SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P41435 Cluster: Apoptosis inhibitor 1; n=13; Nucleopoly...   190   5e-47
UniRef50_UPI0000DB79F2 Cluster: PREDICTED: similar to thread CG1...    85   2e-15
UniRef50_P41437 Cluster: Apoptosis inhibitor 3; n=2; Nucleopolyh...    84   3e-15
UniRef50_Q0IL79 Cluster: Iap3; n=1; Leucania separata nuclear po...    78   2e-13
UniRef50_Q7T9S6 Cluster: Iap-3; n=1; Adoxophyes orana granulovir...    77   5e-13
UniRef50_UPI00015A57A9 Cluster: UPI00015A57A9 related cluster; n...    77   7e-13
UniRef50_A5PLG7 Cluster: Zgc:165605 protein; n=4; Euteleostomi|R...    77   7e-13
UniRef50_Q80LK8 Cluster: Inhibitor of apoptosis protein 3; n=1; ...    76   9e-13
UniRef50_Q9J827 Cluster: ORF110 iap-3; n=1; Spodoptera exigua MN...    75   2e-12
UniRef50_Q9E232 Cluster: Iap; n=3; Nucleopolyhedrovirus|Rep: Iap...    74   4e-12
UniRef50_Q4KT41 Cluster: IAP-3; n=2; Nucleopolyhedrovirus|Rep: I...    74   5e-12
UniRef50_Q1A4L2 Cluster: IAP-3; n=3; Baculoviridae|Rep: IAP-3 - ...    74   5e-12
UniRef50_Q7T5S1 Cluster: Iap-3; n=1; Cryptophlebia leucotreta gr...    73   6e-12
UniRef50_P41436 Cluster: Apoptosis inhibitor IAP; n=12; root|Rep...    73   6e-12
UniRef50_Q9EN27 Cluster: AMV021; n=1; Amsacta moorei entomopoxvi...    73   8e-12
UniRef50_Q91EW1 Cluster: ORF94 IAP; n=1; Cydia pomonella granulo...    73   1e-11
UniRef50_Q4T660 Cluster: Chromosome undetermined SCAF8908, whole...    72   2e-11
UniRef50_Q8JRX3 Cluster: Inhibitor of apoptosis 1; n=1; Phthorim...    71   3e-11
UniRef50_Q287F3 Cluster: IAP-3; n=1; Agrotis segetum nucleopolyh...    70   8e-11
UniRef50_Q7QJ55 Cluster: ENSANGP00000009540; n=1; Anopheles gamb...    70   8e-11
UniRef50_UPI00015B5932 Cluster: PREDICTED: similar to inhibitor ...    69   1e-10
UniRef50_Q6QXJ6 Cluster: ORF53; n=1; Agrotis segetum granuloviru...    69   1e-10
UniRef50_Q7T5K8 Cluster: Iap; n=1; Cryptophlebia leucotreta gran...    69   2e-10
UniRef50_Q13490 Cluster: Baculoviral IAP repeat-containing prote...    69   2e-10
UniRef50_UPI00015B5930 Cluster: PREDICTED: similar to inhibitor ...    68   2e-10
UniRef50_UPI000051A5A0 Cluster: PREDICTED: similar to Inhibitor ...    68   2e-10
UniRef50_Q6JKE3 Cluster: Inhibitor of apoptosis; n=1; Neodiprion...    68   2e-10
UniRef50_Q9YVJ4 Cluster: ORF MSV248 putative inhibitor of apopto...    67   4e-10
UniRef50_Q24306 Cluster: Apoptosis 1 inhibitor; n=3; Sophophora|...    66   1e-09
UniRef50_Q6ZM93 Cluster: Baculoviral IAP repeat-containing 3; n=...    66   1e-09
UniRef50_O62640 Cluster: Putative inhibitor of apoptosis; n=2; L...    66   1e-09
UniRef50_UPI0000D55797 Cluster: PREDICTED: similar to CG8293-PA,...    65   2e-09
UniRef50_UPI0000D55796 Cluster: PREDICTED: similar to CG8293-PA,...    65   2e-09
UniRef50_UPI00006A221A Cluster: Baculoviral IAP repeat-containin...    65   2e-09
UniRef50_Q175J8 Cluster: Inhibitor of apoptosis 1, diap1; n=1; A...    65   2e-09
UniRef50_Q8JHV9 Cluster: IAP-like protein; n=1; Xenopus laevis|R...    64   4e-09
UniRef50_A2AWP0 Cluster: Baculoviral IAP repeat-containing 7; n=...    64   4e-09
UniRef50_Q8WRD9 Cluster: Inhibitor of apotosis protein 1-like pr...    64   4e-09
UniRef50_Q8JKH8 Cluster: Inhibitor of apoptosis protein; n=1; He...    63   9e-09
UniRef50_Q24307 Cluster: Apoptosis 2 inhibitor; n=4; Sophophora|...    62   1e-08
UniRef50_Q8QL95 Cluster: Inhibitor of apoptosis-3 IAP-3; n=2; Nu...    62   2e-08
UniRef50_Q2PQQ3 Cluster: Inhibitor of apoptosis 1 protein; n=1; ...    62   2e-08
UniRef50_Q8JKH5 Cluster: IAP; n=1; Heliothis zea virus 1|Rep: IA...    60   5e-08
UniRef50_Q6JPG0 Cluster: Inhibitor of apoptosis protein; n=1; Ne...    60   5e-08
UniRef50_Q96CA5 Cluster: Baculoviral IAP repeat-containing prote...    60   5e-08
UniRef50_Q7QHS1 Cluster: ENSANGP00000017960; n=1; Anopheles gamb...    60   6e-08
UniRef50_P98170 Cluster: Baculoviral IAP repeat-containing prote...    60   6e-08
UniRef50_A5D8Q0 Cluster: Xxiap protein; n=3; Xenopus|Rep: Xxiap ...    59   1e-07
UniRef50_Q1RPV4 Cluster: Zinc finger protein; n=1; Ciona intesti...    59   1e-07
UniRef50_Q2PQQ2 Cluster: Inhibitor of apoptosis 2 protein; n=1; ...    59   1e-07
UniRef50_P41431 Cluster: Uncharacterized 14.6 kDa protein in EGT...    59   1e-07
UniRef50_A5IZV8 Cluster: Iap-5; n=1; Spodoptera litura granulovi...    58   2e-07
UniRef50_Q9DVT5 Cluster: PxORF98 peptide; n=1; Plutella xylostel...    58   3e-07
UniRef50_Q7SXU1 Cluster: Birc4 protein; n=7; Danio rerio|Rep: Bi...    57   5e-07
UniRef50_Q1RPW2 Cluster: Zinc finger protein; n=1; Ciona intesti...    57   6e-07
UniRef50_Q6R7I2 Cluster: ORF42; n=1; Ostreid herpesvirus 1|Rep: ...    56   8e-07
UniRef50_Q1RPV2 Cluster: Zinc finger protein; n=1; Ciona intesti...    56   8e-07
UniRef50_UPI0000E47BAE Cluster: PREDICTED: similar to baculovira...    56   1e-06
UniRef50_Q0ZP59 Cluster: Inhibitor of apoptosis; n=1; Neodiprion...    56   1e-06
UniRef50_A1YJA1 Cluster: Inhibitor of apoptosis 3; n=1; Spodopte...    56   1e-06
UniRef50_Q9PYQ9 Cluster: ORF137; n=2; Granulovirus|Rep: ORF137 -...    55   2e-06
UniRef50_Q7QJ54 Cluster: ENSANGP00000016568; n=4; Anopheles gamb...    55   2e-06
UniRef50_Q13075 Cluster: Baculoviral IAP repeat-containing prote...    54   3e-06
UniRef50_UPI0000F31773 Cluster: UPI0000F31773 related cluster; n...    52   2e-05
UniRef50_Q9QUK4 Cluster: Baculoviral IAP repeat-containing prote...    52   2e-05
UniRef50_UPI00015B4481 Cluster: PREDICTED: hypothetical protein;...    51   4e-05
UniRef50_Q6R7D0 Cluster: ORF99; n=1; Ostreid herpesvirus 1|Rep: ...    51   4e-05
UniRef50_Q91ET9 Cluster: ORF116 IAP-5; n=5; Granulovirus|Rep: OR...    50   5e-05
UniRef50_Q8MVN1 Cluster: Inhibitor of apoptosis protein-like pro...    49   1e-04
UniRef50_A7T0Y6 Cluster: Predicted protein; n=1; Nematostella ve...    49   1e-04
UniRef50_Q7T9R6 Cluster: Iap-5; n=1; Adoxophyes orana granulovir...    48   2e-04
UniRef50_Q14B43 Cluster: Birc1f protein; n=1; Mus musculus|Rep: ...    48   2e-04
UniRef50_A7SKK5 Cluster: Predicted protein; n=1; Nematostella ve...    48   2e-04
UniRef50_Q6QXG6 Cluster: ORF106; n=1; Agrotis segetum granulovir...    48   3e-04
UniRef50_Q6R7C4 Cluster: ORF106; n=1; Ostreid herpesvirus 1|Rep:...    47   5e-04
UniRef50_P47732 Cluster: Zinc finger protein; n=1; Invertebrate ...    47   5e-04
UniRef50_Q6CGG1 Cluster: Similar to sp|O14064 Schizosaccharomyce...    47   6e-04
UniRef50_Q9VEM2 Cluster: CG12265-PA; n=2; Sophophora|Rep: CG1226...    46   8e-04
UniRef50_Q16GV8 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q7PQW0 Cluster: ENSANGP00000002826; n=2; Coelomata|Rep:...    44   0.003
UniRef50_A0NCK8 Cluster: ENSANGP00000030040; n=1; Anopheles gamb...    43   0.008
UniRef50_UPI00006A201E Cluster: UPI00006A201E related cluster; n...    43   0.010
UniRef50_Q9YMI9 Cluster: Apoptosis inhibitor; n=1; Lymantria dis...    43   0.010
UniRef50_Q5MAF5 Cluster: Inhibitor of apoptosis protein; n=2; Sc...    41   0.032
UniRef50_UPI00015B625E Cluster: PREDICTED: similar to survivin; ...    41   0.042
UniRef50_Q7Q4I9 Cluster: ENSANGP00000019173; n=1; Anopheles gamb...    40   0.055
UniRef50_Q9VH01 Cluster: CG6303-PA; n=11; Coelomata|Rep: CG6303-...    40   0.073
UniRef50_Q29AL2 Cluster: GA19502-PA; n=1; Drosophila pseudoobscu...    40   0.073
UniRef50_Q55KX6 Cluster: Putative uncharacterized protein; n=2; ...    40   0.073
UniRef50_Q9NR09 Cluster: Baculoviral IAP repeat-containing prote...    40   0.073
UniRef50_UPI00015B4272 Cluster: PREDICTED: similar to survivin; ...    39   0.13 
UniRef50_A5DCT0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.39 
UniRef50_UPI00003C0A18 Cluster: PREDICTED: similar to baculovira...    37   0.68 
UniRef50_UPI00006A1E85 Cluster: UPI00006A1E85 related cluster; n...    37   0.68 
UniRef50_Q16LW5 Cluster: Putative uncharacterized protein; n=1; ...    36   0.90 
UniRef50_Q59QN1 Cluster: Putative uncharacterized protein; n=2; ...    36   0.90 
UniRef50_Q90WU9 Cluster: Survivin 1; n=3; Danio rerio|Rep: Survi...    36   1.2  
UniRef50_A7SUG7 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.6  
UniRef50_Q0UPJ0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.6  
UniRef50_P47134 Cluster: Protein BIR1; n=2; Saccharomyces cerevi...    36   1.6  
UniRef50_UPI000023D1AD Cluster: hypothetical protein FG05233.1; ...    35   2.1  
UniRef50_Q4R1J6 Cluster: XSurvivin1B; n=12; Euteleostomi|Rep: XS...    35   2.8  
UniRef50_Q4FZ23 Cluster: Phosphoglycan beta 1,2 arabinosyltransf...    35   2.8  
UniRef50_Q9ZFB5 Cluster: Spore germination protein XB; n=5; Baci...    35   2.8  
UniRef50_Q6R7E2 Cluster: ORF87; n=1; Ostreid herpesvirus 1|Rep: ...    34   4.8  
UniRef50_Q3YJT9 Cluster: Thrombospondin domain-containing protei...    34   4.8  
UniRef50_Q2H209 Cluster: Putative uncharacterized protein; n=1; ...    34   4.8  
UniRef50_Q8X0N9 Cluster: Related to nitrate assimilation regulat...    33   6.4  
UniRef50_Q9DSW8 Cluster: Putative inhibitor apoptosis protein-3;...    33   8.4  
UniRef50_Q8QLC4 Cluster: Inhibitor of apoptosis-2 IAP-2; n=2; Nu...    33   8.4  
UniRef50_O14064 Cluster: Protein bir1; n=3; Schizosaccharomyces ...    33   8.4  

>UniRef50_P41435 Cluster: Apoptosis inhibitor 1; n=13;
           Nucleopolyhedrovirus|Rep: Apoptosis inhibitor 1 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 286

 Score =  190 bits (462), Expect = 5e-47
 Identities = 91/114 (79%), Positives = 95/114 (83%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAE ESFGDNITINAV
Sbjct: 55  FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAERESFGDNITINAV 114

Query: 435 LVKEGRPKCVYRCMSNLQSRMDTFVIFGLPHCVT*LRTLRKRDFFTRVAETKLY 596
           LVKEG+PKCVYRCMSNLQSRMDTFV F  P  +        RD  T +AE  L+
Sbjct: 115 LVKEGKPKCVYRCMSNLQSRMDTFVNF-WPAAL--------RDMITNIAEAGLF 159



 Score =  189 bits (461), Expect = 6e-47
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWH NED WQRHA ENPQCYFV
Sbjct: 140 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHTNEDTWQRHAAENPQCYFV 199

Query: 689 LSVKGKEFCQNAITATHVDKRDDD 760
           LSVKGKEFCQN+IT THVDKRDDD
Sbjct: 200 LSVKGKEFCQNSITVTHVDKRDDD 223



 Score =  103 bits (248), Expect = 4e-21
 Identities = 46/54 (85%), Positives = 48/54 (88%)
 Frame = +1

Query: 94  MNEDTPPFYFINTRDNFRDNIAEHVFDMLLERHGSFENYPIVNTALINSLIVNG 255
           MNEDTPPFYFI+  DNFRDN AEHVFDML+ERH SFENYPI NTA INSLIVNG
Sbjct: 1   MNEDTPPFYFISVCDNFRDNTAEHVFDMLIERHSSFENYPIENTAFINSLIVNG 54



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 18/76 (23%), Positives = 32/76 (42%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +P      I ++   G  Y    D  VC +C+  +++W  +E     H T +P C +   
Sbjct: 39  YPIENTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 98

Query: 695 VKGKEFCQNAITATHV 742
           +  +E   + IT   V
Sbjct: 99  IAERESFGDNITINAV 114



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 14/58 (24%), Positives = 26/58 (44%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           Y    D  VC +C+  +++W  +E     H   +P C +   +   E   ++IT+  V
Sbjct: 160 YTGRGDETVCFFCDCCVRDWHTNEDTWQRHAAENPQCYFVLSVKGKEFCQNSITVTHV 217


>UniRef50_UPI0000DB79F2 Cluster: PREDICTED: similar to thread
           CG12284-PA, isoform A; n=2; Apis mellifera|Rep:
           PREDICTED: similar to thread CG12284-PA, isoform A -
           Apis mellifera
          Length = 536

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 31/83 (37%), Positives = 54/83 (65%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP ++      +A+AG +YTG+GD+T+C+ C C ++DW   ++ W++HA    +CY++L+
Sbjct: 200 WPKSMPQTKEQLADAGFYYTGKGDQTICYHCGCGLKDWEPEDNPWEQHAKWFSKCYYLLT 259

Query: 695 VKGKEFCQNAITATHVDKRDDDE 763
           VKG+++  N IT  HV     +E
Sbjct: 260 VKGQDYV-NKITGQHVSPPSKEE 281



 Score = 37.9 bits (84), Expect = 0.30
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +  +    +A AG +YTG GD+  CF C   +  W   +     H   + +C F+  
Sbjct: 57  WPVSYIEP-EKLAAAGFYYTGEGDKVRCFECQVEICQWVEGDIPMVDHQRWSARCRFIRK 115

Query: 695 V 697
           +
Sbjct: 116 I 116


>UniRef50_P41437 Cluster: Apoptosis inhibitor 3; n=2;
           Nucleopolyhedrovirus|Rep: Apoptosis inhibitor 3 - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 268

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 36/83 (43%), Positives = 52/83 (62%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +AEAG FYTG+GD+T CF CD  ++DW  ++  WQ+HA    +C +VL 
Sbjct: 121 WPRGLKQRPEELAEAGFFYTGQGDKTRCFCCDGGLKDWEPDDAPWQQHARWYDRCEYVLL 180

Query: 695 VKGKEFCQNAITATHVDKRDDDE 763
           VKG++F Q  +T   V +  D+E
Sbjct: 181 VKGRDFVQRVMTEACVVRDADNE 203



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP    +  + +A +G +Y GRGDE  C FC   + +W   +D    H    PQC FV
Sbjct: 28  WPVQFLEP-SRMAASGFYYLGRGDEVRCAFCKVEITNWVRGDDPETDHKRWAPQCPFV 84


>UniRef50_Q0IL79 Cluster: Iap3; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: Iap3 - Leucania separata nuclear
           polyhedrosis virus (LsNPV)
          Length = 248

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 31/84 (36%), Positives = 52/84 (61%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP +++     +AEAG +Y+G GD+  CFFC   ++DW   +D W +HA    +C +VL
Sbjct: 98  YWPKSMKQTPQQLAEAGFYYSGTGDQVKCFFCGGGLKDWEPADDPWAQHARWFDRCAYVL 157

Query: 692 SVKGKEFCQNAITATHVDKRDDDE 763
           +VKG ++ Q  I +  V+ + D+E
Sbjct: 158 TVKGADYVQR-IASESVEHKQDEE 180



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +2

Query: 566 FY-TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           FY TG GDE  C  C   +  W   E A+++H    P C +V
Sbjct: 29  FYSTGNGDEVRCHVCSLEINKWQPGESAFEKHFKCAPFCRWV 70


>UniRef50_Q7T9S6 Cluster: Iap-3; n=1; Adoxophyes orana
           granulovirus|Rep: Iap-3 - Adoxophyes orana granulovirus
           (AoGV)
          Length = 254

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 32/82 (39%), Positives = 46/82 (56%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP AL+     +AEAG FYT  GD   CF+CD  ++DW   + AW +HA     C +VL 
Sbjct: 107 WPKALKQTPKELAEAGFFYTNVGDRVRCFYCDVGLKDWEPTDTAWGQHARWTSLCEYVLL 166

Query: 695 VKGKEFCQNAITATHVDKRDDD 760
           VKG ++ Q  +T   + K + +
Sbjct: 167 VKGTDYVQKVLTEACMIKEEKE 188



 Score = 40.3 bits (90), Expect = 0.055
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +2

Query: 560 GLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           G +YTG  D T C +C+  +  W  ++D ++ H   +P C  ++S
Sbjct: 38  GFYYTGNQDTTKCPYCNLEIEKWEADDDPFEEHFKFSPLCPLLMS 82



 Score = 35.5 bits (78), Expect = 1.6
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 1/69 (1%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           F Y  V D V C YC+  +K+W   +     H   +  C Y   + +   +   +   A 
Sbjct: 123 FFYTNVGDRVRCFYCDVGLKDWEPTDTAWGQHARWTSLCEYV-LLVKGTDYVQKVLTEAC 181

Query: 435 LVKEGR-PK 458
           ++KE + PK
Sbjct: 182 MIKEEKEPK 190



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 17/51 (33%), Positives = 20/51 (39%)
 Frame = +3

Query: 219 KHGVNQQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           K   + QL    F Y    D   C YC  EI+ W  D+     H   SP C
Sbjct: 27  KSPASHQLSICGFYYTGNQDTTKCPYCNLEIEKWEADDDPFEEHFKFSPLC 77


>UniRef50_UPI00015A57A9 Cluster: UPI00015A57A9 related cluster; n=1;
           Danio rerio|Rep: UPI00015A57A9 UniRef100 entry - Danio
           rerio
          Length = 456

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 30/69 (43%), Positives = 40/69 (57%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG FYTG GD   CFFCD  +R+W   +D WQ HA   PQC ++L 
Sbjct: 106 WPTGAAVQPDTLARAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQCEYLLQ 165

Query: 695 VKGKEFCQN 721
            +G+E+ +N
Sbjct: 166 SRGQEYVRN 174



 Score = 37.9 bits (84), Expect = 0.30
 Identities = 17/55 (30%), Positives = 22/55 (40%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP+        +A AG  Y G GD   CF C+  +R W   +     H    P C
Sbjct: 15  WPSDAAVSPEELARAGFHYLGYGDTVQCFCCEGILRHWVDGDTPRGEHERHFPTC 69


>UniRef50_A5PLG7 Cluster: Zgc:165605 protein; n=4; Euteleostomi|Rep:
           Zgc:165605 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 309

 Score = 76.6 bits (180), Expect = 7e-13
 Identities = 30/69 (43%), Positives = 40/69 (57%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG FYTG GD   CFFCD  +R+W   +D WQ HA   PQC ++L 
Sbjct: 149 WPTGAAVQPDTLARAGFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQCEYLLQ 208

Query: 695 VKGKEFCQN 721
            +G+E+ +N
Sbjct: 209 SRGQEYVRN 217



 Score = 39.5 bits (88), Expect = 0.097
 Identities = 23/86 (26%), Positives = 35/86 (40%)
 Frame = +2

Query: 422 HQRCTSKRRQTQVCVQMHVQFTVAYGYVCNFWPAALRDMITNIAEAGLFYTGRGDETVCF 601
           H+R  S R + +V + M  +      +  + WP+        +A AG  Y G GD   CF
Sbjct: 7   HERQRSARMEAEVRLGMRSEEERLQTF--HNWPSDAAVSPEELARAGFHYLGYGDTVQCF 64

Query: 602 FCDCCVRDWHINEDAWQRHATENPQC 679
            C+  +R W   +     H    P C
Sbjct: 65  CCEGILRHWVDGDTPRGEHERHFPTC 90


>UniRef50_Q80LK8 Cluster: Inhibitor of apoptosis protein 3; n=1;
           Adoxophyes honmai NPV|Rep: Inhibitor of apoptosis
           protein 3 - Adoxophyes honmai nucleopolyhedrovirus
          Length = 283

 Score = 76.2 bits (179), Expect = 9e-13
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  +      +AEAG FYTG GD+T CF+C   V +W +N+D W++HA     C +V  
Sbjct: 121 WPPLMPIKPEQLAEAGFFYTGFGDKTKCFYCAGGVWNWELNDDPWEQHAIWFGNCTYVKI 180

Query: 695 VKGKEFCQNAITATHVDKRDD 757
           +KG+ F Q  IT + + K ++
Sbjct: 181 IKGQNFIQKVITESRLIKENN 201


>UniRef50_Q9J827 Cluster: ORF110 iap-3; n=1; Spodoptera exigua
           MNPV|Rep: ORF110 iap-3 - Spodoptera exigua MNPV
          Length = 313

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 31/78 (39%), Positives = 47/78 (60%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  +     ++A AG FYTGR  E  CF  DC + DW   ++ W+ HA   P+C +V++
Sbjct: 166 WPRDIYQRPHDLASAGFFYTGRNAEVRCFQSDCGLSDWEPTDEPWREHARWFPRCEYVIA 225

Query: 695 VKGKEFCQNAITATHVDK 748
           VKGKE+ Q++++   V K
Sbjct: 226 VKGKEYVQDSVSMACVIK 243



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 29/61 (47%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP   +     +A +G +Y GRGDE  C FC   + +W   +D    H    PQC F  +
Sbjct: 41  WPVWAKASPFYLALSGFYYIGRGDEVRCAFCKVEIMNWREGDDPIVDHNRWAPQCKFAQN 100

Query: 695 V 697
           V
Sbjct: 101 V 101



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 15/45 (33%), Positives = 21/45 (46%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           F Y    D V C +C+ EI NW E +     H   +P C +A  +
Sbjct: 57  FYYIGRGDEVRCAFCKVEIMNWREGDDPIVDHNRWAPQCKFAQNV 101


>UniRef50_Q9E232 Cluster: Iap; n=3; Nucleopolyhedrovirus|Rep: Iap -
           Helicoverpa zea SNPV
          Length = 268

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 33/78 (42%), Positives = 45/78 (57%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L  + + +AEAG  YTG+ D T+CF C   + +W +  + W+ HA     C FVLS
Sbjct: 127 WPQTLIILKSKLAEAGWVYTGKDDITICFHCGGKLSNWTLTHEPWREHARWYRNCDFVLS 186

Query: 695 VKGKEFCQNAITATHVDK 748
            KGK+F Q  IT   V+K
Sbjct: 187 EKGKDFVQTVITEACVEK 204



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +2

Query: 485 TVAYGYVCNF-WPAALRDM-ITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH 658
           T +Y YV    WP     M    +A+AG +Y  + D   C FC   + +W   +D  + H
Sbjct: 14  TESYRYVTFANWPVQYYFMDCAKMAQAGFYYLNKDDHVKCAFCKVEMMNWQHEDDPLEEH 73

Query: 659 ATENPQCYFVLSV 697
           A   PQC +V S+
Sbjct: 74  ARWAPQCSYVKSI 86



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWS-EDECIEYAHVTLSPYCAYANKI 389
           F Y   DDHV C +C+ E+ NW  ED+ +E  H   +P C+Y   I
Sbjct: 42  FYYLNKDDHVKCAFCKVEMMNWQHEDDPLE-EHARWAPQCSYVKSI 86


>UniRef50_Q4KT41 Cluster: IAP-3; n=2; Nucleopolyhedrovirus|Rep:
           IAP-3 - Chrysodeixis chalcites nucleopolyhedrovirus
          Length = 278

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 33/76 (43%), Positives = 45/76 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP    D I ++AEAG FYTG GD+  CF+  C + DW  +   WQ+HA   P C +VL 
Sbjct: 118 WPRNRTDYI-DLAEAGFFYTGIGDKVKCFYDGCTLSDWSCDRVPWQQHARWYPDCRYVLF 176

Query: 695 VKGKEFCQNAITATHV 742
           VKG ++ Q  I+ + V
Sbjct: 177 VKGPDYVQQVISESCV 192



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 17/53 (32%), Positives = 25/53 (47%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGK 706
           +A  G +Y G GD+  C +C   +  W  N+   + H    PQC FV  +  K
Sbjct: 33  LAMNGFYYLGSGDQVRCAYCKVEICKWQQNDVVDRDHKKYAPQCPFVKKLDAK 85



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           F Y    D V C YC+ EI  W +++ ++  H   +P C +  K+
Sbjct: 38  FYYLGSGDQVRCAYCKVEICKWQQNDVVDRDHKKYAPQCPFVKKL 82


>UniRef50_Q1A4L2 Cluster: IAP-3; n=3; Baculoviridae|Rep: IAP-3 -
           Choristoneura occidentalis granulovirus
          Length = 283

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 30/78 (38%), Positives = 46/78 (58%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WPA++      +AEAG +YT +GD T C++CD  ++DW   +  W++HA    +C FV  
Sbjct: 136 WPASMTQKPLELAEAGFYYTNKGDRTKCYYCDNGLKDWEPEDVPWEQHARWFDKCEFVKI 195

Query: 695 VKGKEFCQNAITATHVDK 748
           VKG ++ Q  I+   V K
Sbjct: 196 VKGDQYVQKVISEACVIK 213



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           ++++ G +Y  RGDE  C FC+     W  N+D  + H    P+C FV+
Sbjct: 62  DLSKNGFYYLNRGDEVRCAFCNVEFMKWEDNDDPAEFHKKWAPRCPFVI 110


>UniRef50_Q7T5S1 Cluster: Iap-3; n=1; Cryptophlebia leucotreta
           granulovirus|Rep: Iap-3 - Cryptophlebia leucotreta
           granulosis virus (ClGV) (Cryptophlebialeucotreta
           granulovirus)
          Length = 255

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 28/68 (41%), Positives = 42/68 (61%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP ++     ++A+AG FYTG+GD  +C++CD  +  W  +ED W+ HA     C F+  
Sbjct: 107 WPFSMTQKADDMAQAGFFYTGKGDRVICYYCDGKLSMWERDEDPWEEHARWYGSCAFLKL 166

Query: 695 VKGKEFCQ 718
           VKG+EF Q
Sbjct: 167 VKGEEFIQ 174



 Score = 40.7 bits (91), Expect = 0.042
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +A+ G +Y GR DE  C FC   +  W  ++D    H   +PQC
Sbjct: 24  LAKNGFYYLGRSDEVRCAFCKVEIMRWKEDDDPETEHRKWSPQC 67



 Score = 37.1 bits (82), Expect = 0.52
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCA 374
           Q L +  F Y    D V C +C+ EI  W ED+  E  H   SP C+
Sbjct: 22  QLLAKNGFYYLGRSDEVRCAFCKVEIMRWKEDDDPETEHRKWSPQCS 68



 Score = 35.5 bits (78), Expect = 1.6
 Identities = 18/64 (28%), Positives = 28/64 (43%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           F Y    D V+C YC+ ++  W  DE     H      CA+  K+ + E F   I     
Sbjct: 123 FFYTGKGDRVICYYCDGKLSMWERDEDPWEEHARWYGSCAFL-KLVKGEEFIQKIHSERC 181

Query: 435 LVKE 446
           ++K+
Sbjct: 182 MLKD 185


>UniRef50_P41436 Cluster: Apoptosis inhibitor IAP; n=12; root|Rep:
           Apoptosis inhibitor IAP - Cydia pomonella granulosis
           virus (CpGV) (Cydia pomonellagranulovirus)
          Length = 275

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 28/72 (38%), Positives = 43/72 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  ++     +A+AG FYTG GD T CF+CD  ++DW   +  W++H     +C +V  
Sbjct: 118 WPRCMKQRPEQMADAGFFYTGYGDNTKCFYCDGGLKDWEPEDVPWEQHVRWFDRCAYVQL 177

Query: 695 VKGKEFCQNAIT 730
           VKG+++ Q  IT
Sbjct: 178 VKGRDYVQKVIT 189



 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 26/76 (34%), Positives = 36/76 (47%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     T +A+ G +Y GR DE  C FC   +  W   ED    H    PQC F   
Sbjct: 17  WPVSFLSPET-MAKNGFYYLGRSDEVRCAFCKVEIMRWKEGEDPAADHKKWAPQCPF--- 72

Query: 695 VKGKEFCQNAITATHV 742
           VKG + C + +T  ++
Sbjct: 73  VKGIDVCGSIVTTNNI 88



 Score = 33.5 bits (73), Expect = 6.4
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           F Y    D+  C YC+  +K+W  ++     HV     CAY   +   +     IT   V
Sbjct: 134 FFYTGYGDNTKCFYCDGGLKDWEPEDVPWEQHVRWFDRCAYVQLVKGRDYVQKVITEACV 193

Query: 435 LVKE 446
           L  E
Sbjct: 194 LPGE 197


>UniRef50_Q9EN27 Cluster: AMV021; n=1; Amsacta moorei entomopoxvirus
           'L'|Rep: AMV021 - Amsacta moorei entomopoxvirus (AmEPV)
          Length = 264

 Score = 72.9 bits (171), Expect = 8e-12
 Identities = 31/83 (37%), Positives = 46/83 (55%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP ++      +AEAG FYTG+ D+  CF+CD  +  W  ++D W +HA    +C +V  
Sbjct: 117 WPISMPISTEKLAEAGFFYTGKSDKVKCFYCDGGLNKWETDDDPWIQHARWFDKCDYVKL 176

Query: 695 VKGKEFCQNAITATHVDKRDDDE 763
           VKGK+F Q  +T +   K    E
Sbjct: 177 VKGKDFIQKVMTQSTFIKSSKKE 199



 Score = 40.7 bits (91), Expect = 0.042
 Identities = 24/84 (28%), Positives = 38/84 (45%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           F Y   +D V C YC  +I  W E +  E  H   SP C++       +  G+N  I+ +
Sbjct: 35  FYYIGENDTVKCVYCGVQINKWVEGDKPEIDHKKFSPNCSFLKSNDGIDECGNNKNISNI 94

Query: 435 LVKEGRPKCVYRCMSNLQSRMDTF 506
             K      V+  +SN+  R+ T+
Sbjct: 95  TQK----GAVHPNLSNIVERLKTY 114



 Score = 36.3 bits (80), Expect = 0.90
 Identities = 16/69 (23%), Positives = 29/69 (42%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNA 724
           + A  G +Y G  D   C +C   +  W   +     H   +P C F+ S  G + C N 
Sbjct: 29  SFASNGFYYIGENDTVKCVYCGVQINKWVEGDKPEIDHKKFSPNCSFLKSNDGIDECGNN 88

Query: 725 ITATHVDKR 751
              +++ ++
Sbjct: 89  KNISNITQK 97


>UniRef50_Q91EW1 Cluster: ORF94 IAP; n=1; Cydia pomonella
           granulovirus|Rep: ORF94 IAP - Cydia pomonella granulosis
           virus (CpGV) (Cydia pomonellagranulovirus)
          Length = 243

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 29/74 (39%), Positives = 40/74 (54%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L      + EAGL Y+GRGD+  CF C   + DW + +D W+RH   N  C FV+ 
Sbjct: 91  WPVGLGQSKEEMVEAGLCYSGRGDQVECFCCGESICDWRVGDDPWRRHIEANMGCQFVVM 150

Query: 695 VKGKEFCQNAITAT 736
            K  EF ++ +  T
Sbjct: 151 KKSDEFIKSVVNET 164


>UniRef50_Q4T660 Cluster: Chromosome undetermined SCAF8908, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF8908, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 27/69 (39%), Positives = 39/69 (56%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG FYTG GD   C++CD  +R+W   +D WQ HA   P+C F++ 
Sbjct: 161 WPTEASVQPDVLARAGFFYTGHGDNVKCYYCDGGLRNWEPGDDPWQEHAKWFPRCEFLIQ 220

Query: 695 VKGKEFCQN 721
            +G+E+  N
Sbjct: 221 TRGQEYISN 229



 Score = 42.3 bits (95), Expect = 0.014
 Identities = 19/59 (32%), Positives = 26/59 (44%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WPA       ++A+AG F+ G  D   CF C   +R W   +     H    P C F+L
Sbjct: 46  WPADAAVAPADLAKAGFFFLGPRDAVQCFCCGGILRCWVQGDSPGDEHRRHFPTCCFIL 104


>UniRef50_Q8JRX3 Cluster: Inhibitor of apoptosis 1; n=1; Phthorimaea
           operculella granulovirus|Rep: Inhibitor of apoptosis 1 -
           Phthorimaea operculella granulovirus
          Length = 245

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 31/82 (37%), Positives = 47/82 (57%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +A+AGL+YTG GD  +CF C   + +W  +ED W +HA E  +C  ++ 
Sbjct: 80  WPVGLKQKPAELADAGLYYTGCGDRCLCFACGVELENWLPDEDVWTKHALETDKCTHIIL 139

Query: 695 VKGKEFCQNAITATHVDKRDDD 760
            KG EF ++      V K+DD+
Sbjct: 140 SKGDEFVKS------VKKQDDE 155


>UniRef50_Q287F3 Cluster: IAP-3; n=1; Agrotis segetum
           nucleopolyhedrovirus|Rep: IAP-3 - Agrotis segetum
           nuclear polyhedrosis virus (AsNPV)
          Length = 271

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 28/74 (37%), Positives = 41/74 (55%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           N WP AL      +A AG +YTG GD  +CF+ DC + +W+  +D W+ HA    +C +V
Sbjct: 113 NKWPRALTQTPHQLASAGFYYTGIGDAVLCFYNDCRLSEWNAGDDPWREHARWFAECPYV 172

Query: 689 LSVKGKEFCQNAIT 730
              KG ++ Q   T
Sbjct: 173 RKFKGLDYIQKIAT 186



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 22/65 (33%), Positives = 30/65 (46%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WPA+       +A AG +Y  RGDE  C FC   +  W   +D    H    P C +V  
Sbjct: 14  WPASNHVSPQKLAAAGFYYLNRGDEVRCAFCKVEIMRWRPGDDPLADHKRWAPHCKYVCQ 73

Query: 695 VKGKE 709
           + G+E
Sbjct: 74  IDGEE 78


>UniRef50_Q7QJ55 Cluster: ENSANGP00000009540; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000009540 - Anopheles gambiae
           str. PEST
          Length = 297

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 26/68 (38%), Positives = 40/68 (58%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +L+     +++AG FYTG  D   CF C   ++DW   +D WQ+HA     C+++  
Sbjct: 133 WPTSLKQKPQQLSDAGFFYTGMSDRVKCFSCGGGLKDWEQEDDPWQQHAIWYSNCHYLQL 192

Query: 695 VKGKEFCQ 718
           +KG+EF Q
Sbjct: 193 MKGREFIQ 200



 Score = 37.9 bits (84), Expect = 0.30
 Identities = 18/49 (36%), Positives = 22/49 (44%)
 Frame = +3

Query: 240 LDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 386
           L R  F Y   DD V C +C  EI  W   + +   H+  SPYC    K
Sbjct: 30  LARYGFYYVGTDDTVKCYFCRVEIGLWEPQDDVIQEHLRWSPYCPLLKK 78



 Score = 36.7 bits (81), Expect = 0.68
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +A  G +Y G  D   C+FC   +  W   +D  Q H   +P C
Sbjct: 30  LARYGFYYVGTDDTVKCYFCRVEIGLWEPQDDVIQEHLRWSPYC 73


>UniRef50_UPI00015B5932 Cluster: PREDICTED: similar to inhibitor of
           apoptosis 2 protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to inhibitor of apoptosis 2 protein -
           Nasonia vitripennis
          Length = 602

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 28/71 (39%), Positives = 43/71 (60%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+ LR     +A+AG +Y G  D+  CF CD  +R+W   +DAW  HA   P+C +V  
Sbjct: 261 WPSNLRQTPEMLADAGFYYVGAQDQVRCFHCDGGLRNWEETDDAWIEHARWFPKCGYVAL 320

Query: 695 VKGKEFCQNAI 727
           V+G++F ++ I
Sbjct: 321 VRGQDFIKHCI 331



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 23/59 (38%), Positives = 29/59 (49%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WPA        IA+AG +YTG      CF C   V +W+  + A   H   NP+C FVL
Sbjct: 27  WPANCPVSTARIAKAGFYYTGTAQIAQCFLCGTRVSEWNFGDQAMALHRIANPECPFVL 85



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 14/59 (23%), Positives = 23/59 (38%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A +G +Y  + D   C +C   +  W   +D  + H    P C F +
Sbjct: 146 WPIPAIVSPERLARSGFYYLQQADMVECAYCQGVILKWEPGDDPDREHRIHFPNCDFYM 204



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 13/41 (31%), Positives = 18/41 (43%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           F Y    D V C +C+  ++NW E +     H    P C Y
Sbjct: 277 FYYVGAQDQVRCFHCDGGLRNWEETDDAWIEHARWFPKCGY 317


>UniRef50_Q6QXJ6 Cluster: ORF53; n=1; Agrotis segetum
           granulovirus|Rep: ORF53 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 269

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 26/72 (36%), Positives = 41/72 (56%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP ++      +A AG +YTG  D+  CF+C   +RDW   +D WQ+HA    +C F++ 
Sbjct: 124 WPVSIPLRPKELAAAGFYYTGHSDQVNCFYCGGGLRDWKTGDDPWQQHARWFDKCLFLIG 183

Query: 695 VKGKEFCQNAIT 730
            KG ++ Q  +T
Sbjct: 184 KKGTDYIQKVMT 195


>UniRef50_Q7T5K8 Cluster: Iap; n=1; Cryptophlebia leucotreta
           granulovirus|Rep: Iap - Cryptophlebia leucotreta
           granulosis virus (ClGV) (Cryptophlebialeucotreta
           granulovirus)
          Length = 224

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+    ++ +AG +Y+G GD   CF+C   + DW   ++AW+RH   N +C +VL 
Sbjct: 76  WPLGLKQTKDDMVDAGFYYSGYGDRVECFYCGVILCDWWPEDEAWRRHIKANSECAYVLM 135

Query: 695 VKGKEFCQNAITATHVDKRD 754
            K  +F  + +    ++K +
Sbjct: 136 RKKDDFIDDILKDKEINKEE 155


>UniRef50_Q13490 Cluster: Baculoviral IAP repeat-containing protein
           2; n=58; Tetrapoda|Rep: Baculoviral IAP
           repeat-containing protein 2 - Homo sapiens (Human)
          Length = 618

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           +WP+++      +A AG +Y GR D+  CF CD  +R W   +D W  HA   P+C F++
Sbjct: 278 YWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLI 337

Query: 692 SVKGKEF 712
            +KG+EF
Sbjct: 338 RMKGQEF 344



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +PA +     ++A AG +YTG  D+  CF C   + +W + +   Q+H    P C F+
Sbjct: 56  FPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFI 113



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + WP       + +A AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 192 HMWPLTFLSP-SELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL 250


>UniRef50_UPI00015B5930 Cluster: PREDICTED: similar to inhibitor of
           apoptosis 1 protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to inhibitor of apoptosis 1 protein -
           Nasonia vitripennis
          Length = 361

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +2

Query: 509 NFWPAA-LRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           N WP+  +      +A+AG FYTG GD+T C+ C   +++W   +D W +HA     C++
Sbjct: 191 NDWPSTRVSQTKEQLADAGFFYTGTGDQTTCYHCGGGLKNWEPKDDPWVQHAKWFSTCFY 250

Query: 686 VLSVKGKEFCQNAITATHVDKRDDDE 763
           V  VKG+EF  N +   H     +++
Sbjct: 251 VRLVKGQEFINN-VNGKHATPLSEED 275


>UniRef50_UPI000051A5A0 Cluster: PREDICTED: similar to Inhibitor of
           apoptosis 2 CG8293-PA, isoform A; n=1; Apis
           mellifera|Rep: PREDICTED: similar to Inhibitor of
           apoptosis 2 CG8293-PA, isoform A - Apis mellifera
          Length = 518

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 29/73 (39%), Positives = 40/73 (54%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           N WP  ++     +A AG +Y G  D   CF CD  +R+W   +DAW  HA   P+C FV
Sbjct: 241 NGWPENIKQTPEILASAGFYYDGYSDHVRCFHCDGGLRNWETTDDAWIEHAKWFPKCEFV 300

Query: 689 LSVKGKEFCQNAI 727
             V+G+EF +  I
Sbjct: 301 NLVRGQEFIKQCI 313



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 23/58 (39%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WPA        IA+AG +Y+G G E  CF C   + DW+  + A  RH    P C FV
Sbjct: 14  WPANAAVDAVRIAKAGFYYSGHGLEVQCFLCGVKISDWNYGDQAIVRHRLAEPNCSFV 71



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           WP +   +  N+A+AG +Y  R DE  C +C   ++ W + +D  ++H    P C F
Sbjct: 133 WPLSSVILPENLAKAGFYYLQRDDEVQCIYCGGILKKWELGDDPNKKHRKYFPDCNF 189



 Score = 36.7 bits (81), Expect = 0.68
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHE 401
           F Y+   DHV C +C+  ++NW   +     H    P C + N +   E
Sbjct: 259 FYYDGYSDHVRCFHCDGGLRNWETTDDAWIEHAKWFPKCEFVNLVRGQE 307


>UniRef50_Q6JKE3 Cluster: Inhibitor of apoptosis; n=1; Neodiprion
           sertifer NPV|Rep: Inhibitor of apoptosis - Neodiprion
           sertifer NPV
          Length = 181

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 28/78 (35%), Positives = 39/78 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +L      +AEAG +YTG  D T C+ C   ++DW   ED W++H   +P CY V  
Sbjct: 28  WPVSLSQSPRELAEAGFYYTGFNDTTKCYECGVTLKDWMPEEDIWEQHVKWSPNCYHVQK 87

Query: 695 VKGKEFCQNAITATHVDK 748
            KG  F  + +      K
Sbjct: 88  SKGFLFINHCLNVLQEKK 105



 Score = 33.5 bits (73), Expect = 6.4
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 386
           F Y   +D   C  C   +K+W  +E I   HV  SP C +  K
Sbjct: 44  FYYTGFNDTTKCYECGVTLKDWMPEEDIWEQHVKWSPNCYHVQK 87


>UniRef50_Q9YVJ4 Cluster: ORF MSV248 putative inhibitor of apoptosis
           protein (IAP), similar to Orgyia pseudotsugata NPV
           GB:U75930; n=1; Melanoplus sanguinipes
           entomopoxvirus|Rep: ORF MSV248 putative inhibitor of
           apoptosis protein (IAP), similar to Orgyia pseudotsugata
           NPV GB:U75930 - Melanoplus sanguinipes entomopoxvirus
           (MsEPV)
          Length = 150

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 29/75 (38%), Positives = 40/75 (53%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +L   I  + EAG FYT  GD TVCF C   +++W    D W  H+  +P C +++ 
Sbjct: 26  WPISLFFKINRLCEAGFFYTNIGDITVCFNCGLKIKNWLYYNDPWIEHSKWSPNCNYIIF 85

Query: 695 VKGKEFCQNAITATH 739
            KGK+F   A    H
Sbjct: 86  NKGKKFINFAKNFKH 100


>UniRef50_Q24306 Cluster: Apoptosis 1 inhibitor; n=3;
           Sophophora|Rep: Apoptosis 1 inhibitor - Drosophila
           melanogaster (Fruit fly)
          Length = 438

 Score = 66.1 bits (154), Expect = 1e-09
 Identities = 28/64 (43%), Positives = 38/64 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +AEAG FYTG GD   CF C   + DW+ N++ W++HA    QC FV  
Sbjct: 236 WPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKL 295

Query: 695 VKGK 706
           +KG+
Sbjct: 296 MKGQ 299



 Score = 38.7 bits (86), Expect = 0.17
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP    D    +A+ G+++T  GD+  CFFC   +  W   +     H   +P C
Sbjct: 54  WPLDWLDK-RQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNC 107


>UniRef50_Q6ZM93 Cluster: Baculoviral IAP repeat-containing 3; n=8;
           Clupeocephala|Rep: Baculoviral IAP repeat-containing 3 -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 654

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+ +      +A+AG +Y GR D+  CF CD  +R W   +D W  HA   P+C ++L 
Sbjct: 315 WPSRIPVRPDQLAKAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLQ 374

Query: 695 VKGKEF 712
            KG+EF
Sbjct: 375 EKGQEF 380



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSV 697
           ++A AG +YTG GD   CF C+    +W   +   +RH   +P C F+ S+
Sbjct: 75  SLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQLSPNCSFIQSL 125



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A+AGL+Y G+GD   CF C   +  W   + A   H    P C FV
Sbjct: 233 LAKAGLYYLGQGDRVACFSCGGQLGSWEPGDRAVSEHQRHYPNCRFV 279



 Score = 36.7 bits (81), Expect = 0.68
 Identities = 16/52 (30%), Positives = 22/52 (42%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           + L R  F Y  + D V C  C     NW   +C    H  LSP C++   +
Sbjct: 74  RSLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQLSPNCSFIQSL 125


>UniRef50_O62640 Cluster: Putative inhibitor of apoptosis; n=2;
           Laurasiatheria|Rep: Putative inhibitor of apoptosis -
           Sus scrofa (Pig)
          Length = 358

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 26/69 (37%), Positives = 40/69 (57%)
 Frame = +2

Query: 506 CNFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           CN WP+++      +A AG +Y G  D+  CF CD  +R W   +D W  HA   P+C +
Sbjct: 98  CN-WPSSIPVHPEQLASAGFYYMGHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEY 156

Query: 686 VLSVKGKEF 712
           ++ +KG+EF
Sbjct: 157 LIRIKGQEF 165



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/58 (32%), Positives = 27/58 (46%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP        ++A+AG +Y G GD   CF C   + +W   +DA   H    P C F+
Sbjct: 14  WPLTFLSP-ADLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMTEHLRHFPNCPFL 70


>UniRef50_UPI0000D55797 Cluster: PREDICTED: similar to CG8293-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8293-PA, isoform A - Tribolium castaneum
          Length = 338

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 23/66 (34%), Positives = 40/66 (60%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP++ +     +A+AG +Y G  D T+CF C   +RDW   ++ W+ HA   P+C F+++
Sbjct: 186 WPSSAKQSPETLADAGFYYRGVEDHTICFSCGGALRDWKDEDEPWEEHAKWYPRCEFLVA 245

Query: 695 VKGKEF 712
            KG+ +
Sbjct: 246 SKGQGY 251



 Score = 36.3 bits (80), Expect = 0.90
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +3

Query: 276 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEH 398
           D V C +C+AEI +W +D+     HV  SP C +A + +++
Sbjct: 96  DLVKCAFCKAEICSWEQDDEPLSEHVRWSPNCPFAKEKSQN 136


>UniRef50_UPI0000D55796 Cluster: PREDICTED: similar to CG8293-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8293-PA, isoform A - Tribolium castaneum
          Length = 494

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 27/66 (40%), Positives = 37/66 (56%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L      +++AG +Y G GD+  CF CD  +R W   +D W  HA   P+C F+  
Sbjct: 228 WPPDLIQTPDILSQAGFYYEGMGDQVRCFHCDGGLRHWDPQDDPWTEHARWFPRCSFIKL 287

Query: 695 VKGKEF 712
           VKG+EF
Sbjct: 288 VKGQEF 293



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/60 (35%), Positives = 28/60 (46%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         IA+AG FYT       CF C   + +W+  +    +H T NP C FVL+
Sbjct: 14  WPQDAAVSPPRIAKAGFFYTKHDVTVECFSCHLTISEWNYGDQVMAKHKTLNPSCPFVLN 73



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 24/69 (34%), Positives = 28/69 (40%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG +Y   GD T C FC   VR W   +D  Q H      C FVL+
Sbjct: 108 WPKPHIVAPERLARAGFYYLNTGDNTKCAFCKGVVRAWEPGDDPDQEHKRHFEDCPFVLT 167

Query: 695 VKGKEFCQN 721
                  QN
Sbjct: 168 EIVPRLSQN 176


>UniRef50_UPI00006A221A Cluster: Baculoviral IAP repeat-containing
           protein 7 (Kidney inhibitor of apoptosis protein) (KIAP)
           (Melanoma inhibitor of apoptosis protein) (ML-IAP)
           (Livin).; n=2; Tetrapoda|Rep: Baculoviral IAP
           repeat-containing protein 7 (Kidney inhibitor of
           apoptosis protein) (KIAP) (Melanoma inhibitor of
           apoptosis protein) (ML-IAP) (Livin). - Xenopus
           tropicalis
          Length = 369

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 28/69 (40%), Positives = 36/69 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG FYTG  D   CF CD  +R+W   +D W  HA   P C F+L 
Sbjct: 126 WPRYANGDPQQLAGAGFFYTGHRDHVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDFLLQ 185

Query: 695 VKGKEFCQN 721
           VKG+ F ++
Sbjct: 186 VKGEAFIRS 194



 Score = 39.9 bits (89), Expect = 0.073
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 1/64 (1%)
 Frame = +2

Query: 515 WPAALRDMI-TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP   R +    +A +G +Y G GD   CF C   +R W   +     H    P C F+ 
Sbjct: 18  WPHTCRTVSPAELARSGFYYLGPGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCPFLQ 77

Query: 692 SVKG 703
             +G
Sbjct: 78  VRRG 81



 Score = 33.5 bits (73), Expect = 6.4
 Identities = 16/52 (30%), Positives = 24/52 (46%)
 Frame = +3

Query: 222 HGVNQQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           +G  QQL    F Y    DHV C +C+  ++NW + +     H    P C +
Sbjct: 131 NGDPQQLAGAGFFYTGHRDHVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDF 182


>UniRef50_Q175J8 Cluster: Inhibitor of apoptosis 1, diap1; n=1;
           Aedes aegypti|Rep: Inhibitor of apoptosis 1, diap1 -
           Aedes aegypti (Yellowfever mosquito)
          Length = 433

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 27/58 (46%), Positives = 37/58 (63%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQN 721
           +A+AG +Y GR DE  CF+CD  +R W  ++D W  HA   P+C FV  VKG+ F +N
Sbjct: 123 LAQAGFYYLGRADEVHCFYCDGGLRFWLADDDPWFEHARCFPKCQFVQLVKGQLFIEN 180



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 15/51 (29%), Positives = 28/51 (54%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +++A+AG +YT   D+  C +C+  +  W + +D +  H    P C  V+S
Sbjct: 23  SSLAKAGFYYTYNADQVKCAWCEGVIGQWELGDDPFVEHQKFFPNCAKVIS 73


>UniRef50_Q8JHV9 Cluster: IAP-like protein; n=1; Xenopus laevis|Rep:
           IAP-like protein - Xenopus laevis (African clawed frog)
          Length = 401

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 27/66 (40%), Positives = 35/66 (53%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP        ++A +G FYTG  D   CF CD  +R+W   +D W  HA   P C F+L 
Sbjct: 155 WPMYAHGNPEHLAGSGFFYTGHRDNVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDFLLH 214

Query: 695 VKGKEF 712
           VKG+ F
Sbjct: 215 VKGEAF 220



 Score = 37.1 bits (82), Expect = 0.52
 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 1/59 (1%)
 Frame = +2

Query: 515 WPAAL-RDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP    +     +A +G +Y G GD   CF C   +R W   +     H    P C F+
Sbjct: 50  WPRTCPQPSPVEMARSGFYYLGPGDRVQCFSCGGVLRSWEPGDRPDTEHRKFFPSCTFL 108


>UniRef50_A2AWP0 Cluster: Baculoviral IAP repeat-containing 7; n=7;
           Eutheria|Rep: Baculoviral IAP repeat-containing 7 - Mus
           musculus (Mouse)
          Length = 285

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+        +A AG F+TG+ D+  CFFC   ++ W   +D W  HA   P+C F+L 
Sbjct: 103 WPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLR 162

Query: 695 VKGKEFCQNAITATHV----DKRDDDE 763
            KG++F +   T T +    D+R++ E
Sbjct: 163 SKGRDFVERIQTYTPLLGSWDQREEPE 189


>UniRef50_Q8WRD9 Cluster: Inhibitor of apotosis protein 1-like
           protein; n=6; Aedes/Ochlerotatus group|Rep: Inhibitor of
           apotosis protein 1-like protein - Aedes triseriatus
           (Mosquito) (Ochlerotatus triseriatus)
          Length = 403

 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 22/66 (33%), Positives = 39/66 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  ++     +++AG FYTG+GD   CF C   ++DW   ++ W++HA     C ++  
Sbjct: 208 WPKFMKQKPKELSDAGFFYTGKGDRVKCFSCGGGLKDWEAEDEPWEQHAMWYSNCEYLKL 267

Query: 695 VKGKEF 712
           +KG+E+
Sbjct: 268 MKGEEY 273



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +3

Query: 237 QLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 386
           +L R  F Y   +D V C +C  EI  W  ++ +   H+  SPYC    K
Sbjct: 58  ELARYGFYYVGPNDMVKCYFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRK 107



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +A  G +Y G  D   C+FC   +  W  N++    H   +P C
Sbjct: 59  LARYGFYYVGPNDMVKCYFCRVEIGLWEPNDNVLSEHLRWSPYC 102


>UniRef50_Q8JKH8 Cluster: Inhibitor of apoptosis protein; n=1;
           Heliothis zea virus 1|Rep: Inhibitor of apoptosis
           protein - Heliothis zea virus 1
          Length = 182

 Score = 62.9 bits (146), Expect = 9e-09
 Identities = 25/69 (36%), Positives = 37/69 (53%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+    ++AEAG FY+   DE  C+ C   +  W   +D W +HA  +  C F+L 
Sbjct: 30  WPVGLQQCPVSLAEAGFFYSNMCDEVQCYLCGVRISKWLPEDDPWIQHAKCSKNCRFLLR 89

Query: 695 VKGKEFCQN 721
           +KG +F  N
Sbjct: 90  IKGVDFVYN 98


>UniRef50_Q24307 Cluster: Apoptosis 2 inhibitor; n=4;
           Sophophora|Rep: Apoptosis 2 inhibitor - Drosophila
           melanogaster (Fruit fly)
          Length = 498

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPAYVSEVLATT 295



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 78


>UniRef50_Q8QL95 Cluster: Inhibitor of apoptosis-3 IAP-3; n=2;
           Nucleopolyhedrovirus|Rep: Inhibitor of apoptosis-3 IAP-3
           - Mamestra configurata NPV-A
          Length = 276

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 25/70 (35%), Positives = 41/70 (58%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP+ +      +A AG FYTG+ D   CF CD  +++W   +D ++ HA    +C +V+ 
Sbjct: 130 WPSTIPVSPHELATAGFFYTGKSDRVKCFACDGGLKEWTKGDDPFKLHARWFDRCSYVMK 189

Query: 695 VKGKEFCQNA 724
            KG+EF ++A
Sbjct: 190 TKGEEFIKSA 199



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 4/88 (4%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAV 434
           FK     D+V C +C+ EI  W   + +E  H   +P C    K+ + +  GD  T N  
Sbjct: 40  FKDAVYSDNVRCAFCKVEICRWQAHDNVEEDHKRWAPQCKLVRKLVDID--GDYNTTNNT 97

Query: 435 --LVKE--GRPKCVYRCMSNLQSRMDTF 506
              + E   RP   +      QSR+ TF
Sbjct: 98  EPSIDECGARPHYAHPQYRTYQSRLTTF 125


>UniRef50_Q2PQQ3 Cluster: Inhibitor of apoptosis 1 protein; n=1;
           Glossina morsitans morsitans|Rep: Inhibitor of apoptosis
           1 protein - Glossina morsitans morsitans (Savannah
           tsetse fly)
          Length = 366

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 24/66 (36%), Positives = 37/66 (56%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  ++     + EAG FYTG GD   CF C   ++DW  N++ W+ HA    +C F+  
Sbjct: 173 WPRHMKQKPKQLVEAGFFYTGVGDRVRCFSCGGGLKDWGENDNPWEEHAFWMSKCRFLKL 232

Query: 695 VKGKEF 712
           +KG+ +
Sbjct: 233 MKGQNY 238



 Score = 37.5 bits (83), Expect = 0.39
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +A  G+FY G  D+  C+FC+  +  W   +     H   +P C
Sbjct: 39  LAMTGMFYMGEEDKCKCYFCEVEIGRWEREDQPMSEHLRWSPNC 82


>UniRef50_Q8JKH5 Cluster: IAP; n=1; Heliothis zea virus 1|Rep: IAP -
           Heliothis zea virus 1
          Length = 188

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 26/69 (37%), Positives = 38/69 (55%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           W    R     +AEAG FY G  D T CF+CD  + DW+  +D W++HA    +C F+L 
Sbjct: 101 WSVFKRPTPIALAEAGFFYAGMVDCTKCFYCDGGLNDWNPCDDPWEQHAIHFDRCVFLLY 160

Query: 695 VKGKEFCQN 721
            KG  + ++
Sbjct: 161 KKGPLYVES 169


>UniRef50_Q6JPG0 Cluster: Inhibitor of apoptosis protein; n=1;
           Neodiprion lecontii NPV|Rep: Inhibitor of apoptosis
           protein - Neodiprion lecontii NPV
          Length = 260

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 22/62 (35%), Positives = 38/62 (61%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +L+ + T +A  G FYT +GD T+CF C   ++DW+I++     HA    +C ++ +
Sbjct: 169 WPISLKSLKTQLAYTGFFYTQKGDVTICFHCGLVLKDWYIHDTPINEHAKWFDKCKYLTT 228

Query: 695 VK 700
           +K
Sbjct: 229 LK 230



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSV 697
           ++A++G +YTG  D   CF C   ++ W  ++D    H   + +C  V  +
Sbjct: 28  DLAKSGFYYTGISDIVRCFDCRIEIKHWKEHDDPTYEHRRWSERCRMVREI 78



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 18/57 (31%), Positives = 26/57 (45%)
 Frame = +3

Query: 219 KHGVNQQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           K+  ++ L +  F Y  + D V C  C  EIK+W E +   Y H   S  C    +I
Sbjct: 22  KYIKSEDLAKSGFYYTGISDIVRCFDCRIEIKHWKEHDDPTYEHRRWSERCRMVREI 78


>UniRef50_Q96CA5 Cluster: Baculoviral IAP repeat-containing protein
           7; n=8; Eutheria|Rep: Baculoviral IAP repeat-containing
           protein 7 - Homo sapiens (Human)
          Length = 298

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +A AG F+TG  D+  CFFC   ++ W   +D W  HA   P C F+L 
Sbjct: 97  WPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLR 156

Query: 695 VKGKEFCQNAITATH 739
            KG++F  +++  TH
Sbjct: 157 SKGRDFV-HSVQETH 170


>UniRef50_Q7QHS1 Cluster: ENSANGP00000017960; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017960 - Anopheles gambiae
           str. PEST
          Length = 199

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 25/56 (44%), Positives = 33/56 (58%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           T +A AG +YTG  DE  CF CD  +RDW + +D WQ HA    +C F+  V G +
Sbjct: 42  TRLAVAGFYYTGTDDEVRCFQCDAGLRDWLVTDDPWQEHARCFAECTFLRLVFGAD 97


>UniRef50_P98170 Cluster: Baculoviral IAP repeat-containing protein
           4; n=45; Tetrapoda|Rep: Baculoviral IAP
           repeat-containing protein 4 - Homo sapiens (Human)
          Length = 497

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG +  G GD+  CF C   + DW  +ED W++HA   P C ++L  KG+E+  N I
Sbjct: 284 LARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINN-I 342

Query: 728 TATH 739
             TH
Sbjct: 343 HLTH 346



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AGL+YTG GD+  CF C   +++W   + AW  H    P C+FVL
Sbjct: 173 WPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVL 231



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           + +A AG  YTG GD   CF C   V  W   + A  RH   +P C F+
Sbjct: 45  STLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFI 93


>UniRef50_A5D8Q0 Cluster: Xxiap protein; n=3; Xenopus|Rep: Xxiap
           protein - Xenopus laevis (African clawed frog)
          Length = 475

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 25/59 (42%), Positives = 32/59 (54%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP     M   +A AGLFYTG  D+  CF C   + +W  ++ AW  H    P+CYFVL
Sbjct: 170 WPGYSPLMPKELANAGLFYTGINDQVKCFCCGGKLMNWEPSDRAWTEHKKHFPECYFVL 228



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  + D  T +A+AG +  G  D T CF C   +  W  N+D W+ HA   P C F++ 
Sbjct: 260 WPFPI-DKET-LAKAGFYRIGDEDATKCFSCGGMLNCWAANDDPWEEHAKAYPGCQFLIE 317

Query: 695 VKGKEFCQNA 724
            KG++F  NA
Sbjct: 318 EKGQQFINNA 327



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/47 (40%), Positives = 25/47 (53%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A AG +YTG GD   CF C   V DW   + A  +H   +P C F+
Sbjct: 45  LARAGFYYTGDGDRVKCFSCMAMVEDWQHGDTAIGKHRKISPNCKFI 91


>UniRef50_Q1RPV4 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 612

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 26/69 (37%), Positives = 39/69 (56%)
 Frame = +2

Query: 527 LRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGK 706
           LR  I  IAEAG ++ G GD   C++C   ++++ + ++ W  HA   PQC F+L  KG 
Sbjct: 341 LRATIDEIAEAGFYFLGPGDLVKCWYCGNKLKNFDVEDEPWMEHAKWFPQCEFLLQNKGH 400

Query: 707 EFCQNAITA 733
            F  N  T+
Sbjct: 401 AFVANIQTS 409



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +2

Query: 509 NFWPAALRDMITN-IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           ++WP  LR++ T  +A+ G +Y G  D   CF C   + +W+++++   RH    P C F
Sbjct: 215 DYWPHQLREVNTAALAKYGFYYLGISDMVECFCCSNVLGNWNVDDNPKNRHLERFPNCRF 274

Query: 686 V 688
           +
Sbjct: 275 I 275



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSV 697
           +A  G ++TG  D  VCF C   VR+W + +    +     P C F  S+
Sbjct: 54  LAIHGFYFTGVEDCVVCFSCKNSVRNWKLGDKEGDK-KWHKPDCVFFNSL 102


>UniRef50_Q2PQQ2 Cluster: Inhibitor of apoptosis 2 protein; n=1;
           Glossina morsitans morsitans|Rep: Inhibitor of apoptosis
           2 protein - Glossina morsitans morsitans (Savannah
           tsetse fly)
          Length = 526

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 27/68 (39%), Positives = 34/68 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP         +AEAGL+Y    D+  CF C+  +R W   +D W  HA   PQC FV  
Sbjct: 223 WPIPDIQKPVALAEAGLYYQEVDDQVRCFHCNMGLRSWEKEDDPWFEHAKWYPQCPFVRL 282

Query: 695 VKGKEFCQ 718
           VKG  + Q
Sbjct: 283 VKGNTYIQ 290



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WPA        +AE G + +G   E  C +C C + +W   +   +RH T +PQC F+
Sbjct: 14  WPANTPVNPRQLAECGFYASGPFLEAECNWCHCRISNWEYGDVVERRHRTVSPQCEFI 71



 Score = 41.5 bits (93), Expect = 0.024
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           ++A+AG FY  R DE  C +C   +  W   ++A++ H    P C
Sbjct: 134 SLAKAGFFYLNRSDEVKCVWCKGVIAQWEKQDNAFEEHRRFFPDC 178



 Score = 34.7 bits (76), Expect = 2.8
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +3

Query: 288 CEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           C +C   I NW   + +E  H T+SP C +
Sbjct: 41  CNWCHCRISNWEYGDVVERRHRTVSPQCEF 70



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 11/43 (25%), Positives = 22/43 (51%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           Y +VDD V C +C   +++W +++   + H    P C +   +
Sbjct: 241 YQEVDDQVRCFHCNMGLRSWEKEDDPWFEHAKWYPQCPFVRLV 283


>UniRef50_P41431 Cluster: Uncharacterized 14.6 kDa protein in
           EGT-IAP1 intergenic region; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 14.6 kDa
           protein in EGT-IAP1 intergenic region - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 129

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +3

Query: 3   ETKTKLGHINVSLNQNDPNVLILTVTLTS 89
           ETKTKLGHINVSLNQND NVLILTVTLTS
Sbjct: 101 ETKTKLGHINVSLNQNDANVLILTVTLTS 129


>UniRef50_A5IZV8 Cluster: Iap-5; n=1; Spodoptera litura
           granulovirus|Rep: Iap-5 - Spodoptera litura granulovirus
          Length = 263

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 HVQFTVAYGYVCNF--WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDA 646
           H+ FT     + ++  WP  L++++ ++  AG +YT  GD   C+ C   V  W+ N+  
Sbjct: 108 HLDFTTHEARLLSYKHWPIVLKELVFDLCVAGFYYTNIGDYVCCYVCGIKVNHWYANDSP 167

Query: 647 WQRHATENPQCYFVLSVKGKEFC 715
            Q+H   NP C  V  +     C
Sbjct: 168 MQKHYNFNPYCNLVRLMYNNSGC 190



 Score = 34.7 bits (76), Expect = 2.8
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINE-DAWQRHATENPQCYFVLSVKGKEFCQNA 724
           +AE G +YTG GD+  C FC   + +++    D    H   +P+C +VL     EF    
Sbjct: 31  LAEMGFYYTGYGDKIRCAFCQLELYNFNSPACDPIIDHKRWSPRCPYVLET--VEFMTTI 88

Query: 725 ITATHVDK 748
              +H  K
Sbjct: 89  CQYSHTQK 96



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 11/39 (28%), Positives = 19/39 (48%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           F Y  + D+V C  C  ++ +W  ++     H   +PYC
Sbjct: 140 FYYTNIGDYVCCYVCGIKVNHWYANDSPMQKHYNFNPYC 178


>UniRef50_Q9DVT5 Cluster: PxORF98 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF98 peptide - Plutella xylostella
           granulovirus
          Length = 281

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 20/64 (31%), Positives = 39/64 (60%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+ ++  ++ +GL+YT  GD  VC+ C+ C++ W ++++  Q H   N +C  + +
Sbjct: 120 WPIVLQHLVFPLSLSGLYYTNVGDAVVCYVCNFCIKGWSVDDEPDQVHYLINSRCELIKN 179

Query: 695 VKGK 706
           +K K
Sbjct: 180 IKLK 183



 Score = 35.1 bits (77), Expect = 2.1
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           F Y+   D ++C YC   +  ++ DE ++  H   SP+C
Sbjct: 33  FYYSGHQDQIICAYCNLTLDRFTGDEDVQTDHRRFSPHC 71


>UniRef50_Q7SXU1 Cluster: Birc4 protein; n=7; Danio rerio|Rep: Birc4
           protein - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 415

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEF 712
           +A AG + TG  D  +CF C   V+ W  +ED W+ HA   P C F+L+ KG+E+
Sbjct: 259 LARAGFYSTGEQDRVMCFRCGGGVKAWMPDEDPWEEHARHYPGCSFLLAEKGEEY 313



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 22/61 (36%), Positives = 29/61 (47%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           N WPA       ++AEAG++Y G  D   CF C   +  W   +D W  HA     C+F 
Sbjct: 156 NNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGGLSGWEQGDDPWSEHAKYYSNCFFF 215

Query: 689 L 691
           L
Sbjct: 216 L 216



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQNAI 727
           +A AG ++TG GD   CF C   V++W+  +   +RH   +P C F+    G     N+I
Sbjct: 54  LARAGFYFTGEGDRVQCFSCSATVQNWNRGDTPLERHQLASPDCRFLSCAHGMR-NSNSI 112

Query: 728 TATHVDKRDDD 760
            +   D+  ++
Sbjct: 113 QSPDYDEEAEN 123


>UniRef50_Q1RPW2 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 879

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query: 515 WPAA-LRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WPA+ +R     IA+AG F+ G  D   C++C+  +++W  +++ W  HA   P C F+L
Sbjct: 586 WPASNVRASPRQIAKAGFFFLGDRDRVKCWYCNGGLQNWDPDDEPWTEHAKWFPTCEFLL 645

Query: 692 SVKGKEFCQNAIT 730
             KG +F    ++
Sbjct: 646 QRKGPDFVHRMVS 658



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +2

Query: 515 WPAALRDMI-TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WPA  R +  +++A +G FY G  D   CF C   +R+W+  ++    H    P C  V
Sbjct: 461 WPAQNRTVYASDLARSGFFYLGNLDRVQCFSCGGVLRNWNYGDNITAEHRRHFPHCRMV 519



 Score = 39.5 bits (88), Expect = 0.097
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           ++A AG  YTG  D   CF C  CV  W + +D  +        C F+L
Sbjct: 298 HLAAAGFHYTGYKDRVKCFCCGLCVESWCVGDDV-KSPRWHRSNCEFIL 345


>UniRef50_Q6R7I2 Cluster: ORF42; n=1; Ostreid herpesvirus 1|Rep:
           ORF42 - Ostreid herpesvirus 1
          Length = 364

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 24/63 (38%), Positives = 32/63 (50%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           FWP  +RD I  +A  G FYTG  D   C+ C C + +W  N+D  + H    P C  + 
Sbjct: 242 FWPGPIRD-IEKVARTGFFYTGEKDMLTCYACACKLINWEKNDDPIKEHKINFPHCANMA 300

Query: 692 SVK 700
            VK
Sbjct: 301 DVK 303



 Score = 34.7 bits (76), Expect = 2.8
 Identities = 15/59 (25%), Positives = 24/59 (40%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP +    I ++   G  + G GD   C  C   +R+W   +     H    P+C  V+
Sbjct: 135 WPHSEYISIDSMVAEGFEFIGPGDRVQCRHCKVILRNWETTDIPSSEHERNAPRCPLVV 193


>UniRef50_Q1RPV2 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 863

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +2

Query: 515 WPA-ALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP    +  I  IA+AG FY G  D   C++C+  +++W  +++ W  HA   P C F++
Sbjct: 609 WPKNKTQATIQQIAKAGFFYLGERDRVKCWYCNGGLQNWDPDDEPWTEHAKWFPTCEFLI 668

Query: 692 SVKGKEFCQNAIT 730
             KG +F  + ++
Sbjct: 669 RSKGPDFVHHMVS 681



 Score = 40.7 bits (91), Expect = 0.042
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +2

Query: 515 WPAALRDMI-TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP   R +  +++A +G FY G  D   CF C   +R+W+  ++    H    P C
Sbjct: 485 WPTQNRTVNPSDLARSGFFYLGNLDRVQCFSCGGVLRNWNYGDNITTEHRRHFPHC 540



 Score = 34.7 bits (76), Expect = 2.8
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINED 643
           ++A AGL++TG  D   CF C      W   +D
Sbjct: 335 HLATAGLYFTGYKDRVKCFCCGLATEQWQFGDD 367


>UniRef50_UPI0000E47BAE Cluster: PREDICTED: similar to baculoviral
           IAP-repeat containing protein 4; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to baculoviral
           IAP-repeat containing protein 4 - Strongylocentrotus
           purpuratus
          Length = 739

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 2/68 (2%)
 Frame = +2

Query: 515 WPA--ALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WPA   L  +   +A+AG ++TG  DE  CF+CD  +++W   ++ W  HA   P+C ++
Sbjct: 326 WPANPGLHVIPRILAKAGFYFTGLVDECKCFYCDGGLKNWEPTDEPWTEHAKWFPRCEWL 385

Query: 689 LSVKGKEF 712
           +  +G+ F
Sbjct: 386 IQQRGQAF 393



 Score = 37.1 bits (82), Expect = 0.52
 Identities = 17/57 (29%), Positives = 22/57 (38%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           WP       + +A AG ++TG  D   CF C   V  W   + A   H      C F
Sbjct: 35  WPGDCPMNSSRLARAGFYFTGVRDAVKCFSCGGVVEGWEFGDTAMGEHKRLFKTCAF 91


>UniRef50_Q0ZP59 Cluster: Inhibitor of apoptosis; n=1; Neodiprion
           abietis nucleopolyhedrovirus|Rep: Inhibitor of apoptosis
           - Neodiprion abietis nucleopolyhedrovirus
          Length = 202

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH 658
           WP +L+ + T +A  G FYT +GD T+CF C   ++DW+I++     H
Sbjct: 146 WPKSLKSLKTQLAYTGFFYTQKGDVTICFHCGLVLKDWYIHDTPMNEH 193



 Score = 39.1 bits (87), Expect = 0.13
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP    + +  +A+ G +YTG  D   CF C   + +W  N+D    H   + +C  V  
Sbjct: 19  WPVKYLNPLY-LAKTGFYYTGIADNVRCFDCRIEINNWEKNDDPVYEHRRWSERCRMVRG 77

Query: 695 V 697
           +
Sbjct: 78  I 78


>UniRef50_A1YJA1 Cluster: Inhibitor of apoptosis 3; n=1; Spodoptera
           frugiperda MNPV|Rep: Inhibitor of apoptosis 3 -
           Spodoptera frugiperda nuclear polyhedrosis virus (SfNPV)
          Length = 287

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDET-VCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P  L   + ++A AG FY  R D T VCF   C +  W   +D W+ HA   P C +V  
Sbjct: 121 PIPLYQDLDDMACAG-FYYNRDDSTFVCFQGGCTIVHWERRDDPWREHARWFPNCEYVNY 179

Query: 695 VKGKEFCQNAITATHVDKRDDDE 763
           +KG++F Q +I+ + V + ++ E
Sbjct: 180 IKGRDFVQESISLSCVIQSNEQE 202



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/57 (38%), Positives = 27/57 (47%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           WPA  R     +A AG +YTGR DE  C FC   +  W   ++    H    PQC F
Sbjct: 14  WPANDRVPSHMLALAGFYYTGRNDEVRCAFCKVEIMKWKYGDNPILDHKKWAPQCKF 70


>UniRef50_Q9PYQ9 Cluster: ORF137; n=2; Granulovirus|Rep: ORF137 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 285

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WPA L+ +   +  +GL+Y+  GD  VC+ C   +RDW  +   WQRH  +N +C
Sbjct: 116 WPAMLQHLSFEMCLSGLYYSNIGDIVVCYVCRERIRDWWPDHSPWQRHYYQNSKC 170


>UniRef50_Q7QJ54 Cluster: ENSANGP00000016568; n=4; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000016568 - Anopheles gambiae
           str. PEST
          Length = 330

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/66 (34%), Positives = 33/66 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  ++     +A+AG FYTG+ D  +CF C   +RDW    + W  HA     C ++  
Sbjct: 178 WPKCMKQTPEQMADAGFFYTGKSDVVICFCCGGQLRDWLPEYNPWVEHAKNFSGCPYLKL 237

Query: 695 VKGKEF 712
           VK   F
Sbjct: 238 VKTPGF 243



 Score = 34.3 bits (75), Expect = 3.6
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 386
           ++L R  F Y    D V C +C  E+  W E + +   H+  SP C    K
Sbjct: 43  EELARWGFFYTGYRDCVRCYFCHIELGGWDEHDVVIEEHLKWSPDCRLMTK 93



 Score = 33.5 bits (73), Expect = 6.4
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +A  G FYTG  D   C+FC   +  W  ++   + H   +P C
Sbjct: 45  LARWGFFYTGYRDCVRCYFCHIELGGWDEHDVVIEEHLKWSPDC 88


>UniRef50_Q13075 Cluster: Baculoviral IAP repeat-containing protein
           1; n=18; Eutheria|Rep: Baculoviral IAP repeat-containing
           protein 1 - Homo sapiens (Human)
          Length = 1403

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           ++EAG  +TG+ D   CF C  C+ +W   +D W+ HA   P+C F+ S K  E
Sbjct: 181 LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSE 234



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  +A+AGLFYTG  D   CF C  C+  W   +D    H    P C F+ +
Sbjct: 288 WPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQN 347

Query: 695 VK 700
           +K
Sbjct: 348 MK 349


>UniRef50_UPI0000F31773 Cluster: UPI0000F31773 related cluster; n=1;
           Bos taurus|Rep: UPI0000F31773 UniRef100 entry - Bos
           Taurus
          Length = 1308

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/54 (37%), Positives = 31/54 (57%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           ++ AG  +TG+ D   CF C  C+ +W  ++D W+ HA   P+C F+ S K  E
Sbjct: 182 LSAAGFVFTGKHDTVQCFSCGGCLGNWEDDDDPWKEHAKWFPKCEFLQSKKSLE 235



 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 21/51 (41%), Positives = 29/51 (56%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVK 700
           +A+AG FYTG+ D   C+ C   + DW   +D  + HA   P C F+ SVK
Sbjct: 303 LAKAGFFYTGKSDIVQCYSCGGYLHDWKEGDDPLEEHAKFFPNCQFLQSVK 353


>UniRef50_Q9QUK4 Cluster: Baculoviral IAP repeat-containing protein
           1b; n=42; Murinae|Rep: Baculoviral IAP repeat-containing
           protein 1b - Mus musculus (Mouse)
          Length = 1447

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           ++ AG  +TG+ D   CF C  C+ +W   +D W+ HA   P+C F+ S K  E
Sbjct: 181 LSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSPE 234



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/62 (32%), Positives = 31/62 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  + +AGLFYTG+ D   CF C  C+  W   ++  + H    P C F+ +
Sbjct: 288 WPHESPGAVEALVKAGLFYTGKRDIVQCFSCGGCMEKWAEGDNPIEDHTKFFPNCVFLQT 347

Query: 695 VK 700
           +K
Sbjct: 348 LK 349


>UniRef50_UPI00015B4481 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 981

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF-VLSVK 700
           IA+AG FY G GD+T C+ C   +++W  N+D W +H  +    YF VL VK
Sbjct: 305 IADAGFFYGGSGDQTTCYQCGGNLKNWEPNQDPWIQHGYKWFSTYFYVLMVK 356


>UniRef50_Q6R7D0 Cluster: ORF99; n=1; Ostreid herpesvirus 1|Rep:
           ORF99 - Ostreid herpesvirus 1
          Length = 250

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           W   LR     +A AG FYTG GD+  CF C   V DW   ++ W  H   +  C ++
Sbjct: 20  WSKQLRPNKDTLAPAGFFYTGMGDKVKCFACGLEVIDWDPTDNPWTEHGKFSGDCLYL 77


>UniRef50_Q91ET9 Cluster: ORF116 IAP-5; n=5; Granulovirus|Rep:
           ORF116 IAP-5 - Cydia pomonella granulosis virus (CpGV)
           (Cydia pomonellagranulovirus)
          Length = 275

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 18/55 (32%), Positives = 32/55 (58%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +PA+L+ ++++++  G +YT  GD   C+ C    +DW +N D  Q H   N +C
Sbjct: 115 FPASLKSLVSDLSANGFYYTNIGDAVCCYACLIIAKDWTMNSDVRQIHVRLNARC 169



 Score = 36.3 bits (80), Expect = 0.90
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +2

Query: 512 FWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHIN-EDAWQRHATENPQCYFV 688
           +WP    +    +A  G +++G GD+ VC +C   + ++    ED+ + H   +P C F+
Sbjct: 13  YWPG--HEDKEKLALMGFYFSGMGDQIVCHYCKLDLYNFATGAEDSVRDHKRYSPHCPFL 70

Query: 689 LS 694
           L+
Sbjct: 71  LN 72


>UniRef50_Q8MVN1 Cluster: Inhibitor of apoptosis protein-like
           protein; n=1; Boltenia villosa|Rep: Inhibitor of
           apoptosis protein-like protein - Boltenia villosa
          Length = 213

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQ 676
           WP  ++     IAEAG +Y G  D   CF+C+  +++W   +D W  HA   P+
Sbjct: 62  WPNRIKATPQEIAEAGFYYLGERDRCKCFYCNGGLQNWDKYDDPWMEHAKWFPK 115


>UniRef50_A7T0Y6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 332

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/59 (33%), Positives = 29/59 (49%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP         +A AG +YTG GD+  CF CD  +  W   ++ ++ H    P C F+L
Sbjct: 14  WPENCPVRPRELAMAGFYYTGCGDQVRCFSCDLQLGKWVDGDEPFEEHLKHRPSCGFIL 72



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 16/59 (27%), Positives = 27/59 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP +       ++ AG +Y G  D   C+ C   +R+W  ++  W  H   +P C  V+
Sbjct: 88  WPESSPVRPWELSSAGFYYLGDQDSVKCYKCGVALRNWEPDDLPWVEHEKWSPHCPLVI 146


>UniRef50_Q7T9R6 Cluster: Iap-5; n=1; Adoxophyes orana
           granulovirus|Rep: Iap-5 - Adoxophyes orana granulovirus
           (AoGV)
          Length = 279

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           +P+ L+ ++ ++  +G +YT  GD   C+ C    RDW I+ +    H   N  C ++  
Sbjct: 120 FPSILKGLVNDLCVSGFYYTNTGDLVCCYACKVLCRDWKIDANVHNVHMNANKNCQYLKI 179

Query: 695 VKGKEF 712
           V  K +
Sbjct: 180 VNVKMY 185


>UniRef50_Q14B43 Cluster: Birc1f protein; n=1; Mus musculus|Rep:
           Birc1f protein - Mus musculus (Mouse)
          Length = 699

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP      +  +  AG FYTG+ D   CF C  C+  W   +D  + H    P+C F+ +
Sbjct: 288 WPQESPVGVEALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQT 347

Query: 695 VK 700
           +K
Sbjct: 348 LK 349



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           ++ AG  +TG+ D   CF C   + +W   +D W+ HA   P+C F+ S K  E
Sbjct: 181 LSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSE 234


>UniRef50_A7SKK5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 314

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 19/57 (33%), Positives = 28/57 (49%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           NFWPA     +  +A AG  +TGR D   CF C   ++ W +++   + H    P C
Sbjct: 143 NFWPATSSANVFELARAGFVFTGRDDVVECFKCKGTLKQWKVDDRPIESHREFYPDC 199


>UniRef50_Q6QXG6 Cluster: ORF106; n=1; Agrotis segetum
           granulovirus|Rep: ORF106 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 283

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           +P  L+ ++  +  AGL+YT  GD   C+ C   ++DW  ++D  +RH   N  C
Sbjct: 118 YPKCLKHLVYRMCLAGLYYTNVGDCVSCYACGVIIKDWAPDDDPSKRHQASNSLC 172



 Score = 39.9 bits (89), Expect = 0.073
 Identities = 16/53 (30%), Positives = 27/53 (50%)
 Frame = +2

Query: 530 RDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           R+    +A  G +YTG+ D  +C FC   + ++  N +A   H   +P C F+
Sbjct: 17  REDKARLASLGFYYTGQSDRVICAFCKLDLYNFSKNTNALYDHKRYSPHCPFI 69



 Score = 36.3 bits (80), Expect = 0.90
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           F Y    D V+C +C+ ++ N+S++    Y H   SP+C +
Sbjct: 28  FYYTGQSDRVICAFCKLDLYNFSKNTNALYDHKRYSPHCPF 68


>UniRef50_Q6R7C4 Cluster: ORF106; n=1; Ostreid herpesvirus 1|Rep:
           ORF106 - Ostreid herpesvirus 1
          Length = 465

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
 Frame = +2

Query: 506 CNF--WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH 658
           C+F  WP  ++     +AEAG +YTG+ D   CF C      W  ++D W  H
Sbjct: 293 CSFSTWPKQMKQDSKEMAEAGWYYTGKSDRVRCFHCGITFGGWMPDDDPWSIH 345


>UniRef50_P47732 Cluster: Zinc finger protein; n=1; Invertebrate
           iridescent virus 6|Rep: Zinc finger protein - Chilo
           iridescent virus (CIV) (Insect iridescent virus type 6)
          Length = 208

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 4/73 (5%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENP----QCY 682
           WP  L      ++ AG  Y   GD+  CF+CD  +++W  +++ ++ H          C 
Sbjct: 47  WPIQLLPSKEQLSRAGFIYLNIGDQVQCFYCDLKLKEWKRSDNPFEEHKKHTQDLKINCL 106

Query: 683 FVLSVKGKEFCQN 721
           FV S++   F +N
Sbjct: 107 FVKSIEFDNFVKN 119


>UniRef50_Q6CGG1 Cluster: Similar to sp|O14064 Schizosaccharomyces
           pombe Bir1 protein; n=1; Yarrowia lipolytica|Rep:
           Similar to sp|O14064 Schizosaccharomyces pombe Bir1
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 634

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYT---GRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           WP +L+     +AEAG ++       D  VC +CD  +  W   +D    H    P+CYF
Sbjct: 124 WPTSLK-----LAEAGFYFAPTVAEEDLVVCAYCDISLDGWERTDDPLHEHERRRPECYF 178

Query: 686 VLSVKGKE 709
             S+K +E
Sbjct: 179 FTSMKKEE 186



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 3/58 (5%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGR---GDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP    D    +A+AG ++  R    D   CF C+C +  W +++   + H   +  C
Sbjct: 25  WPHEHPDP-EQLAKAGFYFNPRVESPDNVTCFLCECSLDGWELDDCPLKEHLEHSRGC 81



 Score = 33.1 bits (72), Expect = 8.4
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +3

Query: 219 KHGVNQQLDR*RFKYN---QVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 389
           +H   +QL +  F +N   +  D+V C  CE  +  W  D+C    H+  S  C++A  +
Sbjct: 28  EHPDPEQLAKAGFYFNPRVESPDNVTCFLCECSLDGWELDDCPLKEHLEHSRGCSWATIL 87

Query: 390 AE 395
           ++
Sbjct: 88  SK 89


>UniRef50_Q9VEM2 Cluster: CG12265-PA; n=2; Sophophora|Rep:
           CG12265-PA - Drosophila melanogaster (Fruit fly)
          Length = 153

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTG---RGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           +P      I+ +AEAG ++TG     D   CF C   +  W   +D W+ H    PQC F
Sbjct: 40  FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEF 99


>UniRef50_Q16GV8 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 142

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 4/54 (7%)
 Frame = +2

Query: 539 ITNIAEAGLFYTGRG----DETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           I  +AEAG ++ G      D +VCF C   +  W  ++D W+ H    PQC FV
Sbjct: 34  IQKMAEAGFYWQGDDKEDEDTSVCFVCGKVLDGWEESDDPWEEHKKHAPQCLFV 87


>UniRef50_Q7PQW0 Cluster: ENSANGP00000002826; n=2; Coelomata|Rep:
           ENSANGP00000002826 - Anopheles gambiae str. PEST
          Length = 4775

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 4/62 (6%)
 Frame = +2

Query: 548 IAEAGLFY----TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFC 715
           +A+AG ++     G  D  +CF C  C+  W   ++ W  H   +P+C F   VKG EF 
Sbjct: 259 MAQAGFYHQPGENGNKDRAMCFTCTVCLVCWEKTDEPWSEHERHSPECPF---VKG-EFT 314

Query: 716 QN 721
           QN
Sbjct: 315 QN 316


>UniRef50_A0NCK8 Cluster: ENSANGP00000030040; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030040 - Anopheles gambiae
           str. PEST
          Length = 156

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           WP +       +A AG  + G  D+  CF C   +  W   +D W++HA  +P C F+
Sbjct: 14  WPYSGIIHPLRLAYAGFCWRGVDDKVHCFDCGLTLGGWLRTDDPWEKHARSSPNCPFI 71


>UniRef50_UPI00006A201E Cluster: UPI00006A201E related cluster; n=3;
           Xenopus tropicalis|Rep: UPI00006A201E UniRef100 entry -
           Xenopus tropicalis
          Length = 332

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVK 700
           +A AG +Y G  D+  CF C   +  W   ED    H    PQC+F+L  K
Sbjct: 258 LAWAGFYYVGPKDKVQCFSCGGEMDKWWSREDPLTEHHRRFPQCHFILGRK 308



 Score = 39.5 bits (88), Expect = 0.097
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 4/88 (4%)
 Frame = +2

Query: 494 YGYVCNFW--PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATE 667
           +G   N+W      +     +A AG FY G GD   CF C   V +W   +     H   
Sbjct: 145 HGQHFNYWNQQRLAKQTSDELAWAGFFYVGPGDRVRCFSCGGEVDNWEPGDVPLTGHQLF 204

Query: 668 NPQCYFV--LSVKGKEFCQNAITATHVD 745
            P C +V  LS++   F +  +    +D
Sbjct: 205 FPHCSYVQGLSIRHSYFMEEGVGPGFLD 232


>UniRef50_Q9YMI9 Cluster: Apoptosis inhibitor; n=1; Lymantria dispar
           MNPV|Rep: Apoptosis inhibitor - Lymantria dispar
           multicapsid nuclear polyhedrosis virus (LdMNPV)
          Length = 155

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 24/83 (28%), Positives = 36/83 (43%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           W A        +A AG +   R D   C +C   + +W I  DA   H   +P C FV  
Sbjct: 14  WSAVDAPAPAELAHAGFYCANRQDFVKCAYCHIEIGNWSIGSDAMSDHKRYSPACRFVC- 72

Query: 695 VKGKEFCQNAITATHVDKRDDDE 763
               E  +  ++   V++RDDD+
Sbjct: 73  ----ELIKRPVSP--VERRDDDD 89


>UniRef50_Q5MAF5 Cluster: Inhibitor of apoptosis protein; n=2;
           Schistosoma japonicum|Rep: Inhibitor of apoptosis
           protein - Schistosoma japonicum (Blood fluke)
          Length = 393

 Score = 41.1 bits (92), Expect = 0.032
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 542 TNIAEAGLFYTGRGDETVCFFCDCCVRDWHINE 640
           + +A AG F+TG GDETVC  C   +RDW   +
Sbjct: 83  SELASAGFFHTGSGDETVCPACGLGLRDWQATD 115


>UniRef50_UPI00015B625E Cluster: PREDICTED: similar to survivin;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           survivin - Nasonia vitripennis
          Length = 4688

 Score = 40.7 bits (91), Expect = 0.042
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 4/62 (6%)
 Frame = +2

Query: 548 IAEAGLFY----TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFC 715
           +A+AG ++    TG  D  +CF C  C+  W   ++ W  H   +P C F   VKG E+ 
Sbjct: 253 MAQAGFYHQPNSTGE-DRAMCFTCSVCLVCWEPTDEPWSEHERHSPACPF---VKG-EYT 307

Query: 716 QN 721
           QN
Sbjct: 308 QN 309


>UniRef50_Q7Q4I9 Cluster: ENSANGP00000019173; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000019173 - Anopheles gambiae
           str. PEST
          Length = 134

 Score = 40.3 bits (90), Expect = 0.055
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +2

Query: 539 ITNIAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           I  +AEAG ++ G   E     CF C   +  W  ++D W  H    PQC FV
Sbjct: 34  IQKMAEAGFYWHGTETEIDIAACFVCGKELDGWEESDDPWSEHRKHAPQCPFV 86


>UniRef50_Q9VH01 Cluster: CG6303-PA; n=11; Coelomata|Rep: CG6303-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 4876

 Score = 39.9 bits (89), Expect = 0.073
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQ 718
           +A+AG ++   +   D  +CF C  C+  W   ++ W  H   +P C F   VKG E+ Q
Sbjct: 271 MAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSPLCPF---VKG-EYTQ 326

Query: 719 N 721
           N
Sbjct: 327 N 327


>UniRef50_Q29AL2 Cluster: GA19502-PA; n=1; Drosophila
           pseudoobscura|Rep: GA19502-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 4926

 Score = 39.9 bits (89), Expect = 0.073
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQ 718
           +A+AG ++   +   D  +CF C+ C+  W   ++ W  H   +P C F   VKG E+ Q
Sbjct: 264 MAQAGFYHQPSSSGEDRAMCFTCNVCLVCWEKTDEPWSEHERHSPICPF---VKG-EYTQ 319

Query: 719 N 721
           N
Sbjct: 320 N 320


>UniRef50_Q55KX6 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 683

 Score = 39.9 bits (89), Expect = 0.073
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           +A AG  Y   T   D  +C +C+  V  W   +D W+ H ++ P C+F
Sbjct: 153 LARAGFVYNPSTESKDAVICPYCEYGVEGWEATDDPWEIHQSKVPDCHF 201



 Score = 35.5 bits (78), Expect = 1.6
 Identities = 30/115 (26%), Positives = 43/115 (37%), Gaps = 3/115 (2%)
 Frame = +3

Query: 123 YQHARQLSRQHRRTRIRHVTRKTWLV*KLSHCKHGVNQQLDR*RFKYN---QVDDHVVCE 293
           Y+ A  L +      +R  T K W   K         + L R  F YN   +  D V+C 
Sbjct: 114 YETANSLPQSAESIEVRAQTFKKWWPHKQKSGWLPTVKALARAGFVYNPSTESKDAVICP 173

Query: 294 YCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINAVLVKEGRPK 458
           YCE  ++ W   +     H +  P C +       E+ G  I  +      GRPK
Sbjct: 174 YCEYGVEGWEATDDPWEIHQSKVPDCHFFRATLVGEAEGSGIA-DKPNKASGRPK 227


>UniRef50_Q9NR09 Cluster: Baculoviral IAP repeat-containing protein
           6; n=41; Eumetazoa|Rep: Baculoviral IAP
           repeat-containing protein 6 - Homo sapiens (Human)
          Length = 4829

 Score = 39.9 bits (89), Expect = 0.073
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A+AG ++   +   D  +CF C  C+  W   ++ W  H   +P C FV
Sbjct: 281 MAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFV 330


>UniRef50_UPI00015B4272 Cluster: PREDICTED: similar to survivin;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           survivin - Nasonia vitripennis
          Length = 158

 Score = 39.1 bits (87), Expect = 0.13
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 3/58 (5%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKE 709
           N+A AG +  G  DE     CF C   +  W  ++D W  H    P C F+   K +E
Sbjct: 44  NMARAGFYAIGGKDEPDLAECFMCCKQLDGWEPDDDPWLEHKKHQPNCQFIKLDKPEE 101


>UniRef50_A5DCT0 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 1041

 Score = 37.5 bits (83), Expect = 0.39
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +2

Query: 548 IAEAGLFY--TGRGDE-TVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A+AG FY    +GD+ T C +C  C+  W   +D  + H      CY +
Sbjct: 151 LAKAGFFYCPVDQGDDRTQCVYCKFCLEGWSEEDDPLEEHRKYQSDCYLL 200


>UniRef50_UPI00003C0A18 Cluster: PREDICTED: similar to baculoviral
           IAP repeat-containing 5; n=1; Apis mellifera|Rep:
           PREDICTED: similar to baculoviral IAP repeat-containing
           5 - Apis mellifera
          Length = 150

 Score = 36.7 bits (81), Expect = 0.68
 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 6/71 (8%)
 Frame = +2

Query: 515 WPAALRDMITN---IAEAGLFYTG---RGDETVCFFCDCCVRDWHINEDAWQRHATENPQ 676
           WP    D   N   +A AG +  G     D   CF C   +  W  ++D W  H     Q
Sbjct: 23  WPFQSSDNSCNPERMAAAGFYVVGGKKEPDLVECFICSKQLDSWDPDDDPWNEHMKHESQ 82

Query: 677 CYFVLSVKGKE 709
           C F+   K  E
Sbjct: 83  CSFIRLGKSDE 93


>UniRef50_UPI00006A1E85 Cluster: UPI00006A1E85 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A1E85 UniRef100 entry -
           Xenopus tropicalis
          Length = 301

 Score = 36.7 bits (81), Expect = 0.68
 Identities = 18/68 (26%), Positives = 26/68 (38%)
 Frame = +2

Query: 503 VCNFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCY 682
           V   W          +A AG +Y G  D   CF C   +  W   +    RH    P+C 
Sbjct: 221 VSTMWGPRTGSRENKLANAGFYYVGPRDRVRCFSCGGQLEMWEEWDFPLTRHQQTFPECP 280

Query: 683 FVLSVKGK 706
           ++  +K K
Sbjct: 281 YLQELKAK 288



 Score = 34.7 bits (76), Expect = 2.8
 Identities = 16/53 (30%), Positives = 23/53 (43%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGK 706
           +A AG +Y G  D   CF C      W   +    RH    P+C ++  +K K
Sbjct: 4   LANAGFYYVGPEDRVRCFSCGGQFEMWEEWDFPLTRHQQTFPECPYLQELKAK 56



 Score = 33.9 bits (74), Expect = 4.8
 Identities = 14/52 (26%), Positives = 24/52 (46%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVK 700
           ++A+AG +Y G GD   C  C   +  W   +    RH    P C ++  ++
Sbjct: 147 DLAQAGFYYVGPGDRVRCISCGGELEKWERWDVPLTRHQHSFPHCPYMQKLR 198


>UniRef50_Q16LW5 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 151

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH 658
           +AEAG FY GR     CF+C   V     N++ WQ H
Sbjct: 50  LAEAGYFYPGRPATIQCFYCGLRVSGVTPNDNPWQIH 86


>UniRef50_Q59QN1 Cluster: Putative uncharacterized protein; n=2;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 1278

 Score = 36.3 bits (80), Expect = 0.90
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
 Frame = +2

Query: 545 NIAEAGLFYTGRG---DETVCFFCDCCVRDWHINEDAWQRH-ATENPQCYFV 688
           +++ AG  Y+ R    D   C +C C +  W  ++D  Q H   E+  CYF+
Sbjct: 155 SLSHAGFIYSPRSIEDDRVRCMYCQCALDYWEEDDDPIQEHIRNESTYCYFL 206


>UniRef50_Q90WU9 Cluster: Survivin 1; n=3; Danio rerio|Rep: Survivin
           1 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 142

 Score = 35.9 bits (79), Expect = 1.2
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)
 Frame = +2

Query: 545 NIAEAGLFYT---GRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVK 700
           N+A+AG  +T      D   CFFC   +  W   +D  + H   +P C F+L  K
Sbjct: 36  NMAKAGFIHTPSENSPDIAQCFFCLKELEGWEPEDDPEKEHKAHSPSCDFILLKK 90


>UniRef50_A7SUG7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 141

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A AG ++    D+     CF C   +  W   +D WQ H   +P+C FV
Sbjct: 37  MAAAGFYHCETDDDPDVARCFVCFKELDGWEPEDDPWQEHKKHSPKCEFV 86


>UniRef50_Q0UPJ0 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 581

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +3

Query: 276 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYA 380
           D+V C  C  ++  W E +   Y H+T SP C +A
Sbjct: 66  DNVQCWACNCQLDGWEEADVPAYEHLTHSPSCGFA 100


>UniRef50_P47134 Cluster: Protein BIR1; n=2; Saccharomyces
           cerevisiae|Rep: Protein BIR1 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 954

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%)
 Frame = +2

Query: 539 ITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRH--ATENPQCYF 685
           I  + +  +  T   D   C +C   ++ W IN+D   RH   ++N  CYF
Sbjct: 189 IEGLGDPSMDKTLMNDTCYCIYCKQLLQGWSINDDPMSRHYKVSQNGNCYF 239


>UniRef50_UPI000023D1AD Cluster: hypothetical protein FG05233.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05233.1 - Gibberella zeae PH-1
          Length = 874

 Score = 35.1 bits (77), Expect = 2.1
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +2

Query: 545 NIAEAGLFYTG---RGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           ++A AGLF+       D   CF C   +  W  N+D    H T  P+C
Sbjct: 50  SLARAGLFFNPTLENPDNAQCFLCHKGLDGWEANDDPLVEHLTHAPEC 97


>UniRef50_Q4R1J6 Cluster: XSurvivin1B; n=12; Euteleostomi|Rep:
           XSurvivin1B - Xenopus laevis (African clawed frog)
          Length = 160

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%)
 Frame = +2

Query: 545 NIAEAGLFYT---GRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFC 715
           N+A+AG  +       D   CFFC   +  W  ++D W  H+  +  C F+   K    C
Sbjct: 46  NMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWNEHSKRSVNCGFLSLTK----C 101

Query: 716 QNAIT 730
            N +T
Sbjct: 102 VNDLT 106


>UniRef50_Q4FZ23 Cluster: Phosphoglycan beta 1,2
           arabinosyltransferase, putative; n=4; Leishmania|Rep:
           Phosphoglycan beta 1,2 arabinosyltransferase, putative -
           Leishmania major
          Length = 942

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = -2

Query: 434 YSVDGNVVAKRFVLSNLVGIRAIRRQGYVCIFNTLVFGPIF 312
           ++ D N+   R+  SNL G  AIRR+G  C+       PIF
Sbjct: 449 FTPDTNLPYVRYSASNLYGFNAIRREGQYCLVTNAEVKPIF 489


>UniRef50_Q9ZFB5 Cluster: Spore germination protein XB; n=5;
           Bacillus cereus group|Rep: Spore germination protein XB
           - Bacillus anthracis
          Length = 355

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +1

Query: 160 EHVFDMLLERHGSFENYPIVNTALINSLIVNGLNTIKSTIT 282
           EH+F  L+  +G F  YP++ + ++  LI+ G  T+K T+T
Sbjct: 63  EHLFSWLMRNYGGFITYPLL-SIIVLYLIILGTVTLKETLT 102


>UniRef50_Q6R7E2 Cluster: ORF87; n=1; Ostreid herpesvirus 1|Rep:
           ORF87 - Ostreid herpesvirus 1
          Length = 170

 Score = 33.9 bits (74), Expect = 4.8
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = +2

Query: 545 NIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           ++  AGLFYTG  D   C  C   + +W   ++  + H    P C
Sbjct: 121 DLVAAGLFYTGIEDRCACHQCGNELYEWEAGDNPKEEHKRLFPDC 165


>UniRef50_Q3YJT9 Cluster: Thrombospondin domain-containing protein;
           n=1; Biomphalaria glabrata|Rep: Thrombospondin
           domain-containing protein - Biomphalaria glabrata
           (Bloodfluke planorb)
          Length = 138

 Score = 33.9 bits (74), Expect = 4.8
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +3

Query: 318 WSEDECIE--YAHVTLSPYCAYANKIAEHESFGDNITINAVLVKEGRPKCVYRCMSNL 485
           W  DEC E  Y ++  +  C+Y+ + AE     DN  +   ++++    C  RC+  +
Sbjct: 22  WPNDECTEKCYCNINGTMECSYSQEYAECRDVIDNCDLTTNVLEDTDDACCKRCVPKM 79


>UniRef50_Q2H209 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 753

 Score = 33.9 bits (74), Expect = 4.8
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = +3

Query: 276 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGD 413
           D+VVC  CE  +  W E +     H+  SP C +A   A    +G+
Sbjct: 57  DNVVCFLCEKSLDGWEESDNPLEEHLKHSPTCGWAIMAAIEAGYGN 102


>UniRef50_Q8X0N9 Cluster: Related to nitrate assimilation regulatory
           protein nirA; n=1; Neurospora crassa|Rep: Related to
           nitrate assimilation regulatory protein nirA -
           Neurospora crassa
          Length = 900

 Score = 33.5 bits (73), Expect = 6.4
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 4/99 (4%)
 Frame = -3

Query: 694 RQYKITLRVFGGVSLPGVFVNMPITYATIAKETYSFV----SATRVKKSRFRNVRNHVTQ 527
           R  +++LRV G    P   + +P+  A    E  SF     S+ R  +S  R +R++ T+
Sbjct: 474 RILQLSLRVVGANPDPNELMQLPLRCAEFKAELDSFEARLPSSFRWSESNLR-LRSYSTR 532

Query: 526 CGRPKITNVSIRDCKLDMHLYTHLGLPSFTSTALMVMLS 410
            G   +T+V  R C LD++     GL    S + +  L+
Sbjct: 533 LGIFFVTHVWWRQCHLDLYRLFLPGLKEALSASSLAQLA 571


>UniRef50_Q9DSW8 Cluster: Putative inhibitor apoptosis protein-3;
           n=1; Diadromus pulchellus ascovirus 4a|Rep: Putative
           inhibitor apoptosis protein-3 - Diadromus pulchellus
           ascovirus 4a
          Length = 187

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           +A AG  +  +GD  VC  C+  + DW  ++D    H    P+C F
Sbjct: 95  LAAAGFVHL-KGDGVVCSHCNLKLNDWKCSDDPEICHRELRPKCIF 139


>UniRef50_Q8QLC4 Cluster: Inhibitor of apoptosis-2 IAP-2; n=2;
           Nucleopolyhedrovirus|Rep: Inhibitor of apoptosis-2 IAP-2
           - Mamestra configurata NPV-A
          Length = 252

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = +2

Query: 521 AALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           A  +D    +A+ G +Y G+  E  C  C   +   +  ++A   H T +P+C+F
Sbjct: 101 AHFKDNYQQLAQNGFYYYGKKVEIRCSCCQIVIVKLNKTDNASVIHRTWSPECHF 155


>UniRef50_O14064 Cluster: Protein bir1; n=3; Schizosaccharomyces
           pombe|Rep: Protein bir1 - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 997

 Score = 33.1 bits (72), Expect = 8.4
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = +2

Query: 578 RGDETVCFFCDCCVRDWHINEDAWQRHATENPQC--YFVLSVK 700
           R D   C+ C     DW  ++D  + H T +P C   ++LS K
Sbjct: 62  RLDNVTCYMCTKSFYDWEDDDDPLKEHITHSPSCPWAYILSSK 104


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 742,271,563
Number of Sequences: 1657284
Number of extensions: 15082871
Number of successful extensions: 42173
Number of sequences better than 10.0: 111
Number of HSP's better than 10.0 without gapping: 40232
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42145
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 69143070360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -