKCCDLNYGASRRD 270
           LLY  V+  I++ N P +V     + +I+  NLG CP   DR+K C   + +S R+
Sbjct: 4   LLYFIVIL-IIQANVPGSVQDSPEAYNILEPNLGGCPRTSDRIKFCSAKFNSSIRN 58


>UniRef50_Q4E1T7 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 1144

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
 Frame = +3

Query: 345 YKRYSELIARQSEAGGASASLRENVNNQLHARDASQLHLL---DWENFMGE 488
           YK+ SEL +RQ E GGAS S    +  +    D   + LL   DW+ F+GE
Sbjct: 637 YKKVSELCSRQ-EGGGASNSAGRKLRLRYQDSDGDCISLLTQEDWDVFVGE 686


>UniRef50_Q6KIK2 Cluster: Expressed protein; n=1; Mycoplasma
           mobile|Rep: Expressed protein - Mycoplasma mobile
          Length = 697

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = +1

Query: 7   NELKYPWNLITANSFIVSTDES-RQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSIS 183
           N L    N+  +NS I + D+   +  Y Y +F+  N+++  ILK N+P +V  +N  I 
Sbjct: 452 NSLDSSQNMSFSNSIIENLDDYITEINYDYASFVTTNSIV--ILKNNDPVSVDVQNNKIL 509

Query: 184 II 189
           ++
Sbjct: 510 VV 511


>UniRef50_Q6F1P7 Cluster: Putative uncharacterized protein; n=1;
           Mesoplasma florum|Rep: Putative uncharacterized protein
           - Mesoplasma florum (Acholeplasma florum)
          Length = 447

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 17/58 (29%), Positives = 32/58 (55%)
 Frame = +1

Query: 25  WNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRN 198
           W+     +F+V+  + ++  + Y  F +   +L  I+ +NN  NVI+    IS++VRN
Sbjct: 59  WHSNYNYTFVVNLTDFKKYTFEYYNFKIEYQILERIIDKNN--NVISTKNGISLLVRN 114


>UniRef50_A7P245 Cluster: Chromosome chr19 scaffold_4, whole genome
           shotgun sequence; n=3; Vitis vinifera|Rep: Chromosome
           chr19 scaffold_4, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1123

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +3

Query: 465 DWENFMGEFSSYFGLTHTTCSISNI*QLTYLLNK 566
           D +N M  F  +FGLT T C +S+I  LT  L K
Sbjct: 463 DTKNNMSVFGHFFGLTKTKCKLSSIYYLTPWLKK 496


>UniRef50_Q5D8J8 Cluster: SJCHGC02032 protein; n=9; Schistosoma
           japonicum|Rep: SJCHGC02032 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 220

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)
 Frame = +1

Query: 100 FLLYNTVLTAILK---QNNPFNVIAENTSISIIVRNLGNCPNNK 222
           FLLY +++  ++    QNN  N IA+N  I+I +RNLGN    K
Sbjct: 5   FLLYISMVLILINESTQNNLLNAIAKN--ITIAIRNLGNLTGGK 46


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,904,350
Number of Sequences: 1657284
Number of extensions: 12727770
Number of successful extensions: 33841
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 32682
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33825
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 59090914597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -