SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P41447 Cluster: Probable global transactivator; n=11; N...   187   2e-46
UniRef50_UPI000051A1F5 Cluster: PREDICTED: similar to lodestar C...    81   3e-14
UniRef50_UPI00015B57FD Cluster: PREDICTED: similar to CG2684-PA;...    78   2e-13
UniRef50_UPI0000D574D6 Cluster: PREDICTED: similar to CG2684-PA;...    73   1e-11
UniRef50_P34739 Cluster: Transcription termination factor 2; n=4...    73   1e-11
UniRef50_Q5TMS7 Cluster: ENSANGP00000028812; n=1; Anopheles gamb...    72   1e-11
UniRef50_O17550 Cluster: Putative uncharacterized protein; n=3; ...    72   1e-11
UniRef50_Q2WBW9 Cluster: Lodestar protein; n=2; Platynereis dume...    70   8e-11
UniRef50_Q61BT8 Cluster: Putative uncharacterized protein CBG132...    68   2e-10
UniRef50_Q54SZ4 Cluster: Putative uncharacterized protein; n=1; ...    67   4e-10
UniRef50_A0BG98 Cluster: Chromosome undetermined scaffold_105, w...    66   1e-09
UniRef50_Q9VHY2 Cluster: CG10445-PA; n=2; Drosophila melanogaste...    65   2e-09
UniRef50_UPI00015B63D4 Cluster: PREDICTED: similar to helicase; ...    64   3e-09
UniRef50_Q55X95 Cluster: Putative uncharacterized protein; n=2; ...    64   3e-09
UniRef50_O60177 Cluster: ATP-dependent DNA helicase; n=1; Schizo...    62   2e-08
UniRef50_Q10332 Cluster: Uncharacterized ATP-dependent helicase ...    62   2e-08
UniRef50_Q9FF61 Cluster: Putative SWI/SNF-related matrix-associa...    62   2e-08
UniRef50_A7ARZ9 Cluster: DNA repair and recombination protein RA...    61   3e-08
UniRef50_Q9UNY4 Cluster: Transcription termination factor 2; n=9...    61   4e-08
UniRef50_Q4RTN8 Cluster: Chromosome 2 SCAF14997, whole genome sh...    60   5e-08
UniRef50_Q297P0 Cluster: GA10321-PA; n=1; Drosophila pseudoobscu...    60   5e-08
UniRef50_A0CAA3 Cluster: Chromosome undetermined scaffold_160, w...    60   5e-08
UniRef50_Q5NC05 Cluster: Transcription termination factor 2; n=1...    60   5e-08
UniRef50_Q54NP1 Cluster: SNF2-related domain-containing protein;...    60   6e-08
UniRef50_A0E7N9 Cluster: Chromosome undetermined scaffold_81, wh...    60   6e-08
UniRef50_Q2HHC5 Cluster: Putative uncharacterized protein; n=1; ...    60   6e-08
UniRef50_Q4P887 Cluster: Putative uncharacterized protein; n=1; ...    60   8e-08
UniRef50_Q4WVM1 Cluster: DNA repair protein rad5; n=10; Pezizomy...    58   3e-07
UniRef50_UPI00015B5D8F Cluster: PREDICTED: similar to steroid re...    57   4e-07
UniRef50_O12944 Cluster: DNA repair and recombination protein RA...    57   6e-07
UniRef50_UPI000023F51F Cluster: hypothetical protein FG11234.1; ...    56   8e-07
UniRef50_A7PQK2 Cluster: Chromosome chr6 scaffold_25, whole geno...    56   8e-07
UniRef50_A0C9B0 Cluster: Chromosome undetermined scaffold_16, wh...    56   8e-07
UniRef50_P32863 Cluster: DNA repair and recombination protein RA...    56   8e-07
UniRef50_UPI0000E4643D Cluster: PREDICTED: similar to MGC81081 p...    56   1e-06
UniRef50_A2Q4K2 Cluster: SNF2-related; Zinc finger, RING-type; A...    56   1e-06
UniRef50_Q9FNI6 Cluster: Putative SWI/SNF-related matrix-associa...    56   1e-06
UniRef50_UPI000023DDDC Cluster: hypothetical protein FG07734.1; ...    56   1e-06
UniRef50_Q385M5 Cluster: DNA repair and recombination protein RA...    56   1e-06
UniRef50_A6EK72 Cluster: Superfamily II DNA/RNA helicase, SNF2 f...    55   2e-06
UniRef50_A0UXS6 Cluster: SNF2-related; n=1; Clostridium cellulol...    55   2e-06
UniRef50_P41410 Cluster: DNA repair protein rhp54; n=30; Fungi/M...    55   2e-06
UniRef50_A6S690 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_Q8I4S6 Cluster: DNA repair protein rhp16, putative; n=2...    54   3e-06
UniRef50_Q6C733 Cluster: Yarrowia lipolytica chromosome E of str...    54   4e-06
UniRef50_Q6C2R8 Cluster: DNA repair protein RAD5; n=1; Yarrowia ...    54   4e-06
UniRef50_Q4YWQ3 Cluster: DNA repair protein rhp16, putative; n=8...    54   5e-06
UniRef50_Q9P793 Cluster: SHREC complex subunit Mit1; n=1; Schizo...    54   5e-06
UniRef50_Q14527 Cluster: Helicase-like transcription factor; n=3...    54   5e-06
UniRef50_A3DI74 Cluster: SNF2-related protein; n=4; Clostridiale...    53   7e-06
UniRef50_A7Q3Y7 Cluster: Chromosome chr13 scaffold_48, whole gen...    53   7e-06
UniRef50_Q22M98 Cluster: SNF2 family N-terminal domain containin...    53   7e-06
UniRef50_A5E1R6 Cluster: DNA repair and recombination protein RA...    53   7e-06
UniRef50_A5DHG4 Cluster: Putative uncharacterized protein; n=1; ...    53   7e-06
UniRef50_Q7NAF6 Cluster: HepA/SNF2; n=1; Mycoplasma gallisepticu...    53   9e-06
UniRef50_Q9U2S8 Cluster: Putative uncharacterized protein; n=2; ...    53   9e-06
UniRef50_Q4UHZ3 Cluster: Recombinational repair (RAD54 homologue...    53   9e-06
UniRef50_A5DDP1 Cluster: Putative uncharacterized protein; n=1; ...    53   9e-06
UniRef50_A0DNE7 Cluster: Chromosome undetermined scaffold_58, wh...    52   1e-05
UniRef50_Q7S8T9 Cluster: Putative uncharacterized protein NCU052...    52   1e-05
UniRef50_Q2HA80 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_Q92698 Cluster: DNA repair and recombination protein RA...    52   1e-05
UniRef50_Q0SU98 Cluster: DNA/RNA helicase, SNF2; n=2; Clostridiu...    52   2e-05
UniRef50_O00914 Cluster: PfSNF2L; n=11; Eukaryota|Rep: PfSNF2L -...    52   2e-05
UniRef50_A5K911 Cluster: DNA repair protein rhp16, putative; n=2...    52   2e-05
UniRef50_Q758Q0 Cluster: AEL297Wp; n=1; Eremothecium gossypii|Re...    52   2e-05
UniRef50_Q5KK83 Cluster: DNA supercoiling, putative; n=2; Filoba...    52   2e-05
UniRef50_Q4P0X0 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_Q2H388 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_O13762 Cluster: ATP-dependent DNA helicase; n=1; Schizo...    52   2e-05
UniRef50_UPI0000499C2F Cluster: RAD54 DNA repair protein; n=1; E...    52   2e-05
UniRef50_UPI00006CF9D4 Cluster: SNF2 family N-terminal domain co...    51   3e-05
UniRef50_Q73RS9 Cluster: Snf2 family protein; n=1; Treponema den...    51   3e-05
UniRef50_Q4QAQ7 Cluster: DNA repair and recombination protein RA...    51   3e-05
UniRef50_Q6BMD3 Cluster: Debaryomyces hansenii chromosome F of s...    51   3e-05
UniRef50_Q1DHG9 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_A6RA37 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_P51532 Cluster: Probable global transcription activator...    51   3e-05
UniRef50_Q5ACX1 Cluster: DNA repair protein RAD5; n=3; Saccharom...    51   3e-05
UniRef50_Q6BZX0 Cluster: Similarities with tr|O60177 Schizosacch...    51   4e-05
UniRef50_UPI0000D55617 Cluster: PREDICTED: similar to SNF2 histo...    50   5e-05
UniRef50_Q7XNH0 Cluster: OSJNBa0096F01.3 protein; n=4; Oryza sat...    50   5e-05
UniRef50_O04082 Cluster: Transcription factor RUSH-1alpha isolog...    50   5e-05
UniRef50_A4S1Y4 Cluster: Predicted protein; n=2; Ostreococcus|Re...    50   5e-05
UniRef50_Q2USX0 Cluster: Helicase-like transcription factor HLTF...    50   5e-05
UniRef50_Q2UMV9 Cluster: Helicase-like transcription factor HLTF...    50   5e-05
UniRef50_Q9FIY7 Cluster: Putative SWI/SNF-related matrix-associa...    50   5e-05
UniRef50_A2FNE0 Cluster: SNF2 family N-terminal domain containin...    50   7e-05
UniRef50_A6QYV5 Cluster: Putative uncharacterized protein; n=1; ...    50   7e-05
UniRef50_A2QWZ3 Cluster: Function: S. pombe Rhp16 is involved in...    50   7e-05
UniRef50_Q830T4 Cluster: Snf2 family protein; n=2; Enterococcus|...    50   9e-05
UniRef50_Q54T24 Cluster: Helicase; n=2; Dictyostelium discoideum...    50   9e-05
UniRef50_Q54RP8 Cluster: SNF2-related domain-containing protein;...    50   9e-05
UniRef50_Q54Q16 Cluster: CHD gene family protein containing chro...    50   9e-05
UniRef50_Q4PH42 Cluster: Putative uncharacterized protein; n=1; ...    50   9e-05
UniRef50_Q0U4P8 Cluster: Putative uncharacterized protein; n=3; ...    50   9e-05
UniRef50_P43610 Cluster: Uncharacterized ATP-dependent helicase ...    50   9e-05
UniRef50_Q9Y620 Cluster: DNA repair and recombination protein RA...    50   9e-05
UniRef50_Q8EUL7 Cluster: Helicase with SNF2 domain; n=1; Mycopla...    49   1e-04
UniRef50_Q00T92 Cluster: Swi2/Snf2-related protein DDM1; decreas...    49   1e-04
UniRef50_Q55A57 Cluster: Putative uncharacterized protein; n=2; ...    49   1e-04
UniRef50_Q4QA20 Cluster: DNA repair protein, putative; n=3; Leis...    49   1e-04
UniRef50_Q1E8B1 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q9LJK7 Cluster: DNA repair protein RAD54-like; n=6; Mag...    49   2e-04
UniRef50_Q08562 Cluster: ATP-dependent helicase RIS1; n=2; Sacch...    49   2e-04
UniRef50_P36607 Cluster: DNA repair protein rad5; n=1; Schizosac...    49   2e-04
UniRef50_A4S2Y5 Cluster: Predicted protein; n=2; Ostreococcus|Re...    48   2e-04
UniRef50_Q5CNL9 Cluster: DNA repair protein RAD54-like; n=2; Cry...    48   2e-04
UniRef50_Q4Z6K3 Cluster: DNA helicase, putative; n=4; Eukaryota|...    48   2e-04
UniRef50_Q6BKC2 Cluster: Helicase SWR1; n=2; Saccharomycetaceae|...    48   2e-04
UniRef50_Q185W7 Cluster: Putative helicase; n=3; Clostridium dif...    48   3e-04
UniRef50_Q25A47 Cluster: H0323C08.5 protein; n=4; Oryza sativa|R...    48   3e-04
UniRef50_A3A7J0 Cluster: Putative uncharacterized protein; n=2; ...    48   3e-04
UniRef50_Q7RKF2 Cluster: DNA repair protein-like-related; n=1; P...    48   3e-04
UniRef50_Q4N399 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q6BHG7 Cluster: Similar to sp|Q10332 Schizosaccharomyce...    48   3e-04
UniRef50_Q4P3Z7 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_A6R6D0 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q09772 Cluster: Meiotic recombination protein rdh54; n=...    48   3e-04
UniRef50_O22731 Cluster: F11P17.13 protein; n=2; Arabidopsis tha...    48   4e-04
UniRef50_Q4Q417 Cluster: Transcription activator; n=7; Trypanoso...    48   4e-04
UniRef50_Q22KF3 Cluster: SNF2 family N-terminal domain containin...    48   4e-04
UniRef50_A7RK66 Cluster: Predicted protein; n=1; Nematostella ve...    48   4e-04
UniRef50_Q2TX77 Cluster: Helicase-like transcription factor HLTF...    48   4e-04
UniRef50_A2QAZ0 Cluster: Complex: human Rad54B; n=11; Eurotiomyc...    48   4e-04
UniRef50_P32597 Cluster: Nuclear protein STH1/NPS1; n=6; Sacchar...    48   4e-04
UniRef50_Q5KPG8 Cluster: DNA repair protein RAD5; n=2; Filobasid...    48   4e-04
UniRef50_Q1FET3 Cluster: SNF2-related:Helicase-like:Zinc finger,...    47   5e-04
UniRef50_Q9XFH4 Cluster: SWI2/SNF2-like protein; n=16; Viridipla...    47   5e-04
UniRef50_O23055 Cluster: YUP8H12.27 protein; n=2; cellular organ...    47   5e-04
UniRef50_Q7SHJ1 Cluster: Putative uncharacterized protein NCU029...    47   5e-04
UniRef50_Q6C4R0 Cluster: Similar to KLLA0F11814g Kluyveromyces l...    47   5e-04
UniRef50_Q2TWR6 Cluster: Helicase-like transcription factor HLTF...    47   5e-04
UniRef50_A5DUS7 Cluster: SNF2-family ATP dependent chromatin rem...    47   5e-04
UniRef50_Q753V5 Cluster: DNA repair protein RAD5; n=1; Eremothec...    47   5e-04
UniRef50_Q1VZW1 Cluster: DEAD/DEAH box helicase-like protein; n=...    47   6e-04
UniRef50_Q0D6A4 Cluster: Os07g0497000 protein; n=4; Oryza sativa...    47   6e-04
UniRef50_A7P2P8 Cluster: Chromosome chr1 scaffold_5, whole genom...    47   6e-04
UniRef50_Q7RQC0 Cluster: DOMINO B-related; n=5; Plasmodium (Vinc...    47   6e-04
UniRef50_Q228K2 Cluster: SNF2 family N-terminal domain containin...    47   6e-04
UniRef50_Q6FK14 Cluster: Similar to sp|P38086 Saccharomyces cere...    47   6e-04
UniRef50_A2R3B8 Cluster: Function: RAD5 of S. cerevisiae has sin...    47   6e-04
UniRef50_O13682 Cluster: Helicase swr1; n=1; Schizosaccharomyces...    47   6e-04
UniRef50_UPI000023F6B4 Cluster: hypothetical protein FG10568.1; ...    46   8e-04
UniRef50_Q2S6W0 Cluster: Superfamily II DNA/RNA helicase, SNF2 f...    46   8e-04
UniRef50_A7FUH3 Cluster: Helicase, SNF2/RAD54 family; n=4; Clost...    46   8e-04
UniRef50_Q9LUS4 Cluster: Similarity to transcription factors; n=...    46   8e-04
UniRef50_Q7XJP0 Cluster: SNF2/SWI2 family global transcription f...    46   8e-04
UniRef50_A4S6V0 Cluster: Predicted protein; n=3; Ostreococcus|Re...    46   8e-04
UniRef50_A4S2D2 Cluster: Predicted protein; n=1; Ostreococcus lu...    46   8e-04
UniRef50_Q4Q883 Cluster: DNA repair protein-like protein; n=3; L...    46   8e-04
UniRef50_Q387H5 Cluster: DNA repair protein, putative; n=2; Tryp...    46   8e-04
UniRef50_Q7SI21 Cluster: Putative uncharacterized protein NCU006...    46   8e-04
UniRef50_Q6C008 Cluster: Similar to DEHA0C17006g Debaryomyces ha...    46   8e-04
UniRef50_Q6BY55 Cluster: Similar to CA2797|IPF8404 Candida albic...    46   8e-04
UniRef50_Q0V1Y5 Cluster: Putative uncharacterized protein; n=1; ...    46   8e-04
UniRef50_A7TFQ5 Cluster: Putative uncharacterized protein; n=1; ...    46   8e-04
UniRef50_A6RXA5 Cluster: Putative uncharacterized protein; n=2; ...    46   8e-04
UniRef50_A6RHB7 Cluster: Predicted protein; n=1; Ajellomyces cap...    46   8e-04
UniRef50_A5DYP3 Cluster: Helicase SWR1; n=2; Saccharomycetaceae|...    46   8e-04
UniRef50_Q6BIP2 Cluster: DNA repair protein RAD5; n=1; Debaryomy...    46   8e-04
UniRef50_Q4RE24 Cluster: Chromosome 10 SCAF15143, whole genome s...    46   0.001
UniRef50_Q97DN1 Cluster: DNA/RNA helicase, SNF2; n=2; Clostridiu...    46   0.001
UniRef50_A2ZYF1 Cluster: Putative uncharacterized protein; n=4; ...    46   0.001
UniRef50_Q4UAK1 Cluster: DEAD-box family (SNF2-like) helicase, p...    46   0.001
UniRef50_Q23KF5 Cluster: Type III restriction enzyme, res subuni...    46   0.001
UniRef50_Q0V2N7 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q0UNL0 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A4RF63 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A4R562 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A3LSV1 Cluster: SNF2 family DNA-dependent ATPase; n=2; ...    46   0.001
UniRef50_Q5K8T2 Cluster: Helicase SWR1; n=1; Filobasidiella neof...    46   0.001
UniRef50_Q59U81 Cluster: Helicase SWR1; n=3; Saccharomycetales|R...    46   0.001
UniRef50_P38086 Cluster: DNA repair and recombination protein RD...    46   0.001
UniRef50_UPI0000499756 Cluster: DNA repair protein RAD54; n=1; E...    46   0.001
UniRef50_Q11P03 Cluster: Superfamily II DNA/RNA helicase, SNF2 f...    46   0.001
UniRef50_A4J9J5 Cluster: SNF2 helicase associated domain protein...    46   0.001
UniRef50_A7APE4 Cluster: DNA repair protein rhp16, putative; n=1...    46   0.001
UniRef50_Q6PK83 Cluster: CHD1L protein; n=6; Eutheria|Rep: CHD1L...    46   0.001
UniRef50_A5YM64 Cluster: CHD1L protein; n=45; Eumetazoa|Rep: CHD...    46   0.001
UniRef50_Q8NIR3 Cluster: Related to DNA repair protein RAD26; n=...    46   0.001
UniRef50_Q2KGE6 Cluster: Putative uncharacterized protein; n=7; ...    46   0.001
UniRef50_Q0CSH0 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q0CCD8 Cluster: Predicted protein; n=1; Aspergillus ter...    46   0.001
UniRef50_A6S4F7 Cluster: Putative uncharacterized protein; n=2; ...    46   0.001
UniRef50_A6S040 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_A0PA46 Cluster: DNA repair and recombination protein MU...    46   0.001
UniRef50_Q6CA87 Cluster: Helicase SWR1; n=1; Yarrowia lipolytica...    46   0.001
UniRef50_Q6CJ38 Cluster: Helicase SWR1; n=2; Saccharomycetaceae|...    46   0.001
UniRef50_Q7S1P9 Cluster: DNA repair protein rad-5; n=5; Pezizomy...    46   0.001
UniRef50_UPI0000DB74BA Cluster: PREDICTED: similar to DNA repair...    45   0.002
UniRef50_A6LWU4 Cluster: Non-specific serine/threonine protein k...    45   0.002
UniRef50_A6DIK8 Cluster: SNF2-related protein; n=2; Bacteria|Rep...    45   0.002
UniRef50_A7R3I3 Cluster: Chromosome undetermined scaffold_525, w...    45   0.002
UniRef50_A5AIW5 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A2FGX6 Cluster: SNF2 family N-terminal domain containin...    45   0.002
UniRef50_Q7SBI2 Cluster: Putative uncharacterized protein NCU061...    45   0.002
UniRef50_Q5KHC6 Cluster: DNA repair protein rad16, putative; n=4...    45   0.002
UniRef50_Q5K9G4 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q2H4Z6 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_Q000Q7 Cluster: RING-13 protein; n=1; Gibberella zeae|R...    45   0.002
UniRef50_A7THE2 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A5DXJ8 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A2QHB0 Cluster: Contig An03c0200, complete genome; n=1;...    45   0.002
UniRef50_Q05471 Cluster: Helicase SWR1; n=3; Saccharomycetaceae|...    45   0.002
UniRef50_Q6CJM4 Cluster: DNA repair protein RAD5; n=1; Kluyverom...    45   0.002
UniRef50_UPI00006CB005 Cluster: SNF2 family N-terminal domain co...    45   0.002
UniRef50_UPI000049868D Cluster: chromodomain-helicase-DNA-bindin...    45   0.002
UniRef50_Q3ICM5 Cluster: Putative DNA helicase with SNF2 domain;...    45   0.002
UniRef50_Q21RH3 Cluster: SNF2-related; n=1; Rhodoferax ferriredu...    45   0.002
UniRef50_Q8IDQ5 Cluster: DNA helicase, putative; n=2; Plasmodium...    45   0.002
UniRef50_Q8IB35 Cluster: ATP-dependant helicase, putative; n=7; ...    45   0.002
UniRef50_Q55C32 Cluster: SNF2-related domain-containing protein;...    45   0.002
UniRef50_Q17L58 Cluster: E1a binding protein P400; n=2; cellular...    45   0.002
UniRef50_A0C011 Cluster: Chromosome undetermined scaffold_14, wh...    45   0.002
UniRef50_Q8SUC5 Cluster: Similarity to THE ATPase COMPONENT OF T...    45   0.002
UniRef50_Q2GSU4 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q0UDA4 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_A6S0R3 Cluster: Putative uncharacterized protein; n=2; ...    45   0.002
UniRef50_A1DC46 Cluster: DNA excision repair protein Rad16, puta...    45   0.002
UniRef50_P47264 Cluster: Uncharacterized ATP-dependent helicase ...    45   0.002
UniRef50_Q6FK48 Cluster: Helicase SWR1; n=1; Candida glabrata|Re...    45   0.002
UniRef50_P22082 Cluster: Transcription regulatory protein SNF2; ...    45   0.002
UniRef50_UPI0000E4914C Cluster: PREDICTED: similar to MGC81081 p...    44   0.003
UniRef50_UPI0000D562AE Cluster: PREDICTED: similar to Transcript...    44   0.003
UniRef50_A2RUZ9 Cluster: LOC553504 protein; n=7; Danio rerio|Rep...    44   0.003
UniRef50_Q97EW0 Cluster: Superfamily II DNA/RNA helicase, SNF2 f...    44   0.003
UniRef50_Q8EP30 Cluster: Helicase; n=1; Oceanobacillus iheyensis...    44   0.003
UniRef50_Q01KF9 Cluster: OSIGBa0158F05.11 protein; n=4; Oryza sa...    44   0.003
UniRef50_Q7QIL9 Cluster: ENSANGP00000007696; n=1; Anopheles gamb...    44   0.003
UniRef50_Q4H3V6 Cluster: ATRX protein; n=1; Ciona intestinalis|R...    44   0.003
UniRef50_Q23D60 Cluster: SNF2 family N-terminal domain containin...    44   0.003
UniRef50_A7RMN4 Cluster: Predicted protein; n=4; Fungi/Metazoa g...    44   0.003
UniRef50_A5K871 Cluster: Putative uncharacterized protein; n=2; ...    44   0.003
UniRef50_Q7S6P9 Cluster: Putative uncharacterized protein NCU047...    44   0.003
UniRef50_Q7RYI6 Cluster: Putative uncharacterized protein NCU064...    44   0.003
UniRef50_Q6BSL5 Cluster: Similar to CA0917|CaRAD16 Candida albic...    44   0.003
UniRef50_Q2H1X5 Cluster: Putative uncharacterized protein; n=2; ...    44   0.003
UniRef50_A7F1B3 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_A7E474 Cluster: Putative uncharacterized protein; n=2; ...    44   0.003
UniRef50_A6SHP4 Cluster: Putative uncharacterized protein; n=2; ...    44   0.003
UniRef50_A6RUI4 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q9H4L7 Cluster: SWI/SNF-related matrix-associated actin...    44   0.003
UniRef50_P32849 Cluster: DNA repair protein RAD5; n=4; Saccharom...    44   0.003
UniRef50_UPI0000F2008D Cluster: PREDICTED: similar to Rad54b; n=...    44   0.004
UniRef50_UPI00015A5AC0 Cluster: UPI00015A5AC0 related cluster; n...    44   0.004
UniRef50_Q14MF0 Cluster: Hypothetical dna/rna helicase protein; ...    44   0.004
UniRef50_A5G9S7 Cluster: Non-specific serine/threonine protein k...    44   0.004
UniRef50_Q5CVY6 Cluster: Brahma like protein with a HSA domain, ...    44   0.004
UniRef50_Q5CVU2 Cluster: SNF2L ortholog with a SWI/SNF2 like ATp...    44   0.004
UniRef50_Q5CR97 Cluster: Chromodomain-helicase-DNA-binding'multi...    44   0.004
UniRef50_Q6W8T1 Cluster: Global transcription activator Snf2p; n...    44   0.004
UniRef50_Q6CVY8 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    44   0.004
UniRef50_Q0V680 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q000Q9 Cluster: RING-11 protein; n=3; Ascomycota|Rep: R...    44   0.004
UniRef50_A6R7Y0 Cluster: DNA repair protein RAD16; n=1; Ajellomy...    44   0.004
UniRef50_A4QSX9 Cluster: Putative uncharacterized protein; n=2; ...    44   0.004
UniRef50_Q4WAS9 Cluster: Helicase swr1; n=8; Eurotiomycetidae|Re...    44   0.004
UniRef50_P31244 Cluster: DNA repair protein RAD16; n=5; Dikarya|...    44   0.004
UniRef50_UPI00006CB14C Cluster: Helicase conserved C-terminal do...    44   0.006
UniRef50_UPI00004991E9 Cluster: ATP-dependent chromatin remodeli...    44   0.006
UniRef50_A7FUA4 Cluster: Helicase, Snf2 family; n=4; Clostridium...    44   0.006
UniRef50_A6EID0 Cluster: Superfamily II DNA/RNA helicase, SNF2 f...    44   0.006
UniRef50_A7R012 Cluster: Chromosome undetermined scaffold_295, w...    44   0.006
UniRef50_Q9U2X2 Cluster: Putative uncharacterized protein; n=1; ...    44   0.006
UniRef50_Q7RRC1 Cluster: DNA repair protein RAD54-like-related; ...    44   0.006
UniRef50_Q4N784 Cluster: DNA-dependent ATPase, putative; n=4; Pi...    44   0.006
UniRef50_A7SAK3 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    44   0.006
UniRef50_A7RPD7 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.006
UniRef50_A5K5P9 Cluster: Helicase, putative; n=1; Plasmodium viv...    44   0.006
UniRef50_Q6M9D6 Cluster: Related to regulator of chromatin; n=2;...    44   0.006
UniRef50_Q0TVK8 Cluster: Putative uncharacterized protein; n=1; ...    44   0.006
UniRef50_O60264 Cluster: SWI/SNF-related matrix-associated actin...    44   0.006
UniRef50_UPI0000E46767 Cluster: PREDICTED: similar to E1a bindin...    43   0.008
UniRef50_Q8YKW6 Cluster: All7172 protein; n=4; Bacteria|Rep: All...    43   0.008
UniRef50_Q011Z0 Cluster: DNA-dependent ATPase, stimulates strand...    43   0.008
UniRef50_A3BK87 Cluster: Putative uncharacterized protein; n=2; ...    43   0.008
UniRef50_Q5CVR4 Cluster: Swr1p like SWI/SNF2 family ATpase with ...    43   0.008
UniRef50_Q54UZ8 Cluster: CHD gene family protein containing chro...    43   0.008
UniRef50_A2EGL7 Cluster: SNF2 family N-terminal domain containin...    43   0.008
UniRef50_A2ED18 Cluster: SNF2 family N-terminal domain containin...    43   0.008
UniRef50_A0BJ14 Cluster: Chromosome undetermined scaffold_11, wh...    43   0.008
UniRef50_Q5KCX1 Cluster: Chromosome organization and biogenesis-...    43   0.008
UniRef50_Q4WTZ0 Cluster: SNF2 family helicase, putative; n=6; Tr...    43   0.008
UniRef50_Q4WLJ7 Cluster: SWI/SNF family DNA-dependent ATPase Ris...    43   0.008
UniRef50_Q0UWG9 Cluster: Putative uncharacterized protein; n=1; ...    43   0.008
UniRef50_A6SB69 Cluster: Putative uncharacterized protein; n=2; ...    43   0.008
UniRef50_A6RW98 Cluster: Putative uncharacterized protein; n=1; ...    43   0.008
UniRef50_A5DXH8 Cluster: SNF2-family ATP dependent chromatin rem...    43   0.008
UniRef50_A2QSB2 Cluster: Contig An08c0250, complete genome; n=1;...    43   0.008
UniRef50_Q4P328 Cluster: Helicase SWR1; n=1; Ustilago maydis|Rep...    43   0.008
UniRef50_Q4PGG5 Cluster: DNA repair protein RAD5; n=1; Ustilago ...    43   0.008
UniRef50_UPI00015B571A Cluster: PREDICTED: similar to conserved ...    43   0.010
UniRef50_UPI0000F1D5F9 Cluster: PREDICTED: similar to MGC131155 ...    43   0.010
UniRef50_UPI0000D56FBA Cluster: PREDICTED: similar to CG9696-PD,...    43   0.010
UniRef50_Q4T1X3 Cluster: Chromosome 1 SCAF10457, whole genome sh...    43   0.010
UniRef50_Q7P5E7 Cluster: SWF/SNF family helicase; n=3; Fusobacte...    43   0.010
UniRef50_Q1U6X3 Cluster: SNF2-related:Helicase-like:Zinc finger,...    43   0.010
UniRef50_Q9LPR7 Cluster: F11F12.23 protein; n=4; Arabidopsis tha...    43   0.010
UniRef50_Q01FM8 Cluster: Chromodomain-helicase-DNA-binding prote...    43   0.010
UniRef50_O48579 Cluster: Mi-2 autoantigen-like protein; n=4; Bra...    43   0.010
UniRef50_Q86L97 Cluster: Similar to Arabidopsis thaliana (Mouse-...    43   0.010
UniRef50_Q6FSM2 Cluster: Similar to tr|Q08562 Saccharomyces cere...    43   0.010
UniRef50_Q6E6B6 Cluster: Global transcription activator; n=1; An...    43   0.010
UniRef50_Q4WTZ1 Cluster: SNF2 family helicase/ATPase, putative; ...    43   0.010
UniRef50_A4R8K5 Cluster: Putative uncharacterized protein; n=1; ...    43   0.010
UniRef50_Q7G8Y3 Cluster: Probable chromatin-remodeling complex A...    43   0.010
UniRef50_Q8TD26 Cluster: Chromodomain-helicase-DNA-binding prote...    43   0.010
UniRef50_UPI000023DF9C Cluster: hypothetical protein FG08223.1; ...    42   0.013
UniRef50_UPI0000DC2237 Cluster: RIKEN cDNA D030022P06 gene; n=6;...    42   0.013
UniRef50_Q4RLJ2 Cluster: Chromosome undetermined SCAF15020, whol...    42   0.013
UniRef50_Q8A2F2 Cluster: Snf2 family helicase; n=3; Bacteroides|...    42   0.013
UniRef50_Q1PXL4 Cluster: Putative uncharacterized protein; n=1; ...    42   0.013
UniRef50_Q8GZN6 Cluster: SNF2P; n=9; Magnoliophyta|Rep: SNF2P - ...    42   0.013
UniRef50_Q5DAR8 Cluster: SJCHGC06070 protein; n=1; Schistosoma j...    42   0.013
UniRef50_Q4DFG2 Cluster: Helicase, putative; n=1; Trypanosoma cr...    42   0.013
UniRef50_A0BMB8 Cluster: Chromosome undetermined scaffold_116, w...    42   0.013
UniRef50_O15026 Cluster: KIAA0309 protein; n=17; Eutheria|Rep: K...    42   0.013
UniRef50_Q75EC7 Cluster: AAR147Wp; n=1; Eremothecium gossypii|Re...    42   0.013
UniRef50_Q6C828 Cluster: Similar to sp|P22082 Saccharomyces cere...    42   0.013
UniRef50_Q6BJE1 Cluster: Debaryomyces hansenii chromosome G of s...    42   0.013
UniRef50_Q4X0I4 Cluster: SNF2 family helicase/ATPase, putative; ...    42   0.013
UniRef50_Q0CAC0 Cluster: Predicted protein; n=1; Aspergillus ter...    42   0.013
UniRef50_Q0CA85 Cluster: SNF2-family ATP dependent chromatin rem...    42   0.013
UniRef50_A5DVY2 Cluster: DNA repair protein RAD16; n=5; Saccharo...    42   0.013
UniRef50_A4R9Y7 Cluster: Putative uncharacterized protein; n=1; ...    42   0.013
UniRef50_A3LW89 Cluster: Helicase; n=3; Saccharomycetales|Rep: H...    42   0.013
UniRef50_Q149N8 Cluster: E3 ubiquitin-protein ligase SHPRH; n=42...    42   0.013
UniRef50_Q8ELY8 Cluster: Helicase; n=1; Oceanobacillus iheyensis...    42   0.018
UniRef50_Q3ICR3 Cluster: Putative uncharacterized protein; n=2; ...    42   0.018
UniRef50_Q9ZW97 Cluster: F11M21.32 protein; n=8; Magnoliophyta|R...    42   0.018
UniRef50_Q6EVK6 Cluster: Putative SNF2 subfamily ATPase; n=4; Ar...    42   0.018
UniRef50_Q01EV3 Cluster: Swr1 Swr1-Pie_related helicase; n=1; Os...    42   0.018
UniRef50_A7QNM4 Cluster: Chromosome undetermined scaffold_133, w...    42   0.018
UniRef50_Q9NDJ2 Cluster: Helicase DOMINO A; n=14; cellular organ...    42   0.018
UniRef50_Q7Z2C2 Cluster: Snf2-related chromatin remodeling facto...    42   0.018
UniRef50_Q7QJC5 Cluster: ENSANGP00000019059; n=2; Culicidae|Rep:...    42   0.018
UniRef50_Q55GQ9 Cluster: Putative uncharacterized protein; n=1; ...    42   0.018
UniRef50_Q4UCU5 Cluster: Global transcription activator, SNF2 fa...    42   0.018
UniRef50_Q4Q0P3 Cluster: Helicase, putative; n=3; Leishmania|Rep...    42   0.018
UniRef50_O61845 Cluster: Temporarily assigned gene name protein ...    42   0.018
UniRef50_A2FSS0 Cluster: SNF2 family N-terminal domain containin...    42   0.018
UniRef50_Q4WH62 Cluster: SWI/SNF family DNA-dependent ATPase, pu...    42   0.018
UniRef50_Q1DUL0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.018
UniRef50_Q0U9J5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.018
UniRef50_O42861 Cluster: Uncharacterized ATP-dependent helicase ...    42   0.018
UniRef50_O94421 Cluster: SNF2 family ATP-dependent chromatin-rem...    42   0.018
UniRef50_P38144 Cluster: ISWI chromatin-remodeling complex ATPas...    42   0.018
UniRef50_UPI0000E81954 Cluster: PREDICTED: similar to RP11-346B7...    42   0.023
UniRef50_UPI0000E49E54 Cluster: PREDICTED: similar to MGC108253 ...    42   0.023
UniRef50_UPI000065EC84 Cluster: Homolog of Homo sapiens "Chromod...    42   0.023
UniRef50_Q4REI9 Cluster: Chromosome 10 SCAF15123, whole genome s...    42   0.023
UniRef50_A6L6P6 Cluster: Helicase with SNF2 domain; n=1; Bactero...    42   0.023
UniRef50_A4C3V7 Cluster: Putative DNA helicase with SNF2 domain;...    42   0.023
UniRef50_A2U7V6 Cluster: SNF2 helicase associated; n=1; Bacillus...    42   0.023
UniRef50_Q0D6W2 Cluster: Os07g0434500 protein; n=11; Oryza sativ...    42   0.023
UniRef50_A2Y0B5 Cluster: Putative uncharacterized protein; n=2; ...    42   0.023
UniRef50_Q5CQM5 Cluster: Swi2/Snf2 ATpase,Rad16 ortholog; n=2; C...    42   0.023
UniRef50_Q580T1 Cluster: SNF2 DNA repair protein, putative; n=1;...    42   0.023
UniRef50_A2FPM0 Cluster: F/Y-rich N-terminus family protein; n=1...    42   0.023
UniRef50_A0BRC7 Cluster: Chromosome undetermined scaffold_122, w...    42   0.023
UniRef50_Q6CUF0 Cluster: Similarities with sgd|S0005717 Saccharo...    42   0.023
UniRef50_Q6CIQ3 Cluster: Similar to sgd|S0005831 Saccharomyces c...    42   0.023
UniRef50_Q4WL05 Cluster: SWI/SNF family DNA-dependent ATPase, pu...    42   0.023
UniRef50_Q1EA65 Cluster: Putative uncharacterized protein; n=1; ...    42   0.023
UniRef50_Q0UHP0 Cluster: Putative uncharacterized protein; n=1; ...    42   0.023
UniRef50_A7TPE3 Cluster: Putative uncharacterized protein; n=1; ...    42   0.023
UniRef50_A1DFF5 Cluster: DNA excision repair protein (Rad26L), p...    42   0.023
UniRef50_A5MR54 Cluster: Snf2 family protein, putative; n=1; Str...    41   0.031
UniRef50_Q9FWY5 Cluster: T14P4.5 protein; n=1; Arabidopsis thali...    41   0.031
UniRef50_Q5BN47 Cluster: SPLAYED splice variant; n=8; core eudic...    41   0.031
UniRef50_Q0JAZ5 Cluster: Os04g0566100 protein; n=1; Oryza sativa...    41   0.031
UniRef50_A5BAL8 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_Q7QWA1 Cluster: GLP_177_26570_34507; n=1; Giardia lambl...    41   0.031
UniRef50_Q54NM0 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_Q54KQ4 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_A7RQM3 Cluster: Predicted protein; n=1; Nematostella ve...    41   0.031
UniRef50_A0BWP0 Cluster: Chromosome undetermined scaffold_132, w...    41   0.031
UniRef50_Q5T890 Cluster: Chromosome 9 open reading frame 102; n=...    41   0.031
UniRef50_Q7SAR3 Cluster: Putative uncharacterized protein NCU079...    41   0.031
UniRef50_Q6BTU7 Cluster: Similarities with sp|P31380 Saccharomyc...    41   0.031
UniRef50_Q5KI59 Cluster: Pol II transcription elongation factor,...    41   0.031
UniRef50_Q1DUU1 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_A7ET44 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_A5DDL0 Cluster: Putative uncharacterized protein; n=1; ...    41   0.031
UniRef50_P25439 Cluster: Homeotic gene regulator; n=23; Bilateri...    41   0.031
UniRef50_UPI00015B4C88 Cluster: PREDICTED: similar to helicase; ...    41   0.041
UniRef50_UPI000065F41C Cluster: Homolog of Homo sapiens "OTTHUMP...    41   0.041
UniRef50_Q9RUX1 Cluster: DNA helicase, SNF2/RAD54 family; n=3; B...    41   0.041
UniRef50_Q893H4 Cluster: SWF/SNF family helicase; n=7; cellular ...    41   0.041
UniRef50_Q4ITJ2 Cluster: SNF2 related domain:Helicase, C-termina...    41   0.041
UniRef50_Q41HD1 Cluster: SNF2-related:Helicase, C-terminal:SWIM ...    41   0.041
UniRef50_A6TKV3 Cluster: Non-specific serine/threonine protein k...    41   0.041
UniRef50_Q69WP6 Cluster: SWI/SNF-related matrix-associated actin...    41   0.041
UniRef50_A7PZI5 Cluster: Chromosome chr15 scaffold_40, whole gen...    41   0.041
UniRef50_Q54CF8 Cluster: CHD gene family protein containing chro...    41   0.041
UniRef50_Q4DWT5 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_A3FPW3 Cluster: SNF2 helicase, putative; n=3; Cryptospo...    41   0.041
UniRef50_Q4PFD0 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_Q2H2K6 Cluster: Putative uncharacterized protein; n=2; ...    41   0.041
UniRef50_Q0U9C6 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_A7F4M5 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_A6RAI3 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_A4R091 Cluster: Putative uncharacterized protein; n=1; ...    41   0.041
UniRef50_Q7S133 Cluster: Helicase swr-1; n=3; Sordariomycetes|Re...    41   0.041
UniRef50_Q9HCK8 Cluster: Chromodomain-helicase-DNA-binding prote...    41   0.041
UniRef50_UPI0000E496EE Cluster: PREDICTED: similar to PASG; n=2;...    40   0.054
UniRef50_UPI0000DB7BCE Cluster: PREDICTED: similar to helicase, ...    40   0.054
UniRef50_UPI00006A0EF1 Cluster: Chromodomain-helicase-DNA-bindin...    40   0.054
UniRef50_Q9PLL8 Cluster: Helicase, Snf2 family; n=11; Chlamydial...    40   0.054
UniRef50_Q1MS02 Cluster: Superfamily II DNA/RNA helicases, SNF2 ...    40   0.054
UniRef50_A5ZF77 Cluster: Putative uncharacterized protein; n=2; ...    40   0.054
UniRef50_A3TJ52 Cluster: SNF2-like; n=1; Janibacter sp. HTCC2649...    40   0.054
UniRef50_Q6Z7C5 Cluster: SNF2 domain/helicase domain-containing ...    40   0.054
UniRef50_A7R048 Cluster: Chromosome chr10 scaffold_297, whole ge...    40   0.054
UniRef50_A5BD00 Cluster: Putative uncharacterized protein; n=1; ...    40   0.054
UniRef50_Q4Q9N4 Cluster: Helicase-like protein, putative; n=3; L...    40   0.054
UniRef50_Q383K6 Cluster: SNF2 DNA repair protein, putative; n=1;...    40   0.054
UniRef50_Q17II9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.054
UniRef50_O45609 Cluster: Putative uncharacterized protein; n=2; ...    40   0.054
UniRef50_A2DYG3 Cluster: F/Y-rich N-terminus family protein; n=1...    40   0.054
UniRef50_Q6CBQ0 Cluster: Yarrowia lipolytica chromosome C of str...    40   0.054
UniRef50_Q6C2X3 Cluster: Similarities with sp|P43610 Saccharomyc...    40   0.054
UniRef50_Q5BB25 Cluster: Putative uncharacterized protein; n=1; ...    40   0.054
UniRef50_Q2H728 Cluster: Putative uncharacterized protein; n=1; ...    40   0.054
UniRef50_Q0UXB2 Cluster: Putative uncharacterized protein; n=2; ...    40   0.054
UniRef50_A2Q9U8 Cluster: Contig An01c0310, complete genome; n=8;...    40   0.054
UniRef50_UPI00015B6257 Cluster: PREDICTED: similar to chromodoma...    40   0.071
UniRef50_UPI0000499723 Cluster: chromodomain-helicase-DNA-bindin...    40   0.071
UniRef50_Q6MEA0 Cluster: Putative rapA, a bacterial member of th...    40   0.071
UniRef50_Q2LY67 Cluster: Swf/snf family helicase; n=1; Syntrophu...    40   0.071
UniRef50_A0GR34 Cluster: SNF2-related; n=2; Burkholderia|Rep: SN...    40   0.071
UniRef50_Q0DYI8 Cluster: Os02g0689800 protein; n=4; Oryza sativa...    40   0.071
UniRef50_Q9VPL9 Cluster: CG3696-PA, isoform A; n=12; Diptera|Rep...    40   0.071
UniRef50_A7RSV8 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.071
UniRef50_A4HH28 Cluster: Putative uncharacterized protein; n=3; ...    40   0.071
UniRef50_A2FI37 Cluster: SNF2 family N-terminal domain containin...    40   0.071
UniRef50_A2D9P9 Cluster: F/Y-rich N-terminus family protein; n=1...    40   0.071
UniRef50_Q6CSV4 Cluster: Similar to sp|P32657 Saccharomyces cere...    40   0.071
UniRef50_Q5K8L9 Cluster: SWI/SNF related, matrix associated, act...    40   0.071
UniRef50_Q1DUK8 Cluster: Putative uncharacterized protein; n=1; ...    40   0.071
UniRef50_Q0UL42 Cluster: Putative uncharacterized protein; n=1; ...    40   0.071
UniRef50_A4RMS0 Cluster: Putative uncharacterized protein; n=4; ...    40   0.071
UniRef50_UPI0000D5799D Cluster: PREDICTED: similar to CG3696-PA,...    40   0.094
UniRef50_UPI00006CA407 Cluster: SNF2 family N-terminal domain co...    40   0.094
UniRef50_Q4T2N8 Cluster: Chromosome undetermined SCAF10218, whol...    40   0.094
UniRef50_Q9D5K6 Cluster: Adult male testis cDNA, RIKEN full-leng...    40   0.094
UniRef50_Q8Y6P0 Cluster: Lmo1644 protein; n=11; Listeria|Rep: Lm...    40   0.094
UniRef50_Q7NIB7 Cluster: Glr2266 protein; n=2; Cyanobacteria|Rep...    40   0.094
UniRef50_A6DU14 Cluster: Putative uncharacterized protein; n=1; ...    40   0.094
UniRef50_A3HPW9 Cluster: SNF2-related protein; n=1; Pseudomonas ...    40   0.094
UniRef50_Q3E9C2 Cluster: Uncharacterized protein At5g19310.1; n=...    40   0.094
UniRef50_Q5WRS6 Cluster: Putative uncharacterized protein T05A12...    40   0.094
UniRef50_Q29ND9 Cluster: GA19213-PA; n=1; Drosophila pseudoobscu...    40   0.094
UniRef50_A2EX18 Cluster: F/Y-rich N-terminus family protein; n=1...    40   0.094
UniRef50_Q75BI5 Cluster: ACR286Cp; n=2; Saccharomycetaceae|Rep: ...    40   0.094
UniRef50_Q4WV56 Cluster: SNF2 family helicase, putative; n=3; Tr...    40   0.094
UniRef50_A4QXP3 Cluster: Putative uncharacterized protein; n=1; ...    40   0.094
UniRef50_P31380 Cluster: Uncharacterized ATP-dependent helicase ...    40   0.094
UniRef50_Q03468 Cluster: DNA excision repair protein ERCC-6; n=2...    40   0.094
UniRef50_P32657 Cluster: Chromo domain-containing protein 1; n=1...    40   0.094
UniRef50_UPI00015B5B49 Cluster: PREDICTED: hypothetical protein;...    39   0.12 
UniRef50_UPI0000F1D9E5 Cluster: PREDICTED: similar to chromodoma...    39   0.12 
UniRef50_Q4SNT6 Cluster: Chromosome 15 SCAF14542, whole genome s...    39   0.12 
UniRef50_Q4SCU8 Cluster: Chromosome undetermined SCAF14648, whol...    39   0.12 
UniRef50_Q8YP09 Cluster: Alr4398 protein; n=8; Cyanobacteria|Rep...    39   0.12 
UniRef50_Q7ULR2 Cluster: Probable swi/snf family helicase 2; n=1...    39   0.12 
UniRef50_Q0F0J4 Cluster: Superfamily II DNA/RNA helicase, SNF2 f...    39   0.12 
UniRef50_Q17C31 Cluster: Chromodomain helicase DNA binding prote...    39   0.12 
UniRef50_O16283 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q9HE51 Cluster: Putative uncharacterized protein B2F7.1...    39   0.12 
UniRef50_Q0UG06 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_Q0CVP0 Cluster: Predicted protein; n=1; Aspergillus ter...    39   0.12 
UniRef50_A6RHB8 Cluster: Putative uncharacterized protein; n=1; ...    39   0.12 
UniRef50_A2QB33 Cluster: Putative sequencing error; n=1; Aspergi...    39   0.12 
UniRef50_O97159 Cluster: Chromodomain-helicase-DNA-binding prote...    39   0.12 
UniRef50_Q9P2D1 Cluster: Chromodomain-helicase-DNA-binding prote...    39   0.12 
UniRef50_UPI00015B6064 Cluster: PREDICTED: similar to hCG32740; ...    39   0.16 
UniRef50_UPI0000E46B6E Cluster: PREDICTED: similar to Rad54b; n=...    39   0.16 
UniRef50_UPI0000D56DCA Cluster: PREDICTED: similar to CG5899-PA,...    39   0.16 
UniRef50_Q83GW3 Cluster: DNA helicase; n=2; Tropheryma whipplei|...    39   0.16 
UniRef50_Q7UGF2 Cluster: Helicase, Snf2 family; n=1; Pirellula s...    39   0.16 
UniRef50_A1U3V7 Cluster: SNF2-related protein; n=1; Marinobacter...    39   0.16 
UniRef50_Q9M2L7 Cluster: Helicase-like protein; n=3; Arabidopsis...    39   0.16 
UniRef50_Q017V0 Cluster: SNF2 domain-containing protein / helica...    39   0.16 
UniRef50_Q9VL72 Cluster: CG5899-PA, isoform A; n=5; Diptera|Rep:...    39   0.16 
UniRef50_Q93781 Cluster: Putative uncharacterized protein csb-1;...    39   0.16 
UniRef50_Q4UIX6 Cluster: DEAD-box family helicase, putative; n=2...    39   0.16 
UniRef50_Q2N125 Cluster: SWI/SNF-related matrix-associated regul...    39   0.16 
UniRef50_Q241C2 Cluster: HSA family protein; n=5; Oligohymenopho...    39   0.16 
UniRef50_Q22944 Cluster: Putative uncharacterized protein; n=1; ...    39   0.16 
UniRef50_Q17E27 Cluster: Helicase; n=2; Culicidae|Rep: Helicase ...    39   0.16 
UniRef50_A0C3B5 Cluster: Chromosome undetermined scaffold_147, w...    39   0.16 
UniRef50_Q8SWP7 Cluster: Similarity to CHROMODOMAIN HELICASE DNA...    39   0.16 
UniRef50_Q6MW11 Cluster: Related to helicase-DNA-binding protein...    39   0.16 
UniRef50_A1D7K8 Cluster: SNF2 family helicase/ATPase, putative; ...    39   0.16 
UniRef50_UPI000155BECB Cluster: PREDICTED: similar to similar nu...    38   0.22 
UniRef50_Q4AEQ9 Cluster: SNF2-related:Helicase, C-terminal:Type ...    38   0.22 
UniRef50_Q0LLC4 Cluster: SNF2-related; n=2; Herpetosiphon aurant...    38   0.22 
UniRef50_A6G647 Cluster: SNF2/helicase domain protein; n=1; Ples...    38   0.22 

>UniRef50_P41447 Cluster: Probable global transactivator; n=11;
           Nucleopolyhedrovirus|Rep: Probable global transactivator
           - Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 506

 Score =  187 bits (456), Expect = 2e-46
 Identities = 83/90 (92%), Positives = 87/90 (96%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKI 182
           ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN+PRVWKMLNKNNDSTNRIKSIIKKI
Sbjct: 175 ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNNPRVWKMLNKNNDSTNRIKSIIKKI 234

Query: 183 VLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           VLKRDKSEIS NIPKHTVEYVHVN  +++K
Sbjct: 235 VLKRDKSEISSNIPKHTVEYVHVNFNEEEK 264



 Score =  179 bits (436), Expect = 6e-44
 Identities = 80/85 (94%), Positives = 84/85 (98%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           FNEEEKTLYDKLKCESEEAY+KAVAARE+EN LSRLQQMQHVLWLILKLRQICCHPYLAM
Sbjct: 259 FNEEEKTLYDKLKCESEEAYVKAVAARENENALSRLQQMQHVLWLILKLRQICCHPYLAM 318

Query: 434 HGRNLLETNDCFKMDYMSSKCKRVL 508
           HG+N+LETNDCFKMDYMSSKCKRVL
Sbjct: 319 HGKNILETNDCFKMDYMSSKCKRVL 343



 Score =  169 bits (412), Expect = 5e-41
 Identities = 81/84 (96%), Positives = 84/84 (100%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           LVDDILNTS+DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN+AA
Sbjct: 345 LVDDILNTSNDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNDAA 404

Query: 691 DTQHRILLLSIKCGGVGLNLIGGN 762
           +TQHRILLLSIKCGGVGLNLIGGN
Sbjct: 405 NTQHRILLLSIKCGGVGLNLIGGN 428


>UniRef50_UPI000051A1F5 Cluster: PREDICTED: similar to lodestar
           CG2684-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to lodestar CG2684-PA - Apis mellifera
          Length = 954

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 7/91 (7%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A+ RW +TGTPI NK  D+YS++ FL+C PF+D RVWK  + NKN     R+ +++K 
Sbjct: 527 LLASKRWALTGTPIQNKEMDLYSILKFLKCSPFDDLRVWKRWVDNKNAAGRQRLVTVMKT 586

Query: 180 IVLKRDKSEISFN-----IPKHTVEYVHVNL 257
           ++L+R K E+  N     +P+  VE + + L
Sbjct: 587 LMLRRTKQELQINGMLESLPEKFVEEIFIKL 617



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 35/86 (40%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQ-KNIATLMYTGQLKVEDRILAETTFNNAA 690
            V +IL   +DK+I+VSQW   L I  +     K+ +  M+TG + +++R     +FN + 
Sbjct: 791  VKEILE-KNDKLIIVSQWTSTLNIIASCLSSIKDASFDMFTGSVPIKERQGIMDSFNTS- 848

Query: 691  DTQHRILLLSIKCGGVGLNLIGGNTL 768
            + + +ILLLS+  GGVGLNL+GGN L
Sbjct: 849  NNKPKILLLSLTAGGVGLNLVGGNHL 874


>UniRef50_UPI00015B57FD Cluster: PREDICTED: similar to CG2684-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG2684-PA - Nasonia vitripennis
          Length = 1032

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 35/91 (38%), Positives = 60/91 (65%), Gaps = 7/91 (7%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           LTA +RW +TGTPI NK  D+Y+++ FL+C PF+D +VWK  + NKN+    R+ +I+K 
Sbjct: 629 LTAKHRWALTGTPIQNKEMDLYAILKFLKCSPFDDLQVWKRWVDNKNDAGKQRLITIMKG 688

Query: 180 IVLKRDKSEISF-----NIPKHTVEYVHVNL 257
           ++L+R K E+       ++P  ++E + + +
Sbjct: 689 LMLRRTKQELQAKGSLDSLPDKSIELIEIEM 719



 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 1/94 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIF-ENFFKQKNIATLMYTGQLKVEDRILA 666
            +V+     +++IL   D KII+VSQW  +L I  +N    ++    M+TG + V++R   
Sbjct: 863  KVRAIVKTIEEILEKGD-KIIVVSQWTSFLGIVAKNLDDIEDAKYAMFTGNVAVKNRQAI 921

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
               FN+  +  + ILLLS+  GGVGLNL+G N L
Sbjct: 922  VDKFNDPNEDTN-ILLLSLTAGGVGLNLVGANHL 954


>UniRef50_UPI0000D574D6 Cluster: PREDICTED: similar to CG2684-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2684-PA - Tribolium castaneum
          Length = 863

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 29/70 (41%), Positives = 48/70 (68%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L+  +RW +TGTP+HNK  DMY++  FL+C PF+D  VWK  + +K+     R+ ++I  
Sbjct: 440 LSGKSRWALTGTPVHNKELDMYAIFKFLRCSPFDDLHVWKHWVGDKSTGGAMRLHAVISS 499

Query: 180 IVLKRDKSEI 209
           ++L+R K+E+
Sbjct: 500 LMLRRTKAEL 509



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 28/79 (35%), Positives = 44/79 (55%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           + +DK I+VSQW   L +     + + I      G + V+ R+     FN+  ++  ++L
Sbjct: 705 SGEDKAIVVSQWTSLLHLVAIHLENEGIPYASLDGSVVVQKRMPIVDNFNDP-NSATKVL 763

Query: 712 LLSIKCGGVGLNLIGGNTL 768
           LLS+  GGVGLNL+G N L
Sbjct: 764 LLSLTAGGVGLNLVGANHL 782



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 16/28 (57%), Positives = 24/28 (85%), Gaps = 2/28 (7%)
 Frame = +2

Query: 350 LSRLQQM-QH-VLWLILKLRQICCHPYL 427
           L+R++++ QH +L L+L+LRQICCHP L
Sbjct: 589 LNRVKEVSQHEILVLLLRLRQICCHPSL 616


>UniRef50_P34739 Cluster: Transcription termination factor 2; n=4;
            Diptera|Rep: Transcription termination factor 2 -
            Drosophila melanogaster (Fruit fly)
          Length = 1061

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 39/86 (45%), Positives = 51/86 (59%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            L   IL +SDDK I+VSQW   L I  +   +  +ATL   G + V++R      FN+  
Sbjct: 899  LKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFND-R 957

Query: 691  DTQHRILLLSIKCGGVGLNLIGGNTL 768
            + Q R+LLLS+  GGVGLNLIG N L
Sbjct: 958  NNQKRVLLLSLTAGGVGLNLIGANHL 983



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/90 (33%), Positives = 56/90 (62%), Gaps = 7/90 (7%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKKIVLKR 194
           RW +TGTPI NK  D+Y+++ FL+C PF+D   WK  + NK+    NR+  ++K ++L+R
Sbjct: 627 RWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRR 686

Query: 195 DKSEISF-----NIPKHTVEYVHVNLMKKK 269
            K+++       ++P   +  + ++L K++
Sbjct: 687 TKAQLQSDGKLNSLPNKELRLIEISLDKEE 716



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQH-VLWLILKLRQICCHPYL 427
           ++  K  Y+++K +   AY K +  + +    S+ +   H +L L+L+LRQICCHP L
Sbjct: 749 SDANKPTYNQIK-DPNGAYYK-MHEKFARMAGSKKEVKSHDILVLLLRLRQICCHPGL 804


>UniRef50_Q5TMS7 Cluster: ENSANGP00000028812; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000028812 - Anopheles gambiae
           str. PEST
          Length = 813

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 35/88 (39%), Positives = 53/88 (60%), Gaps = 7/88 (7%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKKIVLKR 194
           RW +TGTPI NK  D+Y+++ FL+C PFND   WK  + NK      R+ +I+K I+L+R
Sbjct: 361 RWLLTGTPIQNKEMDVYALMKFLRCTPFNDLVHWKRWIDNKTAGGAMRLNTIMKSIMLRR 420

Query: 195 DKSEIS-----FNIPKHTVEYVHVNLMK 263
            K ++       ++P  T+E + V L K
Sbjct: 421 TKKQLQERGALTSLPSKTIEIIEVQLEK 448



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 31/93 (33%), Positives = 56/93 (60%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
           +++ +  L+++ +  +DDK I+VSQW   L I      ++N+  +  TG+++V+ R    
Sbjct: 643 KIEKTMQLLEEKIFHTDDKAIIVSQWTSMLDILATHLSERNVPFVSLTGKVQVKFRNDIV 702

Query: 670 TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             FN  +  + +++LLS+  GGVGLNL+G N L
Sbjct: 703 LDFNKPSG-KSKVMLLSLTAGGVGLNLVGANHL 734


>UniRef50_O17550 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 1091

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 28/69 (40%), Positives = 47/69 (68%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L+A +RWC++GTPIHN  WD+YS++ FL+ RPF+D + WK  ++       +R+  + K 
Sbjct: 675 LSAFSRWCLSGTPIHNNLWDLYSLVRFLRIRPFSDDKYWKESIMPMKPIMADRVNLLTKN 734

Query: 180 IVLKRDKSE 206
           ++L+R K +
Sbjct: 735 LLLRRTKDQ 743



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 37/111 (33%), Positives = 57/111 (51%)
 Frame = +1

Query: 436  R*KSFGNKRLF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNI 615
            R K     R+F       +++ +  +V++I+   + K+++VSQW   L + E   K    
Sbjct: 900  RDKPRATTRIFDPDYLSCKIKNTLEIVENIMEKKE-KVVIVSQWTSVLNLIEIHIKSSGF 958

Query: 616  ATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                 TGQ+ V+DR     +FN       R++LLS+  GGVGLNL GGN L
Sbjct: 959  KYTSITGQVLVKDRQERVDSFNREKGGA-RVMLLSLAAGGVGLNLTGGNHL 1008


>UniRef50_Q2WBW9 Cluster: Lodestar protein; n=2; Platynereis
           dumerilii|Rep: Lodestar protein - Platynereis dumerilii
           (Dumeril's clam worm)
          Length = 1244

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 2/71 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++ ++WK  + NK++    R+ ++IK 
Sbjct: 785 LRAGVRWALTGTPIQNDLLDMYSLLRFLRCSPFDEYKLWKRQVDNKSDKGQQRLNTLIKT 844

Query: 180 IVLKRDKSEIS 212
           ++L+R K E S
Sbjct: 845 LLLRRTKDETS 855



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/75 (36%), Positives = 40/75 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K ++VSQW + L + E   K + +      G +  + R      FN  +     ++LLS+
Sbjct: 1058 KCVIVSQWTKMLDVIEYHLKSEGVQCCSIRGDMPPKKRSEIVDLFNTPSSGPE-VMLLSL 1116

Query: 724  KCGGVGLNLIGGNTL 768
            + GGVGLNLIGGN L
Sbjct: 1117 RAGGVGLNLIGGNHL 1131


>UniRef50_Q61BT8 Cluster: Putative uncharacterized protein CBG13225;
            n=1; Caenorhabditis briggsae|Rep: Putative
            uncharacterized protein CBG13225 - Caenorhabditis
            briggsae
          Length = 1077

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 37/102 (36%), Positives = 57/102 (55%)
 Frame = +1

Query: 463  LF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL 642
            +F  G    ++Q +  +V+DIL   + K+++VSQW   L + E   +         TGQ+
Sbjct: 896  IFDTGYISCKMQKTLEIVEDILEKKE-KVVIVSQWTSVLNLVEQHIQNGGHNYTSITGQV 954

Query: 643  KVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            +V+DR     +FN       R++LLS+  GGVGLNL+GGN L
Sbjct: 955  QVKDRQERVDSFNQEKGGA-RVMLLSLTAGGVGLNLVGGNHL 995



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 27/69 (39%), Positives = 47/69 (68%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L+A +RWC++GTPIHN  WD+YS+I FL+   F+D + W+  ++     S++R+  + K 
Sbjct: 655 LSAFSRWCLSGTPIHNNLWDLYSLIKFLRIPLFSDRKFWQESIMPMKTMSSDRVNLLTKN 714

Query: 180 IVLKRDKSE 206
           ++L+R K +
Sbjct: 715 LLLRRTKDQ 723


>UniRef50_Q54SZ4 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1640

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/85 (37%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPF-NDPRVWKMLNKNNDSTNRIKSIIKKI 182
            L A ++WC++GTPI N   D+Y  ++FL C P   D + W+ L     +   +K +I  I
Sbjct: 1166 LDAIHKWCLSGTPISNYLDDIYPSLHFLNCYPIAQDLKTWRKLIDRPKNLELLKKVINPI 1225

Query: 183  VLKRDKSEI-SFNIPKHTVEYVHVN 254
            +L+R+KSEI  F +PK   E V+++
Sbjct: 1226 LLRREKSEILDFKLPKKNKEIVYLD 1250



 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQ----KNIATLMYTGQLKVEDRILAETTF 678
            L+D+  N +D+K ++VSQW   L + E   KQ    KN   + Y G+   + +  A    
Sbjct: 1467 LIDNEDN-ADEKCLIVSQWTSMLDLIEESLKQNHWVKNTHYVRYDGRCSHQQKDKAIKQL 1525

Query: 679  NNAADTQHRILLLSIKCGGVGLNLIGGN 762
            N   D   R++L+S+K GGVGLNL   N
Sbjct: 1526 NEDDDV--RVMLVSLKSGGVGLNLTRAN 1551


>UniRef50_A0BG98 Cluster: Chromosome undetermined scaffold_105, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_105, whole genome
            shotgun sequence - Paramecium tetraurelia
          Length = 1215

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 4/95 (4%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-MLNK--NNDSTNRI-KSI 170
            +L +  RWC+TGTP+ NKH D++S++ FLQ   F++   W   +NK  N D   RI   I
Sbjct: 785  SLQSQFRWCLTGTPMQNKHDDLFSLLQFLQVETFSEYFWWNTYINKEENEDDQQRILAQI 844

Query: 171  IKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            ++ I+L+R K+   F   +  +E +H   + +K+R
Sbjct: 845  LQPIILRRTKNSQQFEGLQQVIENIHWVELDQKER 879



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 23/67 (34%), Positives = 35/67 (52%)
 Frame = +2

Query: 257  NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMH 436
            +++E+ LY KL   S+  +   V     +NT +  Q   H+  +I KLR  C HP LA+ 
Sbjct: 875  DQKERMLYKKLLSGSQNLFKSFV-----KNTSN--QSYVHIFQIINKLRVACNHPQLALK 927

Query: 437  GRNLLET 457
              NL +T
Sbjct: 928  DINLQQT 934


>UniRef50_Q9VHY2 Cluster: CG10445-PA; n=2; Drosophila
            melanogaster|Rep: CG10445-PA - Drosophila melanogaster
            (Fruit fly)
          Length = 965

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 33/79 (41%), Positives = 50/79 (63%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            ++++L  ++DKII+ SQWV YL I     +  +  TL + GQL  ++R +    FN  A+
Sbjct: 799  LEELLTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFN--AN 856

Query: 694  TQHRILLLSIKCGGVGLNL 750
             + R+LLLS+  GGVGLNL
Sbjct: 857  NEKRVLLLSLTAGGVGLNL 875



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 6/92 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-LNKNNDSTNRIKSIIKKI 182
           L A   W +TGTP+ N+  D+++++ F+    F D + WK  LN++     R+  IIK +
Sbjct: 491 LRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLNESMLGHRRLNFIIKPL 550

Query: 183 VLKRDKSEISFN-----IPKHTVEYVHVNLMK 263
           +L+R K ++  +     +P   +E + V L K
Sbjct: 551 MLRRTKQKLQASGDMPALPSLKIELICVQLSK 582


>UniRef50_UPI00015B63D4 Cluster: PREDICTED: similar to helicase;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           helicase - Nasonia vitripennis
          Length = 1053

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/96 (30%), Positives = 60/96 (62%), Gaps = 7/96 (7%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L+A  +W +TGTPI N+  D Y+++ FL+C PF+D ++W+  +     ++T+R++ I   
Sbjct: 642 LSAKIKWALTGTPIQNRKLDFYALLKFLKCHPFDDIQLWRRWVSPDTEEATHRLQVITTT 701

Query: 180 IVLKRDKSEISF-----NIPKHTVEYVHVNLMKKKK 272
           ++L+R K+E+       ++P+   + + V+L  ++K
Sbjct: 702 LMLRRTKTELIAKGAIQSLPERRFDLIEVDLDSEEK 737



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 35/104 (33%), Positives = 58/104 (55%), Gaps = 1/104 (0%)
 Frame = +1

Query: 460  RLF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIF-ENFFKQKNIATLMYTG 636
            R+F       +V+    +V+ +L   + K+I+VSQW ++L I   N    +     M+TG
Sbjct: 876  RVFDKDRRSSKVRAVLDVVNSVLEKGE-KVIIVSQWTKFLDIIASNLCLMEGAYFEMFTG 934

Query: 637  QLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            ++ V++R       N++ D +  +LLLS+  GGVGLNL+G N L
Sbjct: 935  KVAVKNRQEIVDRLNDS-DNKLNVLLLSLTAGGVGLNLVGANNL 977


>UniRef50_Q55X95 Cluster: Putative uncharacterized protein; n=2;
            Filobasidiella neoformans|Rep: Putative uncharacterized
            protein - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 1399

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +1

Query: 511  LVDDILNTS-DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN- 684
            L+D I+      KII+ SQ+VEY+ +   F +++NI    Y G +K ++R      FN  
Sbjct: 1225 LIDAIIEQDPSQKIIVFSQFVEYIDLCSIFLRRRNIPHAKYVGSMKQDEREDTIKDFNRP 1284

Query: 685  -AADTQHRILLLSIKCGGVGLNLIGGNTL*CWSL 783
               D   R LL+S+KCGGVGLNL   N + C  L
Sbjct: 1285 MEEDKSPRCLLMSLKCGGVGLNLCIANHVICLDL 1318



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 7/77 (9%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRP------FNDPRVWKMLNKNNDSTNRIK 164
            AL A  RWC++GT + N   D+Y  + FLQ  P      F +            +TNR++
Sbjct: 841  ALRAHLRWCLSGTLVVNSLDDIYPHLRFLQISPSAQWDHFREHISKPQKRFPKLATNRVQ 900

Query: 165  SIIKKIVLKRDK-SEIS 212
            +I++   ++R K SE++
Sbjct: 901  AILRVCCIRRHKESELN 917


>UniRef50_O60177 Cluster: ATP-dependent DNA helicase; n=1;
            Schizosaccharomyces pombe|Rep: ATP-dependent DNA helicase
            - Schizosaccharomyces pombe (Fission yeast)
          Length = 1040

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 1/92 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSD-DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            +++ + + V +I+     DKI++ SQ+V +L++F   F+Q+ I  LMYTG L   +R   
Sbjct: 866  KIEKALNAVKEIIKKQPTDKILIFSQFVSFLELFTVPFRQEGIKYLMYTGGLSTAER--N 923

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            +   N   D   R+LL+S+K G VGLNL   N
Sbjct: 924  QALINFEVDPNVRVLLISLKAGNVGLNLTCAN 955



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 25/77 (32%), Positives = 46/77 (59%), Gaps = 11/77 (14%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNK-------NNDSTN--- 155
           L +T RWC++GTP+ N   + YS+I FL+ +P++D   W   +K       +N +T+   
Sbjct: 558 LESTYRWCLSGTPMQNGVEEFYSLIKFLRIKPYSD---WSSFSKDFTIPLSSNINTSAPM 614

Query: 156 -RIKSIIKKIVLKRDKS 203
            R + ++K ++L+R K+
Sbjct: 615 KRFRGLLKAVLLRRTKN 631



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +2

Query: 377 VLWLILKLRQICCHPYLAMHGRNLLETNDCFK 472
           +L L+L+LRQ CCHP+L +     ++ ND F+
Sbjct: 689 LLVLLLRLRQACCHPWLIVAREAAVDDNDSFQ 720


>UniRef50_Q10332 Cluster: Uncharacterized ATP-dependent helicase
           C582.10c; n=1; Schizosaccharomyces pombe|Rep:
           Uncharacterized ATP-dependent helicase C582.10c -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 830

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 7/82 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-------MLNKNNDSTNRI 161
           AL   NRWC+TGTP+ N   ++YS++ FL   PFND  VWK          + N    R+
Sbjct: 402 ALQGINRWCLTGTPLQNNVDELYSLVKFLHINPFNDQSVWKDQISLPLCQGEENLVFKRL 461

Query: 162 KSIIKKIVLKRDKSEISFNIPK 227
           + ++  I+L+R K+ +  N  K
Sbjct: 462 RMLLSVIMLRRTKTLLEANAGK 483



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K I+ SQ+  +L I +   ++  I  + Y G++    R  +     + + TQ  +LL S+
Sbjct: 672 KTIIFSQFTTFLDIIDLHLRKAGIGFVRYDGRMNNRAREKSLDLLRSDSGTQ--VLLCSL 729

Query: 724 KCGGVGLNL 750
           KCG +GLNL
Sbjct: 730 KCGALGLNL 738


>UniRef50_Q9FF61 Cluster: Putative SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin subfamily A
           member 3-like 1; n=2; Arabidopsis thaliana|Rep: Putative
           SWI/SNF-related matrix-associated actin-dependent
           regulator of chromatin subfamily A member 3-like 1 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 881

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKNNDSTNRIKS 167
           L A+ RW +TGTPI N  +D+YS++ FL+  PF+    W+ L        N    +R++ 
Sbjct: 456 LKASRRWAVTGTPIQNGSFDLYSLMAFLRFEPFSIKSYWQSLIQRPLGQGNKKGLSRLQV 515

Query: 168 IIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           ++  I L+R K +    +P  TVE  +V L  ++++
Sbjct: 516 LMATISLRRTKEKSLIGLPPKTVETCYVELSPEERQ 551



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 21/69 (30%), Positives = 31/69 (44%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++ SQ+ + L + E   K      L   G + V+ R      F N   T   +LL S+
Sbjct: 727 KSVVFSQFRKMLLLLETPLKAAGFTILRLDGAMTVKKRTQVIGEFGNPELTGPVVLLASL 786

Query: 724 KCGGVGLNL 750
           K  G G+NL
Sbjct: 787 KASGTGINL 795


>UniRef50_A7ARZ9 Cluster: DNA repair and recombination protein
           RAD54-like , putative; n=1; Babesia bovis|Rep: DNA
           repair and recombination protein RAD54-like , putative -
           Babesia bovis
          Length = 824

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 32/86 (37%), Positives = 49/86 (56%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L+ +I  T+ D+I+++S + + L +FE   KQ N   +   G L ++ R    TTFN+  
Sbjct: 490 LLHNIRRTTSDRIVIISNYTQTLDVFERMCKQCNYPCVRLDGTLSIKKRHKLVTTFND-P 548

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
           ++     LLS K GG G+NLIG N L
Sbjct: 549 NSHSFAFLLSSKAGGCGINLIGANRL 574


>UniRef50_Q9UNY4 Cluster: Transcription termination factor 2; n=9;
           Tetrapoda|Rep: Transcription termination factor 2 - Homo
           sapiens (Human)
          Length = 1162

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +W+  + N +     R+  + K 
Sbjct: 756 LQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKS 815

Query: 180 IVLKRDKSEI 209
           ++L+R K ++
Sbjct: 816 LLLRRTKDQL 825



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            N++  K ++VSQW   LK+     K+  +      G +  + R+     FN++   Q  +
Sbjct: 1006 NSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQ--V 1063

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
            +L+S+  GGVGLNL GGN L
Sbjct: 1064 MLISLLAGGVGLNLTGGNHL 1083


>UniRef50_Q4RTN8 Cluster: Chromosome 2 SCAF14997, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 2 SCAF14997, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 965

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL C PF++ ++WK  + N +     R+  + + 
Sbjct: 523 LRARARWAVTGTPIQNNLLDMYSLLKFLHCSPFDEFKLWKAQVDNGSRRGRERLNILTRS 582

Query: 180 IVLKRDKSE 206
           ++L+R K +
Sbjct: 583 LLLRRTKDQ 591



 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 28/78 (35%), Positives = 43/78 (55%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
            SD K ++VSQW   L+I     ++  +   +  G +  + R+     FN  A    +++L
Sbjct: 810  SDQKSVIVSQWTSMLRIVAVHLRRIGLRYGIIDGTVNPKQRMDLVEEFNTNAKGP-QVML 868

Query: 715  LSIKCGGVGLNLIGGNTL 768
            +S+  GGVGLNLIGGN L
Sbjct: 869  VSLCAGGVGLNLIGGNHL 886


>UniRef50_Q297P0 Cluster: GA10321-PA; n=1; Drosophila
            pseudoobscura|Rep: GA10321-PA - Drosophila pseudoobscura
            (Fruit fly)
          Length = 1041

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 32/85 (37%), Positives = 46/85 (54%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            +  IL  + DK+I+VSQW  +L I   +  + +  TL + G++   +R +    F N   
Sbjct: 876  LQSILEGTTDKVIVVSQWTSFLDIIREYLNEHDWQTLDFNGKMDATEREVVLKDF-NVVQ 934

Query: 694  TQHRILLLSIKCGGVGLNLIGGNTL 768
               RILLLS+  GGVGLNL   N L
Sbjct: 935  NSKRILLLSLTSGGVGLNLNVANHL 959



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 6/90 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-MLNKNNDSTNRIKSIIKKI 182
           L A  RW +TGTPI N+  D+++++ FL    F   + WK MLN       R+  IIK +
Sbjct: 521 LRAHCRWALTGTPIQNRAIDVFALLRFLNVPHFKHLKQWKMMLNGCIHGHFRLSFIIKPL 580

Query: 183 VLKRDKSEISFN-----IPKHTVEYVHVNL 257
           +L+R K E+  +     +P  +VE V+V L
Sbjct: 581 MLRRTKQELQASGDMPLLPVLSVELVYVQL 610


>UniRef50_A0CAA3 Cluster: Chromosome undetermined scaffold_160,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_160,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1210

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 4/71 (5%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-MLNK--NNDSTNRIKS-I 170
           AL A  RWC+TGTP+ NKH D++S++ FL+   F++   W   +NK  N D   RI S I
Sbjct: 781 ALDADFRWCLTGTPMQNKHDDLFSLLQFLKVETFSEYFWWNTYINKEENEDDQQRILSQI 840

Query: 171 IKKIVLKRDKS 203
           ++ I+L+R K+
Sbjct: 841 LQPIILRRTKN 851



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
            I+    +K+++ +Q V+ +++ +N F++  I     TGQ+ VE R      F  + D   
Sbjct: 1053 IVQQQKEKVLIFTQSVDMIQLIDNLFQENGIVAFRITGQMSVEKREKVIKQFKESQDA-- 1110

Query: 703  RILLLSIKCGGVGLNLIGGNTL 768
              LLLS++    GLNL   N +
Sbjct: 1111 IALLLSLRATSTGLNLTMANNV 1132



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = +2

Query: 239  VCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
            +C   FNE+EK LY KL   S++ +      + ++  L       H+  +I KL+  C H
Sbjct: 865  ICWVEFNEKEKILYQKLLAGSQDIFKHFTIGKNNKTYL-------HIFQIINKLKLACNH 917

Query: 419  PYLAMHGRNLLET 457
            P LA+   NL +T
Sbjct: 918  PQLALKEINLDKT 930


>UniRef50_Q5NC05 Cluster: Transcription termination factor 2; n=11;
           Amniota|Rep: Transcription termination factor 2 - Mus
           musculus (Mouse)
          Length = 1138

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKK 179
           L A  RW +TGTPI N   DMYS++ FL+C PF++  +WK  + N +     R+  + K 
Sbjct: 732 LQAQARWAVTGTPIQNNLLDMYSLMKFLRCSPFDEFSLWKSQVDNGSMKGGERLSILTKS 791

Query: 180 IVLKRDKSEI 209
           ++L+R K ++
Sbjct: 792 LLLRRTKDQL 801



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/75 (33%), Positives = 40/75 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K ++VSQW   L++     K+  +      G +  + R+     FN++   Q  ++L+S+
Sbjct: 987  KSVIVSQWTSMLQVVALHLKKNRLTYATIDGSVNPKQRMDLVEAFNHSQGPQ--VMLISL 1044

Query: 724  KCGGVGLNLIGGNTL 768
              GGVGLNL GGN L
Sbjct: 1045 LAGGVGLNLTGGNHL 1059


>UniRef50_Q54NP1 Cluster: SNF2-related domain-containing protein;
           n=1; Dictyostelium discoideum AX4|Rep: SNF2-related
           domain-containing protein - Dictyostelium discoideum AX4
          Length = 989

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 33/90 (36%), Positives = 52/90 (57%), Gaps = 9/90 (10%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNA------ 687
           L   ++K++LVS + + L +FE   K+ +I TL   G +K + R      FN++      
Sbjct: 642 LKPMNEKLVLVSNFTKTLDVFERLCKRLSIDTLRLDGDVKADSRQALVDKFNSSTQNVSS 701

Query: 688 ---ADTQHRILLLSIKCGGVGLNLIGGNTL 768
              + +Q+++ LLS K GGVG+NLIGGN L
Sbjct: 702 SKSSSSQYQVFLLSAKAGGVGINLIGGNHL 731


>UniRef50_A0E7N9 Cluster: Chromosome undetermined scaffold_81, whole
            genome shotgun sequence; n=2; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_81, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1228

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-MLNKNNDSTNR---IKSI 170
            AL +  RWC+TGTPI NKH D++S+++FL+   F +   W   +NK  +   +   +  I
Sbjct: 795  ALKSECRWCLTGTPIQNKHDDLFSLLSFLRVETFGEYYWWNAYINKEENEEEQQCILGEI 854

Query: 171  IKKIVLKRDKSEIS 212
            IK I+L+R K +++
Sbjct: 855  IKPIILRRTKQQLN 868



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 23/81 (28%), Positives = 41/81 (50%)
 Frame = +2

Query: 239  VCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
            +C      +E+ LYDK    +++ +   + + +S       +Q  H+  +I KLR  C H
Sbjct: 879  ICWVKLENKERALYDKFFEGTQQLFKVYLNSEKS-------RQFVHIFQIINKLRMTCDH 931

Query: 419  PYLAMHGRNLLETNDCFKMDY 481
            P +A+ G N L+TN   ++ Y
Sbjct: 932  PSIALKGIN-LDTNSIDEIKY 951


>UniRef50_Q2HHC5 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 283

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 34/96 (35%), Positives = 48/96 (50%)
 Frame = +1

Query: 481 YEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRI 660
           Y  ++Q  A ++  I   ++DKI+L+S +   L +FE   +  N   L   G + V  R 
Sbjct: 168 YSGKMQVLARMLARIRADTNDKIVLISNYTSTLDLFERLCRSNNYGCLRLDGSMNVNKRQ 227

Query: 661 LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                FN+  D    + LLS K GG GLNLIG N L
Sbjct: 228 KLVDKFND-PDGPEFVFLLSSKAGGCGLNLIGANRL 262


>UniRef50_Q4P887 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1060

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = +1

Query: 508 HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNA 687
           +L+  +   +DDK++LVS +   L I E   ++K    L   G+   ++R+     FN  
Sbjct: 689 NLLQTVRAQTDDKVVLVSNFTSTLDIIEAMMRKKRYPYLRLDGKTPQDERMAMVNQFNRE 748

Query: 688 ADTQHRILLLSIKCGGVGLNLIGGNTL 768
              +  + LLS K GGVGLNLIG N L
Sbjct: 749 GVDKSFVFLLSAKSGGVGLNLIGANRL 775


>UniRef50_Q4WVM1 Cluster: DNA repair protein rad5; n=10;
            Pezizomycotina|Rep: DNA repair protein rad5 - Aspergillus
            fumigatus (Sartorya fumigata)
          Length = 1245

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 32/102 (31%), Positives = 61/102 (59%), Gaps = 13/102 (12%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML----NKNND---STNRIK 164
            L AT+RW +TGTPI N+  D++S++ FLQ  P+N+   WK       ++ D   + N ++
Sbjct: 723  LRATHRWVLTGTPIVNRLEDLFSLVRFLQVEPWNNFSFWKTFITVPFESKDYVRALNVVQ 782

Query: 165  SIIKKIVLKRDKS------EISFNIPKHTVEYVHVNLMKKKK 272
            ++++ +VL+R K+      E    +P+ T++ V V L ++++
Sbjct: 783  TVLEPLVLRRTKTMKTPEGEPLVPLPRRTIDIVEVELSEQER 824


>UniRef50_UPI00015B5D8F Cluster: PREDICTED: similar to steroid
           receptor-interacting snf2 domain protein; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to steroid
           receptor-interacting snf2 domain protein - Nasonia
           vitripennis
          Length = 2197

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 30/82 (36%), Positives = 45/82 (54%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
           I +T+ DKI+LVS + + L +FE    ++    +   G + ++ R      FNN  D+  
Sbjct: 535 IKSTTTDKIVLVSNYTQTLDLFERLCAKRKYKYVRLDGTMSIKKRAKVVDNFNN-PDSGD 593

Query: 703 RILLLSIKCGGVGLNLIGGNTL 768
            I +LS K GG GLNL+G N L
Sbjct: 594 FIFMLSSKAGGCGLNLVGANRL 615


>UniRef50_O12944 Cluster: DNA repair and recombination protein
           RAD54-like; n=6; Bilateria|Rep: DNA repair and
           recombination protein RAD54-like - Gallus gallus
           (Chicken)
          Length = 733

 Score = 56.8 bits (131), Expect = 6e-07
 Identities = 28/80 (35%), Positives = 45/80 (56%)
 Frame = +1

Query: 529 NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
           +TS+DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +  +  I
Sbjct: 499 STSNDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKVVERFNSPSSPEF-I 557

Query: 709 LLLSIKCGGVGLNLIGGNTL 768
            +LS K GG GLNLIG N L
Sbjct: 558 FMLSSKAGGCGLNLIGANRL 577


>UniRef50_UPI000023F51F Cluster: hypothetical protein FG11234.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG11234.1 - Gibberella zeae PH-1
          Length = 909

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 8/78 (10%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFND--------PRVWKMLNKNNDSTNR 158
           AL + +RW +TGTPI N+  D+ S+  F++  P+ D         R+WK   +  ++ NR
Sbjct: 530 ALESRSRWAVTGTPIQNRLGDLASLFKFIRVHPYTDRKCFDADISRLWK-TGEYQEAINR 588

Query: 159 IKSIIKKIVLKRDKSEIS 212
           +K + K ++L+RDK  +S
Sbjct: 589 LKRLSKCLILRRDKGTVS 606


>UniRef50_A7PQK2 Cluster: Chromosome chr6 scaffold_25, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_25, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 980

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDSTNR-----IK 164
           AL A  RWC+TGTPI N   D+YS++ FL+  P+ +   W K++ K  D  +      ++
Sbjct: 542 ALIADRRWCLTGTPIQNNLEDIYSLLRFLRVEPWGNWAWWNKLIQKPFDEGDERGLKLVQ 601

Query: 165 SIIKKIVLKRDK 200
           SI+K I+L+R K
Sbjct: 602 SILKPIMLRRTK 613



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K IL SQW  +L + +    + NI+ +   G L  + R      F+  ++    +LL+S+
Sbjct: 832  KSILFSQWTAFLDLLQIPLSRSNISFVRLDGTLNQQQREKVIKQFSEESNIL--VLLMSL 889

Query: 724  KCGGVGLNL 750
            K GGVG+NL
Sbjct: 890  KAGGVGINL 898


>UniRef50_A0C9B0 Cluster: Chromosome undetermined scaffold_16, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_16,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 954

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 9/100 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW--KMLNKNNDST---NRIKS 167
           ++ A +RWC+TGTPI N   D++S+ +FLQ   F+D   W    +NK  D     N +  
Sbjct: 429 SIQAKSRWCLTGTPIQNHLEDLFSLFHFLQVETFSD-YYWFNHYINKQQDKAAKFNLLHE 487

Query: 168 IIKKIVLKRDKS----EISFNIPKHTVEYVHVNLMKKKKR 275
           I++ ++L+R K     + S N+P      V V +  ++K+
Sbjct: 488 ILRPLLLRRTKQSESIQSSLNLPSKQHFIVRVKMSNQEKK 527


>UniRef50_P32863 Cluster: DNA repair and recombination protein
           RAD54; n=5; Saccharomycetales|Rep: DNA repair and
           recombination protein RAD54 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 898

 Score = 56.4 bits (130), Expect = 8e-07
 Identities = 31/96 (32%), Positives = 47/96 (48%)
 Frame = +1

Query: 481 YEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRI 660
           Y  +       +  I   SDDKI+L+S + + L + E   + K+ + +   G + +  R 
Sbjct: 653 YSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQ 712

Query: 661 LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                FN+  + Q  I LLS K GG G+NLIG N L
Sbjct: 713 KLVDRFND-PEGQEFIFLLSSKAGGCGINLIGANRL 747


>UniRef50_UPI0000E4643D Cluster: PREDICTED: similar to MGC81081
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC81081 protein -
           Strongylocentrotus purpuratus
          Length = 600

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 2/69 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST--NRIKSIIKK 179
           L A  RW +TG  I N   DM+S+I FL+  PF++  VWK   +N  ST    ++ ++K 
Sbjct: 272 LRARARWAVTGYLIQNSTMDMFSLIRFLKFTPFDEYEVWKSEVENAGSTKSETLQKLVKS 331

Query: 180 IVLKRDKSE 206
           +VL+R K +
Sbjct: 332 LVLRRTKDQ 340



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN-NAADTQHRILLL 717
           +K +LVSQW   L + E+  K+         G +   +R  A   FN N    Q  I+L+
Sbjct: 466 EKSVLVSQWTGMLDVVEHHLKEAGFKCWSIDGDVSPNERDEALKDFNYNPRGRQ--IMLV 523

Query: 718 SIKCGGVGLNLIGGNTL 768
           S++ GG  LNL GGN L
Sbjct: 524 SLRTGGATLNLSGGNHL 540


>UniRef50_A2Q4K2 Cluster: SNF2-related; Zinc finger, RING-type;
           ATP-requiring DNA helicase RecQ; n=1; Medicago
           truncatula|Rep: SNF2-related; Zinc finger, RING-type;
           ATP-requiring DNA helicase RecQ - Medicago truncatula
           (Barrel medic)
          Length = 844

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 6/97 (6%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-----KMLNKNNDS-TNRIK 164
           AL A  RW +TGTPI N  +D++S++ FL   PF+    W     + LN+   +  +R++
Sbjct: 392 ALNAKRRWAVTGTPIQNGSYDLFSLMAFLHFEPFSIKSYWQSLVQRPLNQGKQTGMSRLQ 451

Query: 165 SIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            ++  I L+R K      +P   VE  +V L  ++++
Sbjct: 452 VLMSAISLRRTKDTALGGLPPKIVETCYVELSFEERK 488


>UniRef50_Q9FNI6 Cluster: Putative SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin subfamily A
           member 3-like 2; n=5; Magnoliophyta|Rep: Putative
           SWI/SNF-related matrix-associated actin-dependent
           regulator of chromatin subfamily A member 3-like 2 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 1029

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 6/73 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIK 164
           AL A  RWC+TGTPI N   D+YS++ FL+  P+     W K++ K     +      ++
Sbjct: 591 ALVADRRWCLTGTPIQNNLEDLYSLLRFLRIEPWGTWAWWNKLVQKPFEEGDERGLKLVQ 650

Query: 165 SIIKKIVLKRDKS 203
           SI+K I+L+R KS
Sbjct: 651 SILKPIMLRRTKS 663



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L +S  K IL SQW  +L + +    + N + +   G L  + R      F+   D    
Sbjct: 875  LRSSGSKSILFSQWTAFLDLLQIPLSRNNFSFVRLDGTLSQQQREKVLKEFSE--DGSIL 932

Query: 706  ILLLSIKCGGVGLNL 750
            +LL+S+K GGVG+NL
Sbjct: 933  VLLMSLKAGGVGINL 947



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 2/88 (2%)
 Frame = +2

Query: 236 RVCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICC 415
           RV  C  +E E+  YD L   S+  + + V   +       L     +L L+L+LRQ C 
Sbjct: 681 RVIYCELSESERDFYDALFKRSKVKFDQFVEQGKV------LHNYASILELLLRLRQCCD 734

Query: 416 HPYLAMHGRNLLETNDCFKMD--YMSSK 493
           HP+L M   +  E +D  K+   ++S K
Sbjct: 735 HPFLVMSRGDTAEYSDLNKLSKRFLSGK 762


>UniRef50_UPI000023DDDC Cluster: hypothetical protein FG07734.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07734.1 - Gibberella zeae PH-1
          Length = 918

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 8/82 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR--------VWKMLNKNNDSTNR 158
           AL   +RW +TGTPI N+  D+ S++ F++  P+ DPR        +WK   ++ D+  R
Sbjct: 474 ALEGISRWVVTGTPIQNRLGDLASLLKFIRAHPYTDPRRFDADISGLWKS-GEDEDAVRR 532

Query: 159 IKSIIKKIVLKRDKSEISFNIP 224
           +K +   ++L+R KS I  N+P
Sbjct: 533 LKRLSACLLLRRAKSTI--NLP 552



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query: 511 LVDDI-LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNA 687
           LVDDI L+  + K ++ S W   L + +    Q+ I ++ + G++  +DR      F + 
Sbjct: 747 LVDDIKLSPPETKCVVFSTWRLTLDLVKGVLDQEGIQSIRFDGKVPQKDRQSVVKRFES- 805

Query: 688 ADTQHRILLLSIKCGGVGLNL 750
            D   RI+LL++ CG VGL L
Sbjct: 806 -DPNIRIMLLTLTCGAVGLTL 825


>UniRef50_Q385M5 Cluster: DNA repair and recombination protein
           RAD54, putative; n=1; Trypanosoma brucei|Rep: DNA repair
           and recombination protein RAD54, putative - Trypanosoma
           brucei
          Length = 1037

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSD-DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
           ++Q  + ++D++ +  D DK+++VS + + L +     K K I+     G + ++ R   
Sbjct: 700 KMQFVSLMLDELCSNGDHDKLVIVSNFTQTLDVIAAMCKTKKISFFQLDGSMPIKRRQEV 759

Query: 667 ETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   ++Q  + LLS K GGVGLNLIG N L
Sbjct: 760 VDRFN-VPNSQEIVFLLSSKAGGVGLNLIGANRL 792


>UniRef50_A6EK72 Cluster: Superfamily II DNA/RNA helicase, SNF2 family
            protein; n=1; Pedobacter sp. BAL39|Rep: Superfamily II
            DNA/RNA helicase, SNF2 family protein - Pedobacter sp.
            BAL39
          Length = 964

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 31/81 (38%), Positives = 48/81 (59%)
 Frame = +1

Query: 508  HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNA 687
            H +D++L     K+++ SQ+V++L IF N+F+++ I      G  K    I+AE  F   
Sbjct: 805  HTLDNVLK-GGHKVLIFSQFVKHLSIFRNYFEKEQIPFSYLDGSTKNRGEIVAE--FQEN 861

Query: 688  ADTQHRILLLSIKCGGVGLNL 750
             D   ++ L+SIK GGVGLNL
Sbjct: 862  KDL--KVFLISIKAGGVGLNL 880


>UniRef50_A0UXS6 Cluster: SNF2-related; n=1; Clostridium
            cellulolyticum H10|Rep: SNF2-related - Clostridium
            cellulolyticum H10
          Length = 1077

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 33/86 (38%), Positives = 47/86 (54%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            +V D L TS  +I+L SQ+   L I   + ++  I  L   G    ++R+   T FNN  
Sbjct: 917  IVGDSL-TSGHRILLFSQFTSMLAIIRQWLQEDGIDYLYLDGSTPADERMKMVTNFNNG- 974

Query: 691  DTQHRILLLSIKCGGVGLNLIGGNTL 768
              Q +I LLS+K GG GLNL G +T+
Sbjct: 975  --QGQIFLLSLKSGGTGLNLTGADTV 998


>UniRef50_P41410 Cluster: DNA repair protein rhp54; n=30;
           Fungi/Metazoa group|Rep: DNA repair protein rhp54 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 852

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 30/82 (36%), Positives = 42/82 (51%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
           I   +DDKI+L+S +   L +FE   + +    L   G + V  R     TFN+  +   
Sbjct: 622 IKQETDDKIVLISNYTSTLDLFEQLCRARGYKALRLDGTMNVNKRQRLVDTFND-PEKDA 680

Query: 703 RILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG G+NLIG N L
Sbjct: 681 FVFLLSSKAGGCGINLIGANRL 702


>UniRef50_A6S690 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 537

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 9/99 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW----KMLNKNNDSTN----- 155
           AL AT RW ITGTPI NK  D  S++ FL+  P++D + +        KN+ S +     
Sbjct: 225 ALKATRRWAITGTPIQNKLVDFASIVKFLRVHPYSDTKTFGEEITTPFKNSSSIDAKGFL 284

Query: 156 RIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           R+K++++ I + R K+ I        + ++H    +++K
Sbjct: 285 RLKTLVRAITISRTKTVIELPSRVDEIHHLHFTPAEREK 323


>UniRef50_Q8I4S6 Cluster: DNA repair protein rhp16, putative; n=2;
            Plasmodium|Rep: DNA repair protein rhp16, putative -
            Plasmodium falciparum (isolate 3D7)
          Length = 1647

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 30/85 (35%), Positives = 45/85 (52%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            V +++N +DDK ++ SQ+   L + E   K+ NI      G + +  R      FN   D
Sbjct: 1486 VQNVINNTDDKCLIFSQYCSMLDLIEYHLKKHNIVCSKLLGYMSMISRNNILYNFNQ--D 1543

Query: 694  TQHRILLLSIKCGGVGLNLIGGNTL 768
             Q R+LL+S+K GG GLNL   N +
Sbjct: 1544 KQLRVLLISLKAGGEGLNLQVANRI 1568



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 13/28 (46%), Positives = 22/28 (78%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPF 104
            RWC+TGTP+ N+  ++YS+I F++  P+
Sbjct: 1066 RWCLTGTPLQNRISELYSLIRFIEFYPY 1093


>UniRef50_Q6C733 Cluster: Yarrowia lipolytica chromosome E of strain
            CLIB 122 of Yarrowia lipolytica; n=1; Yarrowia
            lipolytica|Rep: Yarrowia lipolytica chromosome E of
            strain CLIB 122 of Yarrowia lipolytica - Yarrowia
            lipolytica (Candida lipolytica)
          Length = 959

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = +1

Query: 445  SFGNKRLF*NGLYEQQVQTSAHLVD--DILNTSDDKIILVSQWVEYLKIFENFFKQKNIA 618
            S G+ ++  NG   + V  SA +V   ++L     K I+ SQ+ ++  + E F  ++NI 
Sbjct: 772  SSGDNKVSING---KDVHASAKVVKLLELLKADPRKTIVFSQFTKFFDVLEPFLIRENIR 828

Query: 619  TLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
             + Y G + +  R  A  T    AD    +LL S+KCG +GLNL   N
Sbjct: 829  YVKYDGSMPIRKRDAALATLR--ADPDTTVLLCSLKCGALGLNLTCAN 874



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 16/38 (42%), Positives = 27/38 (71%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK 125
           A  RWC+TGTP+ N   ++ +++ F++  P++DP VWK
Sbjct: 586 ADRRWCLTGTPVQNNIDELQALLQFIRVPPYDDPVVWK 623


>UniRef50_Q6C2R8 Cluster: DNA repair protein RAD5; n=1; Yarrowia
           lipolytica|Rep: DNA repair protein RAD5 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 1025

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 7/73 (9%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML-------NKNNDSTNRIK 164
           L ATN+W +TGTPIHN+  D++S++ FL   P+ND   W+          K   +   ++
Sbjct: 577 LRATNKWALTGTPIHNRLEDLFSILKFLGAAPWNDFIYWRNFITLPFQEGKIVSALMTVQ 636

Query: 165 SIIKKIVLKRDKS 203
            I++ IVL+R K+
Sbjct: 637 CILEPIVLRRTKN 649



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/75 (32%), Positives = 39/75 (52%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
            D K ++ SQ+  YL I +   +++ I    + G L  + R      F  +  +   +LL+
Sbjct: 874  DAKSVVFSQFTSYLDIIQTELRREKIQAFRFDGTLSRQQRTDVLKAFGLSKGS---VLLI 930

Query: 718  SIKCGGVGLNLIGGN 762
            S+K GGVGLNL+  N
Sbjct: 931  SLKTGGVGLNLVTAN 945


>UniRef50_Q4YWQ3 Cluster: DNA repair protein rhp16, putative; n=8;
            Plasmodium (Vinckeia)|Rep: DNA repair protein rhp16,
            putative - Plasmodium berghei
          Length = 1545

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 30/85 (35%), Positives = 45/85 (52%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            V +++  +DDK ++ SQ+   L + E   K+ NI      G + +  R      FNN  D
Sbjct: 1384 VRNVIYNTDDKCLIFSQYCSMLDLIEYHLKKNNIICSKLLGYMSMVSRNNILYNFNN--D 1441

Query: 694  TQHRILLLSIKCGGVGLNLIGGNTL 768
             Q R+LL+S+K GG GLNL   N +
Sbjct: 1442 NQLRVLLISLKAGGEGLNLQVANRI 1466



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 14/28 (50%), Positives = 22/28 (78%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPF 104
            RWC+TGTP+ N+  ++YS+I FL+  P+
Sbjct: 989  RWCLTGTPLQNRIGELYSLIRFLEFYPY 1016



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = +2

Query: 257  NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMH 436
            + EEK  Y+ L  ++   + K V +    NT+  L    H+  L+ +LRQ   HPYL + 
Sbjct: 1115 SNEEKDFYESLYKKTTTQFDKYVKS----NTV--LHNYAHIFDLLSRLRQAADHPYLILF 1168

Query: 437  GRNLL 451
            G + L
Sbjct: 1169 GNSFL 1173


>UniRef50_Q9P793 Cluster: SHREC complex subunit Mit1; n=1;
            Schizosaccharomyces pombe|Rep: SHREC complex subunit Mit1
            - Schizosaccharomyces pombe (Fission yeast)
          Length = 1418

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L T   +I+L SQ+++ L I E++F+ KNIA   + G     +R  A  +F NA +++  
Sbjct: 883  LITRGHRILLFSQFIQQLDILEDWFEYKNIAYARFDGASSEMERQSAIDSF-NAPNSELS 941

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GGVG+NL   +T+
Sbjct: 942  CFLLSTRAGGVGINLASADTV 962



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN-KNNDSTNRIKSIIKKIVLKRDKSE 206
           +TGTP+ N   ++++++ FL     N   + K  +  + +    +  I+K   L+R KSE
Sbjct: 716 LTGTPLQNNVRELFNLLQFLNPMKINAAELEKRYSIIDTEKVTELHQILKPFFLRRVKSE 775

Query: 207 ISFNIP 224
           +  N P
Sbjct: 776 VLDNFP 781


>UniRef50_Q14527 Cluster: Helicase-like transcription factor; n=33;
           Euteleostomi|Rep: Helicase-like transcription factor -
           Homo sapiens (Human)
          Length = 1009

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 11/101 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK-----NNDSTNRIKS 167
           L +  RW +TGTPI N   D++S+++FL+ +PF D   W + + +     +     R++S
Sbjct: 576 LESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQS 635

Query: 168 IIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKR 275
           +IK I L+R K S+I       +P+  V   H+ L  ++++
Sbjct: 636 LIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERK 676



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDD-KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            ++    H + D+   + + K ++VSQ+  +L + E   K          G +  + R+ +
Sbjct: 834  KINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVES 893

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNL 750
               F N       I+LLS+K GGVGLNL
Sbjct: 894  IQCFQNTEAGSPTIMLLSLKAGGVGLNL 921



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++EE+ +Y  +K E        +    +E T+  L     VL L+L+LRQICCH YL
Sbjct: 671 SDEERKIYQSVKNEGRAT----IGRYFNEGTV--LAHYADVLGLLLRLRQICCHTYL 721


>UniRef50_A3DI74 Cluster: SNF2-related protein; n=4;
            Clostridiales|Rep: SNF2-related protein - Clostridium
            thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 1087

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 28/91 (30%), Positives = 47/91 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q    ++ D  + S  +I+L SQ+   L+I + F  QK++      G  K +DR+   
Sbjct: 920  KIQALEEIMTDAFD-SGHRILLFSQFTSMLEIIKQFLDQKSVEYFYLDGSTKAQDRVEMV 978

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
              FN       ++ L+S+K GG GLNL G +
Sbjct: 979  KAFNQGTG---KLFLISLKAGGTGLNLTGAD 1006


>UniRef50_A7Q3Y7 Cluster: Chromosome chr13 scaffold_48, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr13 scaffold_48, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1211

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
           L A +RWC+TGTPI  +  D+Y ++ FL+  PFN PR W
Sbjct: 237 LHARHRWCVTGTPIQRRLDDLYGLLRFLEASPFNIPRWW 275


>UniRef50_Q22M98 Cluster: SNF2 family N-terminal domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: SNF2
            family N-terminal domain containing protein - Tetrahymena
            thermophila SB210
          Length = 1540

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 26/79 (32%), Positives = 46/79 (58%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +DDK ++ +Q++  + +FE  F++  I  L   G +  + R      FN   D+Q++
Sbjct: 1382 LQKTDDKCLVFTQFLGMMDLFEIDFQKNKIPYLRLDGSVNQKQRAEIIKRFNE--DSQYK 1439

Query: 706  ILLLSIKCGGVGLNLIGGN 762
            + ++S+K GGVGLNL+  N
Sbjct: 1440 VFMISLKAGGVGLNLVKAN 1458



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 48/73 (65%), Gaps = 7/73 (9%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW--KMLNKNNDSTNRI----- 161
            +L+  NRWC+TGTP+ NK  +++ +I+F++  P++D  +W    +NK ++  + +     
Sbjct: 1045 SLSGDNRWCMTGTPLQNKLDELFPLIHFIKLEPWSD-YIWFNNYINKPHEKGDLVVYDVL 1103

Query: 162  KSIIKKIVLKRDK 200
            K+I++ I+L+R K
Sbjct: 1104 KTILRPILLRRTK 1116


>UniRef50_A5E1R6 Cluster: DNA repair and recombination protein
           RAD54; n=2; Saccharomycetaceae|Rep: DNA repair and
           recombination protein RAD54 - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 875

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 30/96 (31%), Positives = 45/96 (46%)
 Frame = +1

Query: 481 YEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRI 660
           +  + Q     +  I   ++DKI+L+S + + L + E   + K    L   G + +  R 
Sbjct: 630 FSGKFQVLERFLHKIKRETNDKIVLISNYTQTLDLIEKMCRYKKYGALRLDGTMNINKRQ 689

Query: 661 LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                FN+  D    I LLS K GG G+NLIG N L
Sbjct: 690 KLVDRFNDP-DGAEFIFLLSSKAGGCGINLIGANRL 724


>UniRef50_A5DHG4 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 1155

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 12/103 (11%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML-------NKNNDSTNRI 161
           AL  + RW +TGTP+ N+  DMYS++ FL+  P+++   WK          K   + + +
Sbjct: 674 ALRLSRRWVLTGTPVINRLDDMYSLVKFLELEPWSNFSYWKTFVTEPFEQRKIKQTIDVV 733

Query: 162 KSIIKKIVLKRDKS-----EISFNIPKHTVEYVHVNLMKKKKR 275
           KSI+  I+L+R K+     E+   +P+  V    V   +++++
Sbjct: 734 KSILDPILLRRTKNMRVDGELLVELPEKEVSIQEVTFNERERQ 776



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 5/75 (6%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKN---IATLMYTGQLKVEDRILAETTFNNAADTQHR-- 705
            +++++ SQ+  YL + EN  K +       + + G+LK+ +R     +FNN  DT  R  
Sbjct: 998  ERVVVFSQFSSYLDLIENELKVQGSDIFHVVKFDGRLKMHERNQLIESFNND-DTSPRVS 1056

Query: 706  ILLLSIKCGGVGLNL 750
            ILLLS+K GGVGLNL
Sbjct: 1057 ILLLSLKAGGVGLNL 1071



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
           FNE E+ LYD  +  +   + + +   +S + L R  Q   +L  IL+LRQICCH
Sbjct: 770 FNERERQLYDWFRVRASRVFKEGL---KSGDLLRRYTQ---ILTQILRLRQICCH 818


>UniRef50_Q7NAF6 Cluster: HepA/SNF2; n=1; Mycoplasma
            gallisepticum|Rep: HepA/SNF2 - Mycoplasma gallisepticum
          Length = 1132

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +1

Query: 520  DILNT---SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            DI+N    S+ K +L SQ++  + +F+   +Q+NI   + TG    E R+     FNNA 
Sbjct: 971  DIINNAIKSNKKTLLFSQYLGVISLFKKELEQRNIKYFILTGDTPKEVRLQYVNDFNNAK 1030

Query: 691  DTQHRILLLSIKCGGVGLNLIG 756
            +    + + S+K GGVGLNL G
Sbjct: 1031 EP--AVFIASLKAGGVGLNLTG 1050


>UniRef50_Q9U2S8 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 833

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 29/73 (39%), Positives = 41/73 (56%)
 Frame = +1

Query: 550 ILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKC 729
           ++VS ++E L + +   +  N   L   G+ +V DR     TFN+  D  + I LLS K 
Sbjct: 537 VIVSNYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSN-IFLLSTKA 595

Query: 730 GGVGLNLIGGNTL 768
           GGVGLNLIG + L
Sbjct: 596 GGVGLNLIGASRL 608



 Score = 33.1 bits (72), Expect = 8.2
 Identities = 18/81 (22%), Positives = 39/81 (48%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKI 182
           +L    R  +TGTP+ N   + YS+++F+  RP     + +     +D   ++  +I + 
Sbjct: 361 SLEIPRRLILTGTPMQNDFEEFYSLLDFV--RPSVFGSIVEFRKMCSDRPEQLNELIDEC 418

Query: 183 VLKRDKSEISFNIPKHTVEYV 245
           +L+R  +++         EY+
Sbjct: 419 MLRRTAADVDLKHLPEKHEYI 439


>UniRef50_Q4UHZ3 Cluster: Recombinational repair (RAD54 homologue)
           protein; n=2; Theileria|Rep: Recombinational repair
           (RAD54 homologue) protein - Theileria annulata
          Length = 806

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 28/86 (32%), Positives = 47/86 (54%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L+  I   S+D+++++S + + L +FE   K+ +       G   ++ R    TTFN+  
Sbjct: 497 LLYQIRKNSNDRVVIISNYTQTLDLFERLCKECSYPFERLDGGTSIKKRHKLVTTFND-P 555

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
           ++   + LLS K GG G+NLIG N L
Sbjct: 556 NSNSFVFLLSSKAGGCGINLIGANRL 581


>UniRef50_A5DDP1 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 888

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 27/76 (35%), Positives = 41/76 (53%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K++LVS + + LK+ E    + N+ +L   G    ++R      FN  +     I LLS
Sbjct: 615 EKVVLVSNYTQTLKLLEQSVNKLNMKSLRLDGTTANKERDKLVNQFNKLSAESTMIFLLS 674

Query: 721 IKCGGVGLNLIGGNTL 768
            K GGVGLNL+G + L
Sbjct: 675 AKAGGVGLNLVGASRL 690


>UniRef50_A0DNE7 Cluster: Chromosome undetermined scaffold_58, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_58,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1135

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 12/96 (12%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-MLNKNNDSTN-----RIKSIIKKI 182
           RWC TGTPI N   DM+S+I+F++  P++D   W   +NK ++         + SI++ I
Sbjct: 694 RWCSTGTPIQNNLNDMFSLIHFIKLEPWSDYLWWNAYINKPHEEGKDNIFPLLNSILRPI 753

Query: 183 VLKRDKSEIS------FNIPKHTVEYVHVNLMKKKK 272
           +L+R K           N+P   + + ++ L K ++
Sbjct: 754 LLRRTKKSKDQNGRPIINLPNKEIHFEYIELKKDER 789



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/75 (29%), Positives = 41/75 (54%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
            ++K ++ +Q++  +++ E     + I  L   G +  ++R     TF    D ++RI ++
Sbjct: 983  NEKCVIFTQFIGMIQMIEFDLDNQKIKHLRLDGSMPQQERAEVLKTFKE--DDEYRIFII 1040

Query: 718  SIKCGGVGLNLIGGN 762
            S+K GGVGLNL   N
Sbjct: 1041 SLKAGGVGLNLTSAN 1055


>UniRef50_Q7S8T9 Cluster: Putative uncharacterized protein
           NCU05246.1; n=5; Eukaryota|Rep: Putative uncharacterized
           protein NCU05246.1 - Neurospora crassa
          Length = 1111

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/96 (30%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP------RVWKMLNKNNDSTNRIKS 167
           L A+ RW +TGTPI NK  D+ S++ FL+ +PF++        +    N + +   +++ 
Sbjct: 636 LQASRRWAVTGTPIQNKLEDLASLLAFLRVKPFDEKIKFLQYIIAPFKNADPEIVPKLRV 695

Query: 168 IIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           +I  I L+R K +I  N+P  T E + ++   +++R
Sbjct: 696 LIDTITLRRLKDKI--NLPPRTDEIIRLDFTPEEQR 729



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 20/69 (28%), Positives = 32/69 (46%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K ++ S W  +L + E   +   I      G++    R  A   F    D   +++L+SI
Sbjct: 954  KSVVFSGWTSHLDLIELALEDAGITFTRLDGKMTRTARTAAMDKFRE--DPSVQVILVSI 1011

Query: 724  KCGGVGLNL 750
              GG+GLNL
Sbjct: 1012 MAGGLGLNL 1020


>UniRef50_Q2HA80 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1558

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/81 (34%), Positives = 43/81 (53%)
 Frame = +1

Query: 520  DILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
            D    + DK+++ SQ +  L   EN FK+K +      G  K+  R  +   FN  A++Q
Sbjct: 1072 DECKKAKDKVLVFSQSIPTLDYIENIFKRKRVVYQRLDGSTKMSTRQASVKKFNTDAESQ 1131

Query: 700  HRILLLSIKCGGVGLNLIGGN 762
              + L+S + GGVGLN+ G N
Sbjct: 1132 --VYLVSTRSGGVGLNIHGAN 1150


>UniRef50_Q92698 Cluster: DNA repair and recombination protein
           RAD54-like; n=35; Eumetazoa|Rep: DNA repair and
           recombination protein RAD54-like - Homo sapiens (Human)
          Length = 747

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK++LVS + + L +FE   + +    +   G + ++ R      FN+ +     + +
Sbjct: 512 SSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDF-VFM 570

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GG GLNLIG N L
Sbjct: 571 LSSKAGGCGLNLIGANRL 588


>UniRef50_Q0SU98 Cluster: DNA/RNA helicase, SNF2; n=2; Clostridium
            perfringens|Rep: DNA/RNA helicase, SNF2 - Clostridium
            perfringens (strain SM101 / Type A)
          Length = 1069

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
            S  KI+L SQ+   L+  E  FK+++I+ L   G    +DR+     FN   D+  ++ L
Sbjct: 913  SGKKILLFSQFTSVLQKIEEDFKKEDISYLYLDGGTSAKDRVERVKKFNE--DSNIKVFL 970

Query: 715  LSIKCGGVGLNLIGGNTL 768
            +S+K GGVGLNL   + +
Sbjct: 971  ISLKAGGVGLNLTSASVV 988



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINF-LQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSE 206
            +TGTPI N   +++S+ +F +    F   R  +    +  + + +KS+I   +L+R K E
Sbjct: 761  LTGTPIENNLMELWSIFDFVMPGYLFTKERFRERFILDESNLSELKSLITPFILRRLKEE 820

Query: 207  ISFNIPKHTVEYVHVNLMKKKKR 275
            +   +P+   +   V +  K+K+
Sbjct: 821  VLSELPEKLEKKYLVEMKGKQKQ 843


>UniRef50_O00914 Cluster: PfSNF2L; n=11; Eukaryota|Rep: PfSNF2L -
           Plasmodium falciparum
          Length = 1422

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML----------NKNNDSTN 155
           L + NR  ITGTP+HN   +++S++NFL  + F++   +  L          NK ++   
Sbjct: 465 LRSENRLLITGTPLHNNLKELWSLLNFLMPKIFDNSEEFDNLFNISKISTNDNKQSEIIT 524

Query: 156 RIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           ++ +I+K  +L+R K E+  ++P     Y+ V + K +K+
Sbjct: 525 QLHTILKPFMLRRLKVEVEQSLPPKREIYIFVGMSKLQKK 564



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 22/75 (29%), Positives = 40/75 (53%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   + +++L SQ    L I +++ + KN   L   G    ++R +    FN   ++++ 
Sbjct: 635 LKKENSRVLLFSQMTRLLDIIDDYCRWKNYPYLRIDGSTPGDERQVRINQFNEP-NSKYF 693

Query: 706 ILLLSIKCGGVGLNL 750
           I LLS + GG+G+NL
Sbjct: 694 IFLLSTRAGGIGINL 708


>UniRef50_A5K911 Cluster: DNA repair protein rhp16, putative; n=2;
            cellular organisms|Rep: DNA repair protein rhp16,
            putative - Plasmodium vivax
          Length = 1589

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 28/85 (32%), Positives = 45/85 (52%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +++ T+DDK ++ SQ+   L + E   K+ NI      G + +  R     +FN   D
Sbjct: 1428 IQNVMKTTDDKCLIFSQYCSMLDLIEYHLKKHNIICSKLLGYMSMVSRNNILYSFNE--D 1485

Query: 694  TQHRILLLSIKCGGVGLNLIGGNTL 768
               R+LL+S+K GG GLNL   N +
Sbjct: 1486 KHLRVLLISLKAGGEGLNLQVANRI 1510



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 14/28 (50%), Positives = 22/28 (78%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPF 104
            RWC+TGTP+ N+  ++YS+I FL+  P+
Sbjct: 996  RWCLTGTPLQNRIGELYSLIRFLEFYPY 1023


>UniRef50_Q758Q0 Cluster: AEL297Wp; n=1; Eremothecium gossypii|Rep:
           AEL297Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 895

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 28/82 (34%), Positives = 43/82 (52%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
           I + S+DKI+L+S + + L + E   +  +   L   G + +  R      FN+ +  + 
Sbjct: 665 IKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEF 724

Query: 703 RILLLSIKCGGVGLNLIGGNTL 768
            I LLS K GG G+NLIG N L
Sbjct: 725 -IFLLSSKAGGCGINLIGANRL 745


>UniRef50_Q5KK83 Cluster: DNA supercoiling, putative; n=2;
           Filobasidiella neoformans|Rep: DNA supercoiling,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 993

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           ++  I   +++K+++VS W   L + +   K K    L   G    + R      FN   
Sbjct: 611 MLHSIYQCTEEKVVVVSNWTSTLDLIQGLCKLKRYNYLRLDGSTPPKQRQELVDRFNKDK 670

Query: 691 DTQHR-ILLLSIKCGGVGLNLIGGNTL 768
             Q   + LLS K GGVGLNLIGG+ L
Sbjct: 671 GRQESFVFLLSAKAGGVGLNLIGGSRL 697


>UniRef50_Q4P0X0 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 986

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/96 (30%), Positives = 54/96 (56%), Gaps = 16/96 (16%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFND-----PRVWKMLNKNNDS-----TNRI 161
           A +RWC+TGTP+ N  ++M+S+I+FL+ +PF+D      ++   L  NN +       R+
Sbjct: 552 AESRWCLTGTPLQNDAFEMFSLIHFLRIQPFDDYQHFKEKIGDPLKSNNQNRVNWGMKRL 611

Query: 162 KSIIKKIVLKR------DKSEISFNIPKHTVEYVHV 251
             +++ I+L+R      D  +   N+PK  +E + +
Sbjct: 612 CFVLQTIMLRRTKEAKTDDGKPILNLPKRNLELLEL 647


>UniRef50_Q2H388 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 910

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 26/77 (33%), Positives = 46/77 (59%), Gaps = 8/77 (10%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP--------RVWKMLNKNNDSTNRI 161
           L + +RW +TGTPI N+  D+ + + F++  P++DP        R+WK   ++ ++  R+
Sbjct: 532 LDSVSRWAVTGTPIQNRLSDLAAQLKFIRVYPYDDPKQFEADISRLWK-AGEDEEAAKRL 590

Query: 162 KSIIKKIVLKRDKSEIS 212
           K +   I+L+R KS IS
Sbjct: 591 KCLSACILLRRAKSTIS 607


>UniRef50_O13762 Cluster: ATP-dependent DNA helicase; n=1;
           Schizosaccharomyces pombe|Rep: ATP-dependent DNA
           helicase - Schizosaccharomyces pombe (Fission yeast)
          Length = 897

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 29/89 (32%), Positives = 49/89 (55%)
 Frame = +1

Query: 496 QTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETT 675
           Q    ++D I +  ++KI++ SQ+ +YL +  +  K +NI  + Y G +    R  +  +
Sbjct: 727 QARQTILDIIGSKRNEKILVYSQFSQYLCLVSHMLKLENIRHVRYDGTMSANQRQKSLHS 786

Query: 676 FNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           FNN  D    ++L+S+K G VGLNL   N
Sbjct: 787 FNNDKDV--LVMLVSLKAGSVGLNLTIAN 813



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 18/107 (16%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN-------------ND 146
           L A  RWC++GTPI N   + YS++ FL+ +P+    VW +  K+               
Sbjct: 416 LDAKYRWCLSGTPIQNHIDEFYSLLKFLRIKPYC---VWSLFAKDISRPLKSYRADIVEA 472

Query: 147 STNRIKSIIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKK 272
           +  R++ ++   V +R K + ++     N+P  T+  V VNL+ +++
Sbjct: 473 ALKRLRILLASTVFRRTKETRVNNLPIVNLPPKTIRTVSVNLLPEER 519


>UniRef50_UPI0000499C2F Cluster: RAD54 DNA repair protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: RAD54 DNA repair
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 710

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 7/92 (7%)
 Frame = +1

Query: 514 VDDILNTSDDKIILVSQWVEYLKIFENFFKQ-------KNIATLMYTGQLKVEDRILAET 672
           + +IL  S +K++LVS + + L +FE +FKQ       K    L   G+   + R +   
Sbjct: 471 IKEILIKSKEKVVLVSNYTKTLDLFEIYFKQEEEYKQKKIFNYLRLDGKTSQKQRDIIVE 530

Query: 673 TFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             N+ + + + ILLLS K GGVGLNLIG + L
Sbjct: 531 KINDKS-SNYNILLLSSKAGGVGLNLIGCSRL 561


>UniRef50_UPI00006CF9D4 Cluster: SNF2 family N-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: SNF2 family N-terminal domain containing
           protein - Tetrahymena thermophila SB210
          Length = 1040

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 13/97 (13%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN-------NDSTNRIKSIIKK 179
           +WC+TGTP+ N   D+YS+I FL    ++D   W+   KN       ++S   I  II+ 
Sbjct: 539 KWCLTGTPLENSIDDIYSLIRFLNIPKYSDWNWWRQNVKNTKNQEQKSNSFKIINQIIEN 598

Query: 180 IVLKRDK------SEISFNIPKHTVEYVHVNLMKKKK 272
           + L+R K       E   +IP+  ++ ++++L   +K
Sbjct: 599 LTLRRTKKSQYANGESITSIPEKQIQNIYIDLFDNEK 635



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 13/51 (25%), Positives = 33/51 (64%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL 642
           ++Q +  ++++I +   +K+I+ SQW++ L + E   ++K I+ + + G+L
Sbjct: 833 KIQKTVEIIEEI-HKKGEKVIVFSQWIDTLNLLEKHLQKKQISFMRFEGKL 882


>UniRef50_Q73RS9 Cluster: Snf2 family protein; n=1; Treponema
            denticola|Rep: Snf2 family protein - Treponema denticola
          Length = 1194

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +1

Query: 481  YEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIAT--LMYTGQLKVED 654
            Y  +      L+++I++ S +K I+ SQ+V  L I +N   QK + T  L+  GQ+    
Sbjct: 1022 YSGKAAVLIELLNEIIS-SGEKAIIFSQYVGTLDILKNII-QKELGTEPLLLHGQMPASK 1079

Query: 655  RILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            R  A   F    D+ +RI L+S+K GG GLNL   N
Sbjct: 1080 RKKAVEVFQT--DSAYRIFLISLKAGGTGLNLTAAN 1113


>UniRef50_Q4QAQ7 Cluster: DNA repair and recombination protein RAD54,
            putative; n=5; Trypanosomatidae|Rep: DNA repair and
            recombination protein RAD54, putative - Leishmania major
          Length = 1127

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 30/80 (37%), Positives = 39/80 (48%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            N   DK+++VS + + L I       K IA     G   ++ R      FN    +Q  +
Sbjct: 807  NGEHDKLVIVSNFTQTLDIIAALCNSKQIAYFQLDGSTPIKKRQQLVDYFN-VPGSQEIV 865

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
             LLS K GGVGLNLIG N L
Sbjct: 866  FLLSSKAGGVGLNLIGANRL 885


>UniRef50_Q6BMD3 Cluster: Debaryomyces hansenii chromosome F of
           strain CBS767 of Debaryomyces hansenii; n=1;
           Debaryomyces hansenii|Rep: Debaryomyces hansenii
           chromosome F of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 884

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL--KVEDRILAETTFNNAADTQ 699
           +N   DK +L+S + + L + E    + NI+ L   G    K+ D+++ +  FN      
Sbjct: 604 INQIGDKTVLISNYTQTLDLLETILHKLNISFLRLDGSTPNKLRDKLVND--FNKQPVLT 661

Query: 700 HRILLLSIKCGGVGLNLIGGNTL 768
           + + LLS K GGVGLNLIG + L
Sbjct: 662 NSVFLLSAKSGGVGLNLIGASRL 684


>UniRef50_Q1DHG9 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 970

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 15/97 (15%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN-----DPRVWKMLNKNNDST----- 152
           A+ +T RWC++GTP+ N   ++YS+I FL+  P+N     D    + L   +D T     
Sbjct: 438 AIRSTYRWCMSGTPMMNNVTELYSLIRFLRIGPYNKSETFDATFTRPLKTFHDRTQKQAM 497

Query: 153 NRIKSIIKKIVLKRDKS-----EISFNIPKHTVEYVH 248
            ++++++K I+L+R KS     +    +P  T E VH
Sbjct: 498 QKLQALLKAILLRRTKSSKIDGKPILQLPSRTTEKVH 534



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+E+E T Y  L+ +++  + + +       T+ +     +VL ++L+LRQ CCHP+L
Sbjct: 537 FSEDENTFYQSLEQKTQNQFNRYL----DNGTVGK--HYSNVLVMLLRLRQACCHPHL 588


>UniRef50_A6RA37 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 996

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 19/41 (46%), Positives = 29/41 (70%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK 125
           AL +  RWC+TGTP+ N   ++ S+INFL+ +P+ND   W+
Sbjct: 428 ALKSEYRWCLTGTPMQNNLDELQSLINFLRIKPYNDLAAWR 468


>UniRef50_P51532 Cluster: Probable global transcription activator
            SNF2L4; n=132; Euteleostomi|Rep: Probable global
            transcription activator SNF2L4 - Homo sapiens (Human)
          Length = 1647

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/81 (33%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  ++ K++L  Q    + I E++F  +    L   G  K EDR +   TFN    +++ 
Sbjct: 1092 LRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPG-SEYF 1150

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLS + GG+GLNL   +T+
Sbjct: 1151 IFLLSTRAGGLGLNLQSADTV 1171



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + ++ N + T 
Sbjct: 903  APRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETI 962

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P+  VEYV
Sbjct: 963  LIIRRLHKVLRPFLLRRLKKEVEAQLPE-KVEYV 995


>UniRef50_Q5ACX1 Cluster: DNA repair protein RAD5; n=3;
           Saccharomycetales|Rep: DNA repair protein RAD5 - Candida
           albicans (Yeast)
          Length = 1084

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 7/74 (9%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML-------NKNNDSTNRIK 164
           L ++ +W +TGTPI N+  D+YS+  FL+  P+N+   WK          K + + + +K
Sbjct: 613 LQSSRKWILTGTPIVNRLDDLYSLTKFLELDPWNNFSYWKTFVTLPFEQKKISQTLDVVK 672

Query: 165 SIIKKIVLKRDKSE 206
           SI++ I L+R KS+
Sbjct: 673 SILEPIFLRRTKSQ 686



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFK--QKNIATLMYTGQLKVEDRILAETTFNNAA-DTQHRI 708
            + K+I+ SQ+  YL I ++  K   +      + G+L + DR     +FN    D +  I
Sbjct: 927  NSKVIVFSQFSSYLDIIQSELKLASEEFIVFKFDGRLNMNDRTKLLESFNQPLEDGKVAI 986

Query: 709  LLLSIKCGGVGLNL 750
            LLLS+K GGVGLNL
Sbjct: 987  LLLSLKAGGVGLNL 1000



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
           FN++E+ LY   K   + AY       +S   L R  Q   +L  IL+LRQ+CCH
Sbjct: 708 FNDDEEKLYQWFK---DRAYASFAEGIKSGQLLRRYTQ---ILTHILRLRQVCCH 756


>UniRef50_Q6BZX0 Cluster: Similarities with tr|O60177
           Schizosaccharomyces pombe DEAD box helicase; n=1;
           Yarrowia lipolytica|Rep: Similarities with tr|O60177
           Schizosaccharomyces pombe DEAD box helicase - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 1353

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 35/127 (27%), Positives = 67/127 (52%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR-----VWKMLNK--------NND 146
           L A  RWC+TGTP+ N   D+ S++ FL+ +P++  +     +   + K         +D
Sbjct: 579 LDAVYRWCLTGTPMQNTVEDLQSLVKFLRIKPYDKEKSFNHHIASGIKKAAISGKAVRDD 638

Query: 147 STNRIKSIIKKIVLKRDK-SEIS----FNIPKHTVEYVHVNLMKKKKRCTIS*NVNRKRR 311
           S  R++S++  I+L+R K S+I+     N+P  TVE   ++  + +++         +RR
Sbjct: 639 SMKRLQSLLAMIMLRRGKDSKINGAPILNLPPKTVETDAIDFSEDERKFYQDLETGAQRR 698

Query: 312 I*KLWQR 332
           + KL ++
Sbjct: 699 VSKLMRQ 705


>UniRef50_UPI0000D55617 Cluster: PREDICTED: similar to SNF2 histone
           linker PHD RING helicase; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to SNF2 histone linker PHD RING
           helicase - Tribolium castaneum
          Length = 1188

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN---NDSTNRIKSIIK 176
           L A  RW +TGTPI     D++ +I++LQ  P+ND   W+ L        +   +   + 
Sbjct: 343 LNAYFRWAVTGTPISKDISDLHGLIDYLQIEPYNDKFTWEQLLFKLYVRGNPEPMLKFLS 402

Query: 177 KIVLKRDKSEI--SFNIPKHTV 236
           +++ +  K EI    NIPK T+
Sbjct: 403 EVLWRSSKDEIIDQINIPKQTI 424



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +1

Query: 475  GLYEQQVQTSAHLVDDI-LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVE 651
            G Y  +V++   L+  + L   D KI+L S W+  L        + ++ + + T    +E
Sbjct: 1008 GNYSTKVESIVRLILKLRLEDEDVKILLFSTWIPVLSYIREALTKNSVTSELITSG-NLE 1066

Query: 652  DRILAETTFNNAADTQHRILLLSIKCGGVGLNLI 753
             +I     F +A D    +LLL I  GG GLNLI
Sbjct: 1067 KQI---EKFKDA-DQNITVLLLPINLGGKGLNLI 1096


>UniRef50_Q7XNH0 Cluster: OSJNBa0096F01.3 protein; n=4; Oryza
           sativa|Rep: OSJNBa0096F01.3 protein - Oryza sativa
           (Rice)
          Length = 1132

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKNNDSTNRIKS 167
           LT+  RWC+TGTP+ N   D++S++ FL   P+ D   W  L      N +      +++
Sbjct: 695 LTSHCRWCLTGTPLQNNLEDLFSLLCFLHVEPWGDASWWNKLIQRPYENGDERGLKLVRA 754

Query: 168 IIKKIVLKRDK 200
           I++ ++L+R K
Sbjct: 755 ILRPLMLRRTK 765



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    +K I+ SQ+  +  + E  F QK I  L + G+L  + R      F+ + D    
Sbjct: 978  LQEKREKSIVFSQFTSFFDLLEVPFNQKGIKFLRFDGKLSQKHREKVLKEFSESKDKL-- 1035

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            +LL+S+K GGVGLNL   + +
Sbjct: 1036 VLLMSLKAGGVGLNLTAASNV 1056



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = +2

Query: 239 VCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
           +  C  +E+E+  Y+ L   S+  + K VA        S L    ++L L+L+LRQ C H
Sbjct: 785 IVECEQSEDERDFYEALFRRSKVQFDKFVAQG------SVLNNYANILELLLRLRQCCDH 838

Query: 419 PYLAM 433
           P+L +
Sbjct: 839 PFLVI 843


>UniRef50_O04082 Cluster: Transcription factor RUSH-1alpha isolog;
            18684-24052; n=2; Arabidopsis thaliana|Rep: Transcription
            factor RUSH-1alpha isolog; 18684-24052 - Arabidopsis
            thaliana (Mouse-ear cress)
          Length = 1227

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN------NDSTNRIKS 167
            L A  RWC++GTPI N   D+YS   FL+  P++  + +    KN       +    +++
Sbjct: 739  LHAKRRWCLSGTPIQNSIADLYSYFRFLKYDPYSSYQTFCETIKNPISSYPGEGYKTLQA 798

Query: 168  IIKKIVLKRDKSEI-----SFNIPKHTVEYVHVNLMKKKK 272
            I+KK++L+R K  +       ++P  ++E   V+  K+++
Sbjct: 799  ILKKVMLRRTKDTLLDGKPVISLPPKSIELRRVDFTKEER 838



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/80 (27%), Positives = 41/80 (51%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            V  ++N + +K I+ +QW + L + E   K   I    + G++ V  R  A   FN   D
Sbjct: 1064 VGGVVNVAGEKAIVFTQWTKMLDLLEAGLKSSGIQYRRFDGKMTVPARDAAVQDFNTLPD 1123

Query: 694  TQHRILLLSIKCGGVGLNLI 753
                ++++S+K   +GLN++
Sbjct: 1124 VS--VMIMSLKAASLGLNMV 1141



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F +EE+  Y KL+C+S + + +   A     T+   Q   ++L ++L+LRQ C HP L
Sbjct: 833 FTKEERDFYSKLECDSRDQFKEYAEA----GTVK--QNYVNILLMLLRLRQACGHPLL 884


>UniRef50_A4S1Y4 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 983

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 26/88 (29%), Positives = 45/88 (51%)
 Frame = +1

Query: 505 AHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN 684
           A L+ ++   + D+I+++S + + L +  N  +++N   +   G   +  R      FN+
Sbjct: 539 ARLLANLRAETKDRIVIISNYTQTLDLVGNMCRERNYPFVRLDGSTSIGKRQKLVKQFND 598

Query: 685 AADTQHRILLLSIKCGGVGLNLIGGNTL 768
                  + LLS K GG G+NLIGGN L
Sbjct: 599 PTSNSF-VFLLSSKAGGCGINLIGGNRL 625


>UniRef50_Q2USX0 Cluster: Helicase-like transcription factor
           HLTF/DNA helicase RAD5; n=1; Aspergillus oryzae|Rep:
           Helicase-like transcription factor HLTF/DNA helicase
           RAD5 - Aspergillus oryzae
          Length = 1003

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 19/37 (51%), Positives = 28/37 (75%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR 116
           L A +RWC++GTPI N   D+ S++ F+Q +PF+DPR
Sbjct: 581 LRAKSRWCLSGTPIQNSLGDLGSLLAFIQLKPFHDPR 617


>UniRef50_Q2UMV9 Cluster: Helicase-like transcription factor
           HLTF/DNA helicase RAD5; n=6; Trichocomaceae|Rep:
           Helicase-like transcription factor HLTF/DNA helicase
           RAD5 - Aspergillus oryzae
          Length = 1157

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 7/79 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLN-KNNDSTNRI 161
           AL A  RWC++GTP+ N   ++ S+I FL+ +P+ND   WK      + N +   +  R+
Sbjct: 544 ALDAEYRWCLSGTPMQNNLDELQSLIKFLRIKPYNDLAAWKEQITKPLANGRGALAIERL 603

Query: 162 KSIIKKIVLKRDKSEISFN 218
           + ++K  + +R K  +  N
Sbjct: 604 QVVLKAFMKRRTKDVLKLN 622



 Score = 37.1 bits (82), Expect = 0.50
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +1

Query: 532  TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
            +SD K I+ S +   L   E F ++  I    Y G ++ + R  +     N + T  R+L
Sbjct: 931  SSDYKFIVFSVFTSMLDKIEPFLQRAGIGFARYDGGMRNDLREASLNKLRNNSGT--RVL 988

Query: 712  LLSIKCGGVGLNL 750
            L S++ G +GLNL
Sbjct: 989  LCSLRAGALGLNL 1001


>UniRef50_Q9FIY7 Cluster: Putative SWI/SNF-related matrix-associated
            actin-dependent regulator of chromatin subfamily A member
            3-like 3; n=1; Arabidopsis thaliana|Rep: Putative
            SWI/SNF-related matrix-associated actin-dependent
            regulator of chromatin subfamily A member 3-like 3 -
            Arabidopsis thaliana (Mouse-ear cress)
          Length = 1277

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 6/71 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNK---NND--STNRIKS 167
            L++  RWC+TGTP+ NK  D+YS++ FL   P+ +   W K++ K   N D      IK+
Sbjct: 841  LSSHCRWCLTGTPLQNKLEDLYSLLCFLHVEPWCNWAWWSKLIQKPYENGDPRGLKLIKA 900

Query: 168  IIKKIVLKRDK 200
            I++ ++L+R K
Sbjct: 901  ILRPLMLRRTK 911



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/78 (34%), Positives = 42/78 (53%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
            S +K I+ SQW  +L + E   +++    L + G+L  + R      FN     Q  ILL
Sbjct: 1126 SGEKSIVFSQWTSFLDLLEIPLRRRGFEFLRFDGKLAQKGREKVLKEFNETK--QKTILL 1183

Query: 715  LSIKCGGVGLNLIGGNTL 768
            +S+K GGVGLNL   +++
Sbjct: 1184 MSLKAGGVGLNLTAASSV 1201


>UniRef50_A2FNE0 Cluster: SNF2 family N-terminal domain containing
           protein; n=1; Trichomonas vaginalis G3|Rep: SNF2 family
           N-terminal domain containing protein - Trichomonas
           vaginalis G3
          Length = 1366

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 26/85 (30%), Positives = 49/85 (57%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVW--KMLN-KNNDSTNRIKSIIKKIVLKRDK 200
           +TGTPI N   ++YS+++F+    FN    +  K  N  N++  + +K +IK  +L+R K
Sbjct: 407 LTGTPIQNNVDELYSLLSFIDKENFNSSEEFDEKFGNMTNSEQVDELKKLIKPYILRRHK 466

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           S++  +I   T   + V L +++K+
Sbjct: 467 SDVDNSILPKTETIIDVELTRQQKK 491



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 43/81 (53%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   ++K+++ SQW   L I E++ +  +       G +K  DR  A   F + A++   
Sbjct: 586 LKQKNEKVLIFSQWTHILDILEDYLRYISFNYERLDGSVKPSDRQTAIDRFKDNANSF-- 643

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + L+S K GGVG+NL   +T+
Sbjct: 644 VFLISTKAGGVGINLTTASTV 664


>UniRef50_A6QYV5 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 1128

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 27/102 (26%), Positives = 57/102 (55%), Gaps = 13/102 (12%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML----NKNND---STNRIK 164
           +  T+RW +TGTPI N+  D++S++ FL+  P+++   WK       ++ D   + N ++
Sbjct: 646 IKGTHRWALTGTPIVNRLEDLFSLVRFLKVEPWSNFSFWKTFVTVPFESKDFLRALNVVQ 705

Query: 165 SIIKKIVLKRDKS------EISFNIPKHTVEYVHVNLMKKKK 272
           ++++ +VL+R K+      E    +P  T++   V L  +++
Sbjct: 706 TVLEPLVLRRTKTMKTPDGEALVPLPSRTIKIAEVELSSQER 747



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMH 436
           + +E+ +YD +   ++  +   VAA     TL  L+    +   IL+LRQ CCHP L  +
Sbjct: 743 SSQEREIYDLIFTRAKRTFNDNVAA----GTL--LKSYTTIFAQILRLRQTCCHPVLTRN 796

Query: 437 GRNLLETND 463
              + E  D
Sbjct: 797 QNIVAEEED 805


>UniRef50_A2QWZ3 Cluster: Function: S. pombe Rhp16 is involved in
           the nucleotide excision repair of UV damage; n=1;
           Aspergillus niger|Rep: Function: S. pombe Rhp16 is
           involved in the nucleotide excision repair of UV damage
           - Aspergillus niger
          Length = 910

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 19/41 (46%), Positives = 28/41 (68%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK 125
           +L A  RWC++GTP+ N   ++ S+I FL+ +PFND   WK
Sbjct: 418 SLDAEYRWCLSGTPMQNNLEELQSLIKFLRIKPFNDLAAWK 458



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           +SD K I+ S +   L   E F K+  I    Y G ++ + R  +     N + T  R+L
Sbjct: 687 SSDHKFIVFSVFTSMLDKIEPFLKRTGIGYARYDGGMRNDHREASLNKLRNNSGT--RVL 744

Query: 712 LLSIKCGGVGLNL 750
           L S++ G +GLNL
Sbjct: 745 LCSLRAGALGLNL 757


>UniRef50_Q830T4 Cluster: Snf2 family protein; n=2; Enterococcus|Rep:
            Snf2 family protein - Enterococcus faecalis
            (Streptococcus faecalis)
          Length = 1065

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            +++L SQ+   L I E    +  + T    G  K +DR+     FN     +  + L+S+
Sbjct: 913  RVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRLTMANAFNEG---EKDVFLISL 969

Query: 724  KCGGVGLNLIGGNTL*CWSL 783
            K GG GLNL G +T+  + L
Sbjct: 970  KAGGTGLNLTGADTVILYDL 989


>UniRef50_Q54T24 Cluster: Helicase; n=2; Dictyostelium discoideum|Rep:
            Helicase - Dictyostelium discoideum AX4
          Length = 1540

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 5/73 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPF-NDPRVWKMLNKNNDSTNRIKSIIKK- 179
            L + NRWC+TGTP  N   D++ M+ FL   P   +   W+ L ++    +  K I+KK 
Sbjct: 873  LDSVNRWCLTGTPYQNNCTDLFPMLYFLNVFPIAKNIATWRKLVESIQDQSEKKKILKKY 932

Query: 180  ---IVLKRDKSEI 209
               I+L R K ++
Sbjct: 933  LNPIILSRSKKDV 945



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 7/80 (8%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQ----KNIATLMYTGQLKVEDRILAETTF---NNAADTQH 702
            K I+ S W  +L + E         K++      G+L +  R     +F   +N  +   
Sbjct: 1335 KGIVFSHWTMFLDLIEESLIANDWIKDVDFCRIDGKLPISKREAIIDSFQAKSNNGNGGP 1394

Query: 703  RILLLSIKCGGVGLNLIGGN 762
            R++L+SI CGG+GLNL   N
Sbjct: 1395 RLMLMSITCGGIGLNLERAN 1414


>UniRef50_Q54RP8 Cluster: SNF2-related domain-containing protein;
           n=2; Dictyostelium discoideum AX4|Rep: SNF2-related
           domain-containing protein - Dictyostelium discoideum AX4
          Length = 931

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +1

Query: 481 YEQQVQTSAHLVDDILNT-SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDR 657
           Y  ++     L+ +I N+ S DK +++S + + L++     K +  A     G      R
Sbjct: 615 YSSKLLFVDRLLANIRNSKSGDKTVIISNYTQTLEVLATMCKTRGYAYFQLDGSTANAKR 674

Query: 658 ILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                 +N+ A  +  + LLS K GGVGLNLIGGN L
Sbjct: 675 QQLVNLYNDPARPEF-VFLLSSKAGGVGLNLIGGNHL 710


>UniRef50_Q54Q16 Cluster: CHD gene family protein containing
            chromodomain, helicase domain, and DNA-binding domain;
            n=2; Eukaryota|Rep: CHD gene family protein containing
            chromodomain, helicase domain, and DNA-binding domain -
            Dictyostelium discoideum AX4
          Length = 1917

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 25/90 (27%), Positives = 50/90 (55%), Gaps = 3/90 (3%)
 Frame = +3

Query: 15   TNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLN---KNNDSTNRIKSIIKKIV 185
            TNR  +TGTP+ N   ++++++NFL    F   + ++      K ND   ++ S++K  +
Sbjct: 913  TNRLLVTGTPLQNSLKELWNLLNFLMPNKFTSLKDFQDQYSDLKENDQIAQLHSVLKPHL 972

Query: 186  LKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            L+R K ++  ++P  T   + V+L   +K+
Sbjct: 973  LRRIKKDVEKSLPPKTERILRVDLSNVQKK 1002



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 25/81 (30%), Positives = 40/81 (49%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L I  ++ K ++       G +  E R  A   FN A D+   
Sbjct: 1077 LKETGHRVLIFSQMVRMLDILADYLKGRSFQFQRLDGSMSREKRSQAMDRFN-AVDSPDF 1135

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS K GG+G+NL   +T+
Sbjct: 1136 CFLLSTKAGGLGINLSTADTV 1156


>UniRef50_Q4PH42 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1605

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
            LTA  R C+TGTPI N   D+Y+++ FL+  PF D  VW
Sbjct: 984  LTAQRRLCLTGTPIQNTINDLYALVKFLRLEPFTDRAVW 1022



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 3/73 (4%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            K ++ SQW    K+ +   K  NI  + YT   G +   DR  A   F   A  +  +LL
Sbjct: 1486 KSVVFSQWT---KMLDRIQKSLNITGIRYTRLDGTMSRPDRTAALEAFKRDAGIE--VLL 1540

Query: 715  LSIKCGGVGLNLI 753
            +S++ GG GLNL+
Sbjct: 1541 VSLRAGGTGLNLV 1553


>UniRef50_Q0U4P8 Cluster: Putative uncharacterized protein; n=3;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1122

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 6/96 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR------VWKMLNKNNDSTNRIKS 167
           L    RW +TGTP+ N+  D+ ++ NF++  PFN  +      V    N + D   +++ 
Sbjct: 639 LFGQRRWAVTGTPVQNRLEDLGALFNFIKLSPFNTQQGFNQYVVHPFKNADPDVVPKLQL 698

Query: 168 IIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           ++  + ++R K  I   +PK     V +   K++++
Sbjct: 699 LVSTVTMRRTKEIIKDEVPKRNDIIVKLEFSKEERQ 734


>UniRef50_P43610 Cluster: Uncharacterized ATP-dependent helicase
           YFR038W; n=6; Saccharomycetales|Rep: Uncharacterized
           ATP-dependent helicase YFR038W - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 853

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 25/75 (33%), Positives = 43/75 (57%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K+++ SQ+V  L + E++    + AT    G +  E R      FN++ D +H I LLS 
Sbjct: 621 KVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKDQLEKFNSSKD-KHNIFLLST 679

Query: 724 KCGGVGLNLIGGNTL 768
           +  G+G+NL+G +T+
Sbjct: 680 RAAGLGINLVGADTV 694


>UniRef50_Q9Y620 Cluster: DNA repair and recombination protein
           RAD54B; n=21; Eumetazoa|Rep: DNA repair and
           recombination protein RAD54B - Homo sapiens (Human)
          Length = 910

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 29/76 (38%), Positives = 40/76 (52%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K++LVS + + L I +   K+   A     GQ  +  R      FN+   +   I LLS
Sbjct: 661 EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQ-HSSFFIFLLS 719

Query: 721 IKCGGVGLNLIGGNTL 768
            K GGVGLNLIGG+ L
Sbjct: 720 SKAGGVGLNLIGGSHL 735


>UniRef50_Q8EUL7 Cluster: Helicase with SNF2 domain; n=1; Mycoplasma
            penetrans|Rep: Helicase with SNF2 domain - Mycoplasma
            penetrans
          Length = 1041

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/86 (31%), Positives = 47/86 (54%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            L+ D++  ++DKI+L SQ+   + +     K+  I  L+ TG+   ++R+     FNN  
Sbjct: 879  LIKDLIK-NNDKILLFSQFTSMIDLIAQELKKLKINFLVLTGETNKKERMELVNEFNNKN 937

Query: 691  DTQHRILLLSIKCGGVGLNLIGGNTL 768
            +   +I L+S+K GG GL L   N +
Sbjct: 938  NI--KIFLISLKAGGTGLTLTSANAV 961



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 20/87 (22%), Positives = 46/87 (52%), Gaps = 6/87 (6%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVW------KMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   +++S+ +++      D +++      K++ K+ ++  ++K+ I   +L+
Sbjct: 729 LTGTPIENNLLELWSIFDYIMPGFLYDYKLFKSLFQDKIIAKDEEALKKLKTKISPFILR 788

Query: 192 RDKSEISFNIPKHTVEYVHVNLMKKKK 272
           R K E+   +P  T + +      K+K
Sbjct: 789 RTKEEVLKELPSKTYKIMTCEFEDKQK 815



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 19/71 (26%), Positives = 38/71 (53%)
 Frame = +2

Query: 236 RVCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICC 415
           ++ TC F +++K +Y     +S+ A  K +     + T+++  Q   +  ++ KLRQICC
Sbjct: 804 KIMTCEFEDKQKEMYYAELSKSQIAIRKGI----EDKTINK--QGAFIFSVLTKLRQICC 857

Query: 416 HPYLAMHGRNL 448
            P L+    ++
Sbjct: 858 SPKLSYENSDI 868


>UniRef50_Q00T92 Cluster: Swi2/Snf2-related protein DDM1; decrease
           in DNA methylation 1; CHR1; n=1; Ostreococcus tauri|Rep:
           Swi2/Snf2-related protein DDM1; decrease in DNA
           methylation 1; CHR1 - Ostreococcus tauri
          Length = 708

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     K+++ SQ    L + E++F+Q+        G +K +DR      FN   D  + 
Sbjct: 484 LRARGHKVLVFSQMTRMLDLLESYFQQRGENVCRIDGSVKQDDRREFIAKFNT--DPDYG 541

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I LLS + GG+G+NL  G+T+
Sbjct: 542 IFLLSTRAGGLGINLTAGDTV 562


>UniRef50_Q55A57 Cluster: Putative uncharacterized protein; n=2;
            Dictyostelium discoideum|Rep: Putative uncharacterized
            protein - Dictyostelium discoideum AX4
          Length = 1210

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 19/40 (47%), Positives = 29/40 (72%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
            AL +  RWC+TGTPI NK  D++S+++FL+  PF++   W
Sbjct: 1146 ALESIIRWCVTGTPIQNKLDDLFSLLHFLRVEPFHNYSWW 1185


>UniRef50_Q4QA20 Cluster: DNA repair protein, putative; n=3;
           Leishmania|Rep: DNA repair protein, putative -
           Leishmania major
          Length = 1092

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF 104
           AL A  RWC+TGTP+ N+  D+YS++ FL+ RP+
Sbjct: 590 ALAAEYRWCLTGTPLQNRVGDLYSLLRFLRMRPY 623



 Score = 41.5 bits (93), Expect = 0.023
 Identities = 23/91 (25%), Positives = 50/91 (54%)
 Frame = +1

Query: 478  LYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDR 657
            L+  ++   A+ ++++    D+K+++ SQ+   L + + + ++++I  +   G L +  R
Sbjct: 921  LHGTKLDAIANYIEEV--PKDEKVVVFSQFGSMLDLTQYWLQRRSIRAVKLCGSLTLTQR 978

Query: 658  ILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
                  F +  D   R++L+S+K GG GLNL
Sbjct: 979  QSVLQAFLH--DQNVRVILISLKAGGEGLNL 1007


>UniRef50_Q1E8B1 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 1034

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 7/79 (8%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-----KMLNKNND--STNRI 161
           AL +  RWC+TGTP+ N   ++ S+I FLQ +P++D   W     + LN      +  R+
Sbjct: 426 ALDSLYRWCLTGTPMQNNLDELQSLIRFLQIKPYDDLAAWRDQITRPLNNGRGGLAIRRL 485

Query: 162 KSIIKKIVLKRDKSEISFN 218
           +  +K  + +R K  +  N
Sbjct: 486 QIYLKAFMKRRTKDVLKLN 504



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ S +   L   E F K   I    Y G ++ + R  +     +++ T  R+LL S+
Sbjct: 802  KFIVFSVFTSMLDKIEPFLKSAGIGYARYDGGMRNDLREASLEKLRHSSST--RVLLCSL 859

Query: 724  KCGGVGLNL 750
            + G +GLNL
Sbjct: 860  RAGSLGLNL 868


>UniRef50_Q9LJK7 Cluster: DNA repair protein RAD54-like; n=6;
           Magnoliophyta|Rep: DNA repair protein RAD54-like -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 959

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 27/88 (30%), Positives = 43/88 (48%)
 Frame = +1

Query: 505 AHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN 684
           + L+ ++   +DD+I+LVS + + L +F    +++    L   G   +  R       N+
Sbjct: 540 SRLLANLRRKTDDRIVLVSNYTQTLDLFAQLCRERRYPFLRLDGSTTISKRQKLVNRLND 599

Query: 685 AADTQHRILLLSIKCGGVGLNLIGGNTL 768
               +    LLS K GG GLNLIG N L
Sbjct: 600 PTKDEF-AFLLSSKAGGCGLNLIGANRL 626


>UniRef50_Q08562 Cluster: ATP-dependent helicase RIS1; n=2;
            Saccharomyces cerevisiae|Rep: ATP-dependent helicase RIS1
            - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1619

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +1

Query: 484  EQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQK-NIATLMYTGQLKVEDRI 660
            EQ +Q    + D+   ++ +KII+ SQ+  + +I E+F K K N   L Y G +  + R 
Sbjct: 1446 EQCIQVIQRVFDE---SATEKIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSMNAQRRS 1502

Query: 661  LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
                 F    D + RILL+S+K G  GL L   N
Sbjct: 1503 DVINEFYR--DPEKRILLISMKAGNSGLTLTCAN 1534



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 14/36 (38%), Positives = 25/36 (69%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM 128
            RW ++GTPI N   ++YS+I FL+  P++  + +K+
Sbjct: 1132 RWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKL 1167


>UniRef50_P36607 Cluster: DNA repair protein rad5; n=1;
           Schizosaccharomyces pombe|Rep: DNA repair protein rad5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 1133

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 26/73 (35%), Positives = 47/73 (64%), Gaps = 7/73 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK----MLNKNND---STNRI 161
           ++++ NRW ITGTPI NK  D+YS+I F++  P+ +   W+    +  ++ D   + N +
Sbjct: 674 SISSQNRWVITGTPIVNKLDDLYSLIKFMRYEPWCNYTYWQTFVSLPYQSKDVLKALNVV 733

Query: 162 KSIIKKIVLKRDK 200
           +SI++ +VL+R K
Sbjct: 734 QSILEFLVLRRTK 746



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 42/78 (53%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            ++  +K+++ SQ+  +L I  +  + + +    + G +  + R  A  TF N  D    +
Sbjct: 978  SSEPEKVVIFSQFTTFLDIIADVLESEKMGYARFDGTMSQQMRSTALETFRNDPDVN--V 1035

Query: 709  LLLSIKCGGVGLNLIGGN 762
            L++S+K GGVGLNL   N
Sbjct: 1036 LIISLKAGGVGLNLTCAN 1053



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 23/73 (31%), Positives = 36/73 (49%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           F++ E+ +YD L  +++      + A     TL R      +L L+L+LRQ CC P L  
Sbjct: 771 FSDSERKIYDSLYTKAKSTVNANIVA----GTLFR--NYTTILGLLLRLRQACCDPVLLS 824

Query: 434 HGRNLLETNDCFK 472
           +     ET D F+
Sbjct: 825 NMTINSETFDDFE 837


>UniRef50_A4S2Y5 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 821

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/78 (34%), Positives = 43/78 (55%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           +D++I++VS +   L +     + +++      G    ++R     TFNN+     +ILL
Sbjct: 589 NDERIVVVSGFTTTLDLIAKLCESEHLKYDRLQGSTPPKERTSIVRTFNNSG----KILL 644

Query: 715 LSIKCGGVGLNLIGGNTL 768
           LS K GGVGLNL+G N L
Sbjct: 645 LSTKAGGVGLNLVGANRL 662


>UniRef50_Q5CNL9 Cluster: DNA repair protein RAD54-like; n=2;
           Cryptosporidium|Rep: DNA repair protein RAD54-like -
           Cryptosporidium hominis
          Length = 877

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/88 (30%), Positives = 45/88 (51%)
 Frame = +1

Query: 505 AHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN 684
           + L+  I + + D+++LVS + + L +FE   +   +  +   G   +  R     TFN+
Sbjct: 516 SRLLFHIRSNTKDRVVLVSNYTQTLDVFECLCRDLQVPCVRLDGSTSITRRHNLVKTFND 575

Query: 685 AADTQHRILLLSIKCGGVGLNLIGGNTL 768
             ++     LLS K GG G+NLIG N L
Sbjct: 576 -PNSNSFAFLLSSKAGGCGINLIGANRL 602


>UniRef50_Q4Z6K3 Cluster: DNA helicase, putative; n=4; Eukaryota|Rep:
            DNA helicase, putative - Plasmodium berghei
          Length = 1396

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-------LNKNNDSTNRIK 164
            L    +WC+TGTPI N  +D++ ++ FL  +P+ +   W          NK N + + ++
Sbjct: 872  LRGERKWCLTGTPIQNSLYDIFPLLRFLGIKPYGNVEWWNKEIVDYVNRNKLNIALDIVR 931

Query: 165  SIIKKIVLKRDKS 203
             I   I+L+R KS
Sbjct: 932  KISSPILLRRTKS 944



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 20/101 (19%)
 Frame = +1

Query: 508  HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN-- 681
            H+ +DI N  +  +++ SQW+ +LKI E       I   +Y G L  E R      FN  
Sbjct: 1204 HIKEDIKN--ELHVVVFSQWIGFLKIIEKLLTLHEIPNKIYDGSLTYEQRKSTLYWFNIQ 1261

Query: 682  -------------NAAD-----TQHRILLLSIKCGGVGLNL 750
                         +  D        ++LL S+K GGVGLNL
Sbjct: 1262 KGKIYQPGIGFCQSTCDIPIENESGKVLLCSLKAGGVGLNL 1302


>UniRef50_Q6BKC2 Cluster: Helicase SWR1; n=2; Saccharomycetaceae|Rep:
            Helicase SWR1 - Debaryomyces hansenii (Yeast)
            (Torulaspora hansenii)
          Length = 1616

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/93 (30%), Positives = 48/93 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q  A L+ D L  +  + ++ +Q  + L I E F        +   G  K+EDR L  
Sbjct: 1333 KLQKLATLLQD-LTANGHRALIFTQMTKVLDILEQFLNIHGYRYMRLDGATKIEDRQLLT 1391

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D++  + +LS + GG+G+NL G +T+
Sbjct: 1392 EKFNR--DSKIPVFILSTRSGGLGINLTGADTV 1422


>UniRef50_Q185W7 Cluster: Putative helicase; n=3; Clostridium
            difficile|Rep: Putative helicase - Clostridium difficile
            (strain 630)
          Length = 1062

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/92 (22%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINFLQ-CRPFNDPRVWKMLNKNNDSTNRIKSIIKK 179
            ++ A N++ +TGTP+ N   +++S+ +F+     ++  +  ++     D+   +K +IK 
Sbjct: 749  SINAENKFALTGTPMENNLLELWSIFDFIMPGYLYSKAKFQELFINKEDNVKNLKKLIKP 808

Query: 180  IVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             +L+R K ++   +P    +   V L K++K+
Sbjct: 809  FILRRSKKQVMKELPDKIEKNFFVELNKEQKK 840



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/87 (29%), Positives = 45/87 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            +++T   ++ D +N  + KI+L SQ+   LK       +  I      G+   ++R+   
Sbjct: 892  KIETCLEILRDSIN-ENHKILLFSQFTSVLKNISKELDKYKIKYHYIDGKTNAKERLELV 950

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNL 750
              FNN+ D   ++ L+S+K GG GLNL
Sbjct: 951  DEFNNSMDK--KVFLISLKAGGTGLNL 975


>UniRef50_Q25A47 Cluster: H0323C08.5 protein; n=4; Oryza sativa|Rep:
           H0323C08.5 protein - Oryza sativa (Rice)
          Length = 1051

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 27/100 (27%), Positives = 55/100 (55%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNK---NNDST---NRIKS 167
           L A  RWC++GTPI N   D+YS   FL+  P++    ++ + K   + D+T    ++++
Sbjct: 590 LRAKRRWCLSGTPIQNTIDDLYSYFRFLKYEPYSVYGSFRSMIKYQISRDATRGYKKLQA 649

Query: 168 IIKKIVLKRDK-----SEISFNIPKHTVEYVHVNLMKKKK 272
           ++K ++L+R K      E    +P  T++   ++  K+++
Sbjct: 650 VLKIVLLRRTKETLIDGEPIIKLPPKTIQLSKIDFSKEER 689



 Score = 39.5 bits (88), Expect = 0.094
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQW   L + E       I      G + +  R  A   FN   D + R++L+S+
Sbjct: 898  KAIVFSQWTGLLDLLELSLDSSRIKFRRLDGAMSLNLREAAVREFN--TDPEVRVMLMSL 955

Query: 724  KCGGVGLNLI 753
            K G +GLN++
Sbjct: 956  KAGNLGLNMV 965


>UniRef50_A3A7J0 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1006

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFND 110
           ALTA  RWC+TGTPI N   D+YS+  FL+  P+ +
Sbjct: 622 ALTADRRWCLTGTPIQNNLEDIYSLFRFLRVEPWRN 657


>UniRef50_Q7RKF2 Cluster: DNA repair protein-like-related; n=1;
            Plasmodium yoelii yoelii|Rep: DNA repair
            protein-like-related - Plasmodium yoelii yoelii
          Length = 1412

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 10/96 (10%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-------LNKNNDSTNRIK 164
            L    +WC+TGTPI N  +D++ ++ FL  +P+ +   W          NK N + + ++
Sbjct: 887  LRGERKWCLTGTPIQNSLYDIFPLLRFLGIKPYGNIEWWSKEIADYVNRNKLNIALDIVR 946

Query: 165  SIIKKIVLKR---DKSEISFNIPKHTVEYVHVNLMK 263
             I   I+L+R    K+   +NI     + VHV  +K
Sbjct: 947  KISSPILLRRTKNSKTREGYNIITLPKKNVHVLKLK 982



 Score = 37.1 bits (82), Expect = 0.50
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 20/101 (19%)
 Frame = +1

Query: 508  HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN-- 681
            H+ +DI N  +  +++ SQW+ +LKI E       I   +Y G L  E R      FN  
Sbjct: 1219 HIKEDIKN--ELHVVVFSQWIGFLKIIEKLLTLHEIPNKIYDGSLTFEQRKNTLYWFNIQ 1276

Query: 682  -------------NAAD-----TQHRILLLSIKCGGVGLNL 750
                         +  D        ++LL S+K GGVGLNL
Sbjct: 1277 KGKIYQPGIGFCQSTCDIPIENKSGKVLLCSLKAGGVGLNL 1317


>UniRef50_Q4N399 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 845

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIA-TLMYTGQLKVEDRILA 666
           +VQ    ++ +I+  ++ K+++ SQ+  YL I ++  + + I   L   G + + DR   
Sbjct: 697 KVQKMLEILSNIMERNE-KVLIFSQFTNYLDIIQHVLRLREITPVLRLDGTVSLTDRDTI 755

Query: 667 ETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             TFN  A +   ILL+S+K G VGLNL   N +
Sbjct: 756 INTFNTDAVS---ILLISVKVGNVGLNLSVANNV 786


>UniRef50_Q6BHG7 Cluster: Similar to sp|Q10332 Schizosaccharomyces
           pombe YBMA_SCHPO Probable helicase; n=1; Debaryomyces
           hansenii|Rep: Similar to sp|Q10332 Schizosaccharomyces
           pombe YBMA_SCHPO Probable helicase - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 834

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           +++ ++   D K I+ SQ+    K+  +    K    L Y G + ++ R  A  +  N  
Sbjct: 660 VLEILMTNRDRKTIIFSQFPSLFKVLGDTLSTKGFKILTYDGSMDIKARNFALNSLKN-- 717

Query: 691 DTQHRILLLSIKCGGVGLNL 750
           D    +LL S+KCG VGLNL
Sbjct: 718 DPDMNVLLCSLKCGSVGLNL 737



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
           L A  RWC+TGTP+ N   ++ S+  F++   + D ++W
Sbjct: 403 LDADRRWCLTGTPLQNNLGELQSLFKFIRVSKYADDKIW 441


>UniRef50_Q4P3Z7 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1106

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/91 (30%), Positives = 46/91 (50%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q    L+ +I     D+I++ SQ+   L I     +   +  + +TG  +V+DR +  
Sbjct: 918  KIQALQRLIPEI-QAKGDRILIFSQFTMVLDILCVCLQHMGVKYVGFTGSTQVQDRQVLV 976

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
              F N  D    + LLS K GG+G+NLI  N
Sbjct: 977  DQFTN--DASITVFLLSTKAGGLGINLIAAN 1005


>UniRef50_A6R6D0 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 1162

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 15/104 (14%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN-----DPRVWKMLNKNNDSTN----- 155
           L +T RWC+TGTP+ N   ++YS+I FL+  P+N     +      L +N+   N     
Sbjct: 680 LKSTYRWCMTGTPMMNNVSELYSLIKFLRIGPYNVLEKFNSTFTNQLQRNDIPPNYPPMQ 739

Query: 156 RIKSIIKKIVLKRDKS-----EISFNIPKHTVEYVHVNLMKKKK 272
           + ++++K I+L+R KS     ++  ++P  T E  +    + +K
Sbjct: 740 QFQALLKAILLRRTKSSKIDGKMILHLPPRTTEKTYAVFSEDEK 783



 Score = 43.2 bits (97), Expect = 0.008
 Identities = 21/58 (36%), Positives = 38/58 (65%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+E+EK+LY+ L+ +++  + + +     E T+ R     ++L L+L+LRQ CCHP+L
Sbjct: 778 FSEDEKSLYEGLESKTQIRFNRYL----DEGTIGR--NYSNILVLLLRLRQACCHPHL 829


>UniRef50_Q09772 Cluster: Meiotic recombination protein rdh54; n=1;
           Schizosaccharomyces pombe|Rep: Meiotic recombination
           protein rdh54 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 811

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/75 (34%), Positives = 38/75 (50%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++VSQ+ E L++ E F    ++      G     +R L    FN ++  +  +LLLS 
Sbjct: 550 KAVIVSQYKETLELIELFLSILHVRFCKLLGSTPFSERDLIVHNFNTSSFKEFSVLLLSS 609

Query: 724 KCGGVGLNLIGGNTL 768
           K GG GLNL G   L
Sbjct: 610 KAGGCGLNLTGSTRL 624


>UniRef50_O22731 Cluster: F11P17.13 protein; n=2; Arabidopsis
            thaliana|Rep: F11P17.13 protein - Arabidopsis thaliana
            (Mouse-ear cress)
          Length = 1272

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIK------S 167
            L A  RWC++GTPI N   D+YS   FL+  P++   ++    KN  + N +K      +
Sbjct: 819  LRAKRRWCLSGTPIQNSIDDLYSYFRFLKYDPYSSYVLFCSTIKNPITRNPVKGYQKLQA 878

Query: 168  IIKKIVLKRDKSEI 209
            I+K ++L+R K  +
Sbjct: 879  ILKTVMLRRTKGSL 892



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 24/94 (25%), Positives = 43/94 (45%)
 Frame = +1

Query: 472  NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVE 651
            +GL    V+     VD  +  + +K I+ SQW + L + E      +I      G + V 
Sbjct: 1108 SGLSITPVKNEGMSVDVPIKVAGEKAIVFSQWTKMLNLLEASLVSSHIQYRRLDGTMSVA 1167

Query: 652  DRILAETTFNNAADTQHRILLLSIKCGGVGLNLI 753
             R  A   FN   +    ++++S+K   +GLN++
Sbjct: 1168 ARDKAVQDFNTLPEV--TVMIMSLKAASLGLNMV 1199



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +2

Query: 254  FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
            F  EE+  Y KL+ ES   +      RE     +  Q   ++L ++L+LRQ C HP L
Sbjct: 913  FTVEERDFYSKLEAESRTQF------REYAEAGTVKQNYVNILLMLLRLRQACDHPLL 964


>UniRef50_Q4Q417 Cluster: Transcription activator; n=7;
           Trypanosomatidae|Rep: Transcription activator -
           Leishmania major
          Length = 1103

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 6/96 (6%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR---VWKMLNKNNDSTN---RIK 164
           +L  ++R  ITGTP+ N   +++++++FL  R FND      W          N    + 
Sbjct: 315 SLQTSHRLIITGTPLQNNLKELWALLHFLAPRLFNDSESFDTWFDTTSGQQDANVMSNLH 374

Query: 165 SIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            I+  ++++R K+++S  IP     YV   L KK++
Sbjct: 375 KILAPLMIRRLKADVSTGIPPKKEIYVSCQLSKKQR 410



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 21/73 (28%), Positives = 36/73 (49%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K+++ SQ+   L I E++   +        G     DR     +FN+ + + + I LLS 
Sbjct: 492 KVLIFSQFTSMLNILEDYCNMRGFMYCRIDGNTSGYDRDSQMASFNSPS-SDYFIFLLST 550

Query: 724 KCGGVGLNLIGGN 762
           + GG+G+NL   N
Sbjct: 551 RAGGLGINLQAAN 563


>UniRef50_Q22KF3 Cluster: SNF2 family N-terminal domain containing
           protein; n=1; Tetrahymena thermophila SB210|Rep: SNF2
           family N-terminal domain containing protein -
           Tetrahymena thermophila SB210
          Length = 1285

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 4/70 (5%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---MLNKNNDSTNR-IKSII 173
           L +  RWC+TGTP+ NK  D++    FL+     + R W      ++N + T + IK+++
Sbjct: 651 LNSKFRWCLTGTPLQNKIEDLFGYFRFLKVPQIGEWRWWSDYISKSRNKEKTYQFIKAVL 710

Query: 174 KKIVLKRDKS 203
           K ++L+R K+
Sbjct: 711 KGMMLRRTKT 720


>UniRef50_A7RK66 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1552

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++  Q    + I E++F  K    L   G  K EDR    + FN A D+ + 
Sbjct: 984  LKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFN-AKDSPYF 1042

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+GLNL   +T+
Sbjct: 1043 VFLLSTRAGGLGLNLQAADTV 1063


>UniRef50_Q2TX77 Cluster: Helicase-like transcription factor
           HLTF/DNA helicase RAD5; n=1; Aspergillus oryzae|Rep:
           Helicase-like transcription factor HLTF/DNA helicase
           RAD5 - Aspergillus oryzae
          Length = 966

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 15/105 (14%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRP----------FNDPRVWKMLNKNNDST 152
           AL AT RWC++GTP+ N   ++YS++ FL+ +P          F  P   +   +   +T
Sbjct: 429 ALDATYRWCLSGTPVMNNLRELYSLLKFLRVQPYASRQSFATAFQQPLQTRGSPQRAAAT 488

Query: 153 NRIKSIIKKIVLKRDKS-----EISFNIPKHTVEYVHVNLMKKKK 272
            R++ ++  I+L+R K+     +    +P  T E V+V   + ++
Sbjct: 489 ARLRRLMDTIMLRRTKTSTIQGQPILQLPVQTTEIVYVTFTEPER 533



 Score = 39.5 bits (88), Expect = 0.094
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            +K+++ SQ+   L + E    +   A   Y G +K  DR  A   F  A D    ILL+S
Sbjct: 812  EKVVIFSQFTSMLDLIEVPLARHGWAFRRYDGTMKPADRHAATVHF--ATDPDCLILLVS 869

Query: 721  IKCGGVGLNL 750
            +K G  GLNL
Sbjct: 870  MKAGNSGLNL 879



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F E E+ LY  L+C +   +   ++       +S      H+L L+ +LRQ CCHP+L
Sbjct: 528 FTEPERELYTALECHTRLQFNHYLSGGNPSRNVS------HMLGLLQRLRQACCHPFL 579


>UniRef50_A2QAZ0 Cluster: Complex: human Rad54B; n=11;
           Eurotiomycetidae|Rep: Complex: human Rad54B -
           Aspergillus niger
          Length = 1007

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 27/86 (31%), Positives = 38/86 (44%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L+D +   + +KI+LVS +   L +  N     ++  L   G    + R      FN   
Sbjct: 640 LLDGLRTKTSEKIVLVSNYTSTLNLLANLLTSLSLPFLRLDGSTPAQKRQSLVEDFNRLP 699

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
                  LLS K GG GLNLIG + L
Sbjct: 700 SNLCFAFLLSAKAGGTGLNLIGASRL 725


>UniRef50_P32597 Cluster: Nuclear protein STH1/NPS1; n=6;
            Saccharomycetales|Rep: Nuclear protein STH1/NPS1 -
            Saccharomyces cerevisiae (Baker's yeast)
          Length = 1359

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 3/89 (3%)
 Frame = +1

Query: 511  LVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
            L+D +L     S  ++++  Q  + + I E+F + K++  +   G  K E+R      F 
Sbjct: 795  LLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAF- 853

Query: 682  NAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            NA D+ +   LLS + GG+GLNL   +T+
Sbjct: 854  NAPDSDYFCFLLSTRAGGLGLNLQTADTV 882


>UniRef50_Q5KPG8 Cluster: DNA repair protein RAD5; n=2;
           Filobasidiella neoformans|Rep: DNA repair protein RAD5 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 1198

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 22/72 (30%), Positives = 45/72 (62%), Gaps = 6/72 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLNKNNDSTNRIKS 167
           L    RW +TGTPI N+  D+YS+++FL+  P+ +   ++       LN+++ + N ++ 
Sbjct: 707 LKGQRRWALTGTPIVNRLEDLYSLLHFLRITPWGNYSFFRSFVTVPFLNQDHKALNVVQY 766

Query: 168 IIKKIVLKRDKS 203
           I++  +L+R+K+
Sbjct: 767 ILESCLLRREKT 778



 Score = 39.5 bits (88), Expect = 0.094
 Identities = 23/73 (31%), Positives = 36/73 (49%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K ++ SQ+  +L + E    ++ I  L + G +    R      F    + +  ILL+S+
Sbjct: 1037 KALVFSQFTSFLDLIEATLTKQGIRWLRFDGTMSQAQRANTIEEFGRKTN-EPLILLISL 1095

Query: 724  KCGGVGLNLIGGN 762
            K GGVGLNL   N
Sbjct: 1096 KAGGVGLNLTMAN 1108


>UniRef50_Q1FET3 Cluster: SNF2-related:Helicase-like:Zinc finger,
            SWIM-type; n=1; Clostridium phytofermentans ISDg|Rep:
            SNF2-related:Helicase-like:Zinc finger, SWIM-type -
            Clostridium phytofermentans ISDg
          Length = 1069

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 27/86 (31%), Positives = 47/86 (54%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            L+++ L  +D +I++ SQ+   LKI E   K+ +++     G   + +R      FN   
Sbjct: 910  LIEEAL-ANDHRILIFSQFTSMLKIMEAELKKLSVSYFYLEGSTPITERNDFVKRFNAGE 968

Query: 691  DTQHRILLLSIKCGGVGLNLIGGNTL 768
             +   I L+S+K GG GLNL+G +T+
Sbjct: 969  GS---IFLISLKAGGTGLNLVGADTV 991



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 23/100 (23%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINF------LQCRPFNDPRVWKMLNKNNDSTNRIKS 167
            L +T+R+ +TGTPI N   +++S+ +F      L    F +    ++L ++ ++   +  
Sbjct: 752  LDSTHRFALTGTPIENSLSELWSIFDFIMPGYLLTHSKFVNKFEKQILKEDTEALENLNR 811

Query: 168  IIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKRCTIS 287
             I   VL+R K ++  ++P    E +   + +++K+  +S
Sbjct: 812  RIHPFVLRRMKKDVLNDLPDKLEEKIVTEMTEEQKKVYVS 851


>UniRef50_Q9XFH4 Cluster: SWI2/SNF2-like protein; n=16;
           Viridiplantae|Rep: SWI2/SNF2-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 764

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/80 (28%), Positives = 43/80 (53%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  ++ K+++ SQW + L I + +F +K        G +K+++R      F++   +   
Sbjct: 536 LFANNHKVLIFSQWTKLLDIMDYYFSEKGFEVCRIDGSVKLDERRRQIKDFSDEKSSCS- 594

Query: 706 ILLLSIKCGGVGLNLIGGNT 765
           I LLS + GG+G+NL   +T
Sbjct: 595 IFLLSTRAGGLGINLTAADT 614


>UniRef50_O23055 Cluster: YUP8H12.27 protein; n=2; cellular
           organisms|Rep: YUP8H12.27 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 822

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 18/35 (51%), Positives = 27/35 (77%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN 107
           AL AT RW ++GTP+ N+  ++YS+I FLQ RP++
Sbjct: 378 ALEATYRWALSGTPLQNRVGELYSLIRFLQIRPYS 412



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 20/69 (28%), Positives = 33/69 (47%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K I+ SQ+  +L +      +  ++ +   G + +  R  A   F    D   R+ L+S+
Sbjct: 748 KAIVFSQFTSFLDLINYTLGKCGVSCVQLVGSMTMAARDTAINKFKEDPDC--RVFLMSL 805

Query: 724 KCGGVGLNL 750
           K GGV LNL
Sbjct: 806 KAGGVALNL 814


>UniRef50_Q7SHJ1 Cluster: Putative uncharacterized protein
           NCU02913.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU02913.1 - Neurospora crassa
          Length = 846

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR--------VWKMLNKNNDSTNR 158
           +L   +RW +TGTPI NK  D+ +++ FL+  P++D R        +WK   + N++  R
Sbjct: 454 SLDGDSRWAVTGTPIQNKLSDLATLLKFLRIYPYSDKRCFDADFTNLWKN-GQANEALKR 512

Query: 159 IKSIIKKIVLKRDKSEI 209
           +K +   ++L+R  + I
Sbjct: 513 LKRLAGCLILRRPSTTI 529


>UniRef50_Q6C4R0 Cluster: Similar to KLLA0F11814g Kluyveromyces
           lactis; n=1; Yarrowia lipolytica|Rep: Similar to
           KLLA0F11814g Kluyveromyces lactis - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 940

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 22/76 (28%), Positives = 40/76 (52%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K+++VS + + L + E   K   ++     G ++   R      FN+++     + LLS
Sbjct: 666 EKVVIVSSFTQTLDVIEGLVKDLKLSFTRLDGSVQASARAKIVKQFNSSSADSCFVFLLS 725

Query: 721 IKCGGVGLNLIGGNTL 768
            + GGVG+NLIG + L
Sbjct: 726 ARAGGVGINLIGASRL 741


>UniRef50_Q2TWR6 Cluster: Helicase-like transcription factor
           HLTF/DNA helicase RAD5; n=1; Aspergillus oryzae|Rep:
           Helicase-like transcription factor HLTF/DNA helicase
           RAD5 - Aspergillus oryzae
          Length = 619

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQC-RPFNDPRVWKMLNKNNDSTNRIKSIIKK 179
           ALT   +W ++GTP+HN   + Y + +FL   R       WK+  K+N++   + ++++ 
Sbjct: 110 ALTGHYKWVLSGTPVHNCVEEFYPLFDFLGVPRTGTYENFWKLYCKDNEANKCLVNLLRS 169

Query: 180 IVLKRDKSEISFNIP 224
            + +R  S   F++P
Sbjct: 170 FMFRRTHSSRLFSLP 184


>UniRef50_A5DUS7 Cluster: SNF2-family ATP dependent chromatin
            remodeling factor snf21; n=2; Saccharomycetaceae|Rep:
            SNF2-family ATP dependent chromatin remodeling factor
            snf21 - Lodderomyces elongisporus (Yeast) (Saccharomyces
            elongisporus)
          Length = 1926

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 24/75 (32%), Positives = 42/75 (56%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++  Q  + + I E+F + +N+  +   G  K +DR      FN A D+++   LLS 
Sbjct: 1265 KVLIFFQMTQIMDIMEDFLRLRNLKYMRLDGGTKADDRTELLKLFN-APDSEYFCFLLST 1323

Query: 724  KCGGVGLNLIGGNTL 768
            + GG+GLNL   +T+
Sbjct: 1324 RAGGLGLNLQTADTV 1338


>UniRef50_Q753V5 Cluster: DNA repair protein RAD5; n=1; Eremothecium
            gossypii|Rep: DNA repair protein RAD5 - Ashbya gossypii
            (Yeast) (Eremothecium gossypii)
          Length = 1085

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 4/85 (4%)
 Frame = +1

Query: 508  HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLM----YTGQLKVEDRILAETT 675
            HL D    ++++++++ SQ+  YL I EN  +Q   + +     + G+L +++R      
Sbjct: 921  HLQD---TSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERSNVLAK 977

Query: 676  FNNAADTQHRILLLSIKCGGVGLNL 750
            F   +  + ++LLLS+K GGVGLNL
Sbjct: 978  FTEKSLVKMKVLLLSLKAGGVGLNL 1002



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 7/74 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN-------NDSTNRI 161
           ALT+  +W +TGTPI N+  D++S+I F+   P+     W+    +       + +   I
Sbjct: 621 ALTSRRKWVLTGTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPFEKKDYSSALEVI 680

Query: 162 KSIIKKIVLKRDKS 203
           ++++  I+L+R K+
Sbjct: 681 QAVMGPILLRRTKN 694


>UniRef50_Q1VZW1 Cluster: DEAD/DEAH box helicase-like protein; n=1;
            Psychroflexus torquis ATCC 700755|Rep: DEAD/DEAH box
            helicase-like protein - Psychroflexus torquis ATCC 700755
          Length = 1216

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 7/97 (7%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-------LNKNNDSTNRIK 164
            L   NR  +TGTPI N  +D+YS  NFL    F   + ++          ++ D++  + 
Sbjct: 898  LNCENRLALTGTPIENNTFDLYSQFNFLNPGIFGSIKHFRTNFSDAIDKEQDEDTSALLA 957

Query: 165  SIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             II   +L+R K +++  +P  T   ++  + K +++
Sbjct: 958  KIIHPFLLRRTKPQVATELPSKTEAIIYCEMNKPQRK 994



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++ SQ+V  L++ +    +++I      GQ K  +  +    F N  + + R+ L+S+
Sbjct: 1068 KVLVFSQFVGMLQLVKERLDEEDIKFEYLDGQTKKREEKV--NNFQN--NPKVRVFLISL 1123

Query: 724  KCGGVGLNL 750
            K GG GLNL
Sbjct: 1124 KAGGTGLNL 1132


>UniRef50_Q0D6A4 Cluster: Os07g0497000 protein; n=4; Oryza
           sativa|Rep: Os07g0497000 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 622

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 5/89 (5%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST-----NRIKSI 170
           L+  +R  +TGTP+ N   +MY+++NFLQ  P + P +     K ND T       +K++
Sbjct: 134 LSFQHRVLLTGTPLQNNIGEMYNLLNFLQ--PASFPSLASFEEKFNDLTTTEKVEELKNL 191

Query: 171 IKKIVLKRDKSEISFNIPKHTVEYVHVNL 257
           +   +L+R K +   NIP  T   V V L
Sbjct: 192 VAPHMLRRLKKDAMQNIPPKTERMVPVEL 220



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 9/106 (8%)
 Frame = +1

Query: 478 LYEQQVQTSA-----HLVDDILNTSDDKIILVSQWVEYLKIFENF----FKQKNIATLMY 630
           L+E +++ SA     H +  IL+    ++++ SQ  + L I E++    F  K    +  
Sbjct: 281 LHEMRIKASAKLTLLHSMLKILHKDGHRVLIFSQMTKLLDILEDYLTWEFGPKTFERV-- 338

Query: 631 TGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G + V +R  A   FN   D    + LLS +  G+G+NL   +T+
Sbjct: 339 DGSVSVAERQAAIARFNQ--DKSRFVFLLSTRSCGLGINLATADTV 382


>UniRef50_A7P2P8 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 836

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 5/85 (5%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST-----NRIKSIIKKI 182
           +R  +TGTP+ N   +MY+++NFLQ  P   P ++    K ND T       +K ++   
Sbjct: 450 HRVLLTGTPLQNNIGEMYNLLNFLQ--PATFPSLFSFEEKFNDLTTAEKVEELKKLVAPH 507

Query: 183 VLKRDKSEISFNIPKHTVEYVHVNL 257
           +L+R K +   NIP  T   V V L
Sbjct: 508 MLRRLKKDAMQNIPPKTERMVPVEL 532



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +1

Query: 478 LYEQQVQTSA-----HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQK-NIATL-MYTG 636
           L+E +++ SA     H +  +L     ++++ SQ  + L I E++   +    T     G
Sbjct: 584 LHEMRIKASAKLTLLHSMLKVLYKEGHRVLIFSQMTKLLDILEDYLTTEFGPRTFERVDG 643

Query: 637 QLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            + V DR  A   FN   D    + LLS +  G+G+NL   +T+
Sbjct: 644 SVSVADRQAAIARFNQ--DKTRFVFLLSTRSCGLGINLATADTV 685


>UniRef50_Q7RQC0 Cluster: DOMINO B-related; n=5; Plasmodium
            (Vinckeia)|Rep: DOMINO B-related - Plasmodium yoelii
            yoelii
          Length = 1732

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            +K +L +Q+++ L I E F    N + +   G  KVE R    T FNN  D  + I + S
Sbjct: 1422 NKCLLFTQFIKMLDILEIFLNHLNYSFIRLDGSTKVEQRQKIVTKFNN--DKSYFIFISS 1479

Query: 721  IKCGGVGLNLIGGNTL 768
             + G +G+NL   N +
Sbjct: 1480 TRSGSIGINLTAANVV 1495


>UniRef50_Q228K2 Cluster: SNF2 family N-terminal domain containing
            protein; n=1; Tetrahymena thermophila SB210|Rep: SNF2
            family N-terminal domain containing protein - Tetrahymena
            thermophila SB210
          Length = 1811

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 26/81 (32%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    DK+++ +Q    L IFEN     N   +   G  K+E+R      FN   D++  
Sbjct: 1305 LKQRGDKVLIFTQMSRMLDIFENVLNLFNFTYVRLDGSTKIENRQKVVERFN--GDSRIF 1362

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              + S + GG+GLNL G N +
Sbjct: 1363 CFISSTRSGGIGLNLTGANVV 1383



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 13/99 (13%)
 Frame = +3

Query: 18   NRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPRVW------KMLNKN----NDSTNR 158
            +R  +TGTP+ N   +++S+++FL  R F   +D   W      + L KN     +   +
Sbjct: 932  HRLLLTGTPLQNDVGELWSLLHFLMPRIFDSHSDFMEWFSIPMQQALQKNLPISQEILKK 991

Query: 159  IKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            + SI++  +L+R K ++   +P  T EY+    + +++R
Sbjct: 992  LHSILRPFLLRRLKKDVEKQLPTKT-EYIIKCPLSRRQR 1029


>UniRef50_Q6FK14 Cluster: Similar to sp|P38086 Saccharomyces
           cerevisiae YBR073w RDH54; n=2; Saccharomycetales|Rep:
           Similar to sp|P38086 Saccharomyces cerevisiae YBR073w
           RDH54 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 920

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 25/76 (32%), Positives = 38/76 (50%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +K+++VS + + L I +       ++     G    + R +   TFNN  +      LLS
Sbjct: 650 EKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNNNPNIFG--FLLS 707

Query: 721 IKCGGVGLNLIGGNTL 768
            K GGVGLNLIG + L
Sbjct: 708 AKAGGVGLNLIGASRL 723


>UniRef50_A2R3B8 Cluster: Function: RAD5 of S. cerevisiae has
            single-stranded DNA-dependent ATPase activity; n=1;
            Aspergillus niger|Rep: Function: RAD5 of S. cerevisiae
            has single-stranded DNA-dependent ATPase activity -
            Aspergillus niger
          Length = 1189

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 24/84 (28%), Positives = 49/84 (58%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            L + +   S  KI++ +Q++++++I     + +N   ++ TG+L +  R    T F++  
Sbjct: 987  LTEWLAQDSPGKIVIFTQFLDFVQILATMCQAENWPYVLLTGKLSLAVRENNMTLFSD-K 1045

Query: 691  DTQHRILLLSIKCGGVGLNLIGGN 762
            D++ RI++ S+K GG GL+L   N
Sbjct: 1046 DSEKRIMIASLKAGGTGLDLSAAN 1069



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP 113
           +LT   +W ++GTP+HN   + Y + +FL      DP
Sbjct: 649 SLTGHFKWILSGTPVHNYLEEFYPLFDFLGVPGIRDP 685


>UniRef50_O13682 Cluster: Helicase swr1; n=1; Schizosaccharomyces
            pombe|Rep: Helicase swr1 - Schizosaccharomyces pombe
            (Fission yeast)
          Length = 1288

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 26/93 (27%), Positives = 48/93 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q    L+ D+++    ++++ +Q  + L I E F        L   G  K+E R +  
Sbjct: 992  KLQVLDRLLKDLVSNGH-RVLIFTQMTKVLDILEQFLNIHGHRYLRLDGATKIEQRQILT 1050

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FNN  D +  + +LS + GG+G+NL G +T+
Sbjct: 1051 ERFNN--DDKIPVFILSTRSGGLGINLTGADTV 1081


>UniRef50_UPI000023F6B4 Cluster: hypothetical protein FG10568.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10568.1 - Gibberella zeae PH-1
          Length = 786

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 7/92 (7%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-----LNKNN--DSTNRI 161
           +L    RWC++GTPI N   D+ S++ F +  PF++  V++      L   N   STN +
Sbjct: 424 SLATERRWCLSGTPIQNCINDLVSLLRFFKFEPFSNMDVFRQYILEPLRTENVLGSTNPL 483

Query: 162 KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNL 257
           + +++ + L+R  +E   N+P    E + ++L
Sbjct: 484 QMLLQSVCLRR--TEKYLNLPAAHYELITLSL 513



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +1

Query: 535 SDDKIILV-SQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           S D++ LV S W   L + +   + + I      G L   +R+     F N  D    +L
Sbjct: 656 STDRVSLVFSYWTTTLNLLQTMLEDRGIVLRRIDGSLGNGERLRVLNEFKN--DPAISVL 713

Query: 712 LLSIKCGGVGLNL 750
           L++++ G VGL L
Sbjct: 714 LITMQTGAVGLTL 726


>UniRef50_Q2S6W0 Cluster: Superfamily II DNA/RNA helicase, SNF2
            family; n=1; Hahella chejuensis KCTC 2396|Rep:
            Superfamily II DNA/RNA helicase, SNF2 family - Hahella
            chejuensis (strain KCTC 2396)
          Length = 1106

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 7/97 (7%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML-----NKNNDSTNR--IK 164
            L A +R C+TGTP+ N   +++S+ NFL      D R +K L      K  D   +  + 
Sbjct: 785  LEARHRLCLTGTPMENHLGELWSLFNFLTPGLLGDDRKFKTLFRTPIEKQGDLERQRLLS 844

Query: 165  SIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
              IK  +L+R K E++  +P+ T E     L++ K+R
Sbjct: 845  RRIKPFMLRRTKQEVATELPEKT-EIQRTVLLEGKQR 880



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            KI+L SQ+   L + E    +  I  +  TG  K  DR   +T  N   + +  + L+S+
Sbjct: 957  KILLFSQFTSMLGLIEAQLDKAGIEYVKLTGATK--DR---DTPVNRFQNGEVSLFLISL 1011

Query: 724  KCGGVGLNLIGGNTL 768
            K GGVGLNL   +T+
Sbjct: 1012 KAGGVGLNLTAADTV 1026


>UniRef50_A7FUH3 Cluster: Helicase, SNF2/RAD54 family; n=4;
            Clostridium botulinum|Rep: Helicase, SNF2/RAD54 family -
            Clostridium botulinum (strain ATCC 19397 / Type A)
          Length = 1077

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 3/80 (3%)
 Frame = +1

Query: 520  DILNTSDD---KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            DI+N+S +   KI+L SQ+   LK     FK  NI  L   G  K + R      FNN  
Sbjct: 913  DIVNSSINAGHKILLFSQFTSVLKNIAEVFKANNINYLYLDGSTKADVRGSLVKDFNNGK 972

Query: 691  DTQHRILLLSIKCGGVGLNL 750
                 I L+S+K GG GLNL
Sbjct: 973  GD---IFLISLKAGGTGLNL 989



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 23/98 (23%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = +3

Query: 3    ALTATNRWCITGTPIHNKHWDMYSMINF------LQCRPFNDPRVWKML-NKNNDSTNRI 161
            ++ A N + +TGTP+ N   +++S+ +F      L  R F       ++ +KN ++   +
Sbjct: 754  SIKANNYFALTGTPVENSLTELWSIFDFIMPGYLLNYRRFYAKYESPIVKDKNEEALKEL 813

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             + IK  +L+R K  +   +P      + VN+ +++K+
Sbjct: 814  NNHIKPFILRRLKKHVIKELPPKIEHNIVVNMTEEQKK 851


>UniRef50_Q9LUS4 Cluster: Similarity to transcription factors; n=2;
           Arabidopsis thaliana|Rep: Similarity to transcription
           factors - Arabidopsis thaliana (Mouse-ear cress)
          Length = 653

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 6/77 (7%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN-----DPRVWKMLNKNN-DSTNRIK 164
           +L A  RWC+TGTPI NK  D+YS   FL+  P+        R+   ++K       +++
Sbjct: 237 SLRAKRRWCLTGTPIKNKVDDLYSYFRFLRYHPYAMCNSFHQRIKAPIDKKPLHGYKKLQ 296

Query: 165 SIIKKIVLKRDKSEISF 215
           +I++ I+L+R K E SF
Sbjct: 297 AILRGIMLRRTK-EWSF 312


>UniRef50_Q7XJP0 Cluster: SNF2/SWI2 family global transcription
           factor; n=1; Arabidopsis thaliana|Rep: SNF2/SWI2 family
           global transcription factor - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 1648

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
           L   +RWCITGTPI  K  D++ ++ FL+  PF+  R W
Sbjct: 609 LYTKHRWCITGTPIQRKLDDLFGLLKFLKANPFDVSRWW 647


>UniRef50_A4S6V0 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 1086

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 16/34 (47%), Positives = 26/34 (76%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF 104
           AL +T +WC+TGTP+ N+  D+YS++ FL+  P+
Sbjct: 607 ALKSTYKWCLTGTPLQNRIGDLYSLVRFLRMDPY 640



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 21/64 (32%), Positives = 30/64 (46%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAM 433
           FNE E+  Y+ L   +   +   V         S L    HV  L+ +LRQ C HPYL +
Sbjct: 739 FNEVEQDFYESLYMLTRSKFDAFVKKG------SVLHNYAHVFELLARLRQACDHPYLVI 792

Query: 434 HGRN 445
           H ++
Sbjct: 793 HSKS 796


>UniRef50_A4S2D2 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 688

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 41/76 (53%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +++++VS +   L   E+  K+ N+ T    G + V+ R      FN+    Q  ++LLS
Sbjct: 452 ERVVVVSGYSASLATAEDICKKLNVTTSRLDGTVAVDLRTSIVKNFNSGQGGQ--VMLLS 509

Query: 721 IKCGGVGLNLIGGNTL 768
           +  GG GLNL+G N L
Sbjct: 510 VVAGGAGLNLVGANRL 525


>UniRef50_Q4Q883 Cluster: DNA repair protein-like protein; n=3;
           Leishmania|Rep: DNA repair protein-like protein -
           Leishmania major
          Length = 922

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 24/87 (27%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = +1

Query: 508 HLVDDILNT-SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN 684
           +L+D I +  ++DK+++ S ++ YL+  +++ +   ++  +Y+G + ++ +      F++
Sbjct: 726 YLIDTIRSLPAEDKVVVFSSFLTYLRCAQHWLQAAGVSCALYSGSMTMKQKQSLLELFHD 785

Query: 685 AA-DTQHRILLLSIKCGGVGLNLIGGN 762
           AA     R+LL +I   GVGLNL   N
Sbjct: 786 AARPASPRVLLATISSCGVGLNLTCAN 812


>UniRef50_Q387H5 Cluster: DNA repair protein, putative; n=2;
           Trypanosoma|Rep: DNA repair protein, putative -
           Trypanosoma brucei
          Length = 984

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF 104
           AL   +RWC+TGTP+ N+  D+YS++ FL+  P+
Sbjct: 491 ALVGEHRWCLTGTPLQNRVGDVYSLVRFLRLAPY 524



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
            ++K+I+ SQ+ + L + + + ++  + T+   G L +  R      F +  D   R +L+
Sbjct: 831  EEKVIVFSQFGDTLDLIQLWLQKVKVKTVKLVGSLMLSQRQAVLRAFLH--DKSVRAILI 888

Query: 718  SIKCGGVGLNL 750
            S+K GG GLNL
Sbjct: 889  SLKAGGEGLNL 899


>UniRef50_Q7SI21 Cluster: Putative uncharacterized protein
           NCU00631.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU00631.1 - Neurospora crassa
          Length = 1097

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLK 191
           AT RWC+TGTP+ N   ++ S++ FLQ +PF D + +K    + D     + + K   +K
Sbjct: 566 ATYRWCLTGTPMMNSVSELSSLLRFLQIKPFCDEKKFKEAFASLDHKYTGRDVEKSTAMK 625

Query: 192 R 194
           +
Sbjct: 626 Q 626



 Score = 37.1 bits (82), Expect = 0.50
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+E E   Y  L+ +S+  Y + V      NT+ +     ++L L+L+LRQ CCHP+L
Sbjct: 664 FSEGELEFYKNLQEKSQVIYGRYVR----NNTVGK--NYSNILVLLLRLRQACCHPHL 715


>UniRef50_Q6C008 Cluster: Similar to DEHA0C17006g Debaryomyces
           hansenii; n=1; Yarrowia lipolytica|Rep: Similar to
           DEHA0C17006g Debaryomyces hansenii - Yarrowia lipolytica
           (Candida lipolytica)
          Length = 920

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
           I+  ++D++++ SQ+ + L I E+      IA L   GQ  VE R   +       +T  
Sbjct: 759 IMKENNDRVLIFSQFTQCLDILESVLNTLGIAFLRLDGQTPVEAR--QDMIDKYYEETDI 816

Query: 703 RILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG G+NL   NT+
Sbjct: 817 TVFLLSTKAGGFGINLACANTV 838


>UniRef50_Q6BY55 Cluster: Similar to CA2797|IPF8404 Candida albicans
           IPF8404 putative helicase; n=2; Saccharomycetaceae|Rep:
           Similar to CA2797|IPF8404 Candida albicans IPF8404
           putative helicase - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 771

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 24/86 (27%), Positives = 49/86 (56%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L+D++L   + K+++ SQ+ + L +  ++   +N+      G +   DR    T FN A 
Sbjct: 536 LLDELL-LKNHKVLIFSQFTKVLDLINDWLVYENVEICRLDGSMNQLDREEEITEFN-AK 593

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
           +++ ++ LLS + GG+G+NL   +T+
Sbjct: 594 NSKQQVFLLSTRAGGLGINLTASDTV 619


>UniRef50_Q0V1Y5 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 888

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 28/86 (32%), Positives = 38/86 (44%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           LV  I  T+++KI++VS +   L + E      +   L   G      R      FN   
Sbjct: 596 LVHRIHTTTEEKIVIVSNYTTTLDMIERMLVSLSYTYLRLDGSTPSNKRQALVEKFNKTP 655

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
                  LLS K GGVGLNLIG + +
Sbjct: 656 KAASFAFLLSAKSGGVGLNLIGASRI 681


>UniRef50_A7TFQ5 Cluster: Putative uncharacterized protein; n=1;
            Vanderwaltozyma polyspora DSM 70294|Rep: Putative
            uncharacterized protein - Vanderwaltozyma polyspora DSM
            70294
          Length = 1178

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 4/77 (5%)
 Frame = +1

Query: 532  TSDDKIILVSQWVEYLKIFENFFKQ----KNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
            ++ ++I++ SQ+  YL I E    +    K      + G+L +++R      F     T+
Sbjct: 1019 SAGEQIVIFSQFSSYLDILEQDLNEALSTKETIIYKFDGRLSLKERSTVLKEFTTKDLTK 1078

Query: 700  HRILLLSIKCGGVGLNL 750
             +ILLLS+K GGVGLNL
Sbjct: 1079 QKILLLSLKAGGVGLNL 1095



 Score = 42.3 bits (95), Expect = 0.013
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 7/72 (9%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKNNDST-NRIK 164
           L++  +W +TGTPI N+  D+YS++ FL   P++    WK         K+  S  + + 
Sbjct: 712 LSSKRKWILTGTPIINRLDDIYSLVKFLGLEPWSQIGYWKSFVSEPFEKKDFKSAFDVVN 771

Query: 165 SIIKKIVLKRDK 200
           SI+  ++L+R K
Sbjct: 772 SILSPVLLRRTK 783


>UniRef50_A6RXA5 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 1065

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 17/41 (41%), Positives = 29/41 (70%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK 125
           +L +  RWC+TGTP+ N   ++ S+I FL+ +P+++ R WK
Sbjct: 423 SLRSQYRWCLTGTPMQNNLDELQSLIKFLRIKPYDNLREWK 463



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/69 (37%), Positives = 36/69 (52%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQ+   L + E F +QK      Y G +K + R  +     N  D   R+LL S+
Sbjct: 845  KFIVFSQFTSMLDLVEPFLRQKGYKYTRYDGGMKNDLREASLDRLRN--DENCRVLLCSL 902

Query: 724  KCGGVGLNL 750
            KCG +GLNL
Sbjct: 903  KCGSLGLNL 911


>UniRef50_A6RHB7 Cluster: Predicted protein; n=1; Ajellomyces
            capsulatus NAm1|Rep: Predicted protein - Ajellomyces
            capsulatus NAm1
          Length = 1687

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +1

Query: 478  LYEQQVQTSAHLVDDILNTS---DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKV 648
            ++  ++   A + D I+  S    DK++L S  +  L   E   KQ   +     G+  +
Sbjct: 1241 MWSLELSHRAQVADQIIERSIAAGDKVLLFSHSIPTLNYLELVLKQAKRSYSRLDGKTPI 1300

Query: 649  EDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
              R +A   FN+  D+Q  + L+S + GG+GLN+ G N
Sbjct: 1301 ATRQIATKNFNSGFDSQ--VYLISTRAGGLGLNIPGAN 1336


>UniRef50_A5DYP3 Cluster: Helicase SWR1; n=2; Saccharomycetaceae|Rep:
            Helicase SWR1 - Lodderomyces elongisporus (Yeast)
            (Saccharomyces elongisporus)
          Length = 1764

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 27/93 (29%), Positives = 48/93 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q  A L+ D++  +  + ++ +Q  + L I E F        +   G  K+EDR L  
Sbjct: 1495 KLQKLATLMRDLV-ANGHRALIFTQMTKVLDILEQFLNIHGYRYMRLDGATKIEDRQLLT 1553

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +  + +LS + GG+G+NL G +T+
Sbjct: 1554 EKFNR--DPKIPVFILSTRSGGLGINLTGADTV 1584


>UniRef50_Q6BIP2 Cluster: DNA repair protein RAD5; n=1; Debaryomyces
           hansenii|Rep: DNA repair protein RAD5 - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 1153

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML-------NKNNDSTNRIKSIIKK 179
           +W +TGTP+ N+  D+YS++ FL+  P+++   WK          K + + + +KSI++ 
Sbjct: 702 KWVLTGTPVINRLDDLYSLVKFLELEPWSNFSYWKTFVTLPFEQRKISQTLDVVKSILEP 761

Query: 180 IVLKRDKS 203
           I ++R K+
Sbjct: 762 IFIRRTKN 769



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFKQK---NIATLMYTGQLKVEDRI-LAETTFNNAADTQHR 705
            ++++++ SQ+  YL I EN  K +   +     + G+L + +R  + E   +   + +  
Sbjct: 1031 NEQVVVFSQFSSYLDIIENELKIQILNDFVVYKFDGRLNMNERQKILENFSSQKHENKVM 1090

Query: 706  ILLLSIKCGGVGLNL 750
            ILLLS+K GGVGLNL
Sbjct: 1091 ILLLSLKAGGVGLNL 1105



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
           FNE E+ LY+  K  + +++   +   +S +   +  Q   +L  IL+LRQ+CCH
Sbjct: 793 FNEVEEKLYNWFKARASQSFKDGI---KSGDLFKKYSQ---ILTHILRLRQVCCH 841


>UniRef50_Q4RE24 Cluster: Chromosome 10 SCAF15143, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 10 SCAF15143, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 894

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K +++SQ+  +L I E   ++   + +   G    + R      F NAA     I+LLS+
Sbjct: 732 KCLVISQFTRFLTILETPLREHGFSFVRLDGSSNQKKRTEVIREFQNAAADSPTIMLLSL 791

Query: 724 KCGGVGLNL 750
           K GGVGLNL
Sbjct: 792 KAGGVGLNL 800



 Score = 41.5 bits (93), Expect = 0.023
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 6/72 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLNKNNDSTNRIKS 167
           LTA  RW ++GTPI N   D++ ++ FL+ +PF+    W       + + +      ++ 
Sbjct: 455 LTAQRRWILSGTPIQNSVKDLWMLLAFLRLKPFDVKDWWNRVIQRPVTHGDPAGLQNLQM 514

Query: 168 IIKKIVLKRDKS 203
           +IK   L+R KS
Sbjct: 515 LIKCTTLRRTKS 526



 Score = 33.1 bits (72), Expect = 8.2
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 8/64 (12%)
 Frame = +2

Query: 266 EKTL-YDKLKCESEEAYMKAVAARESENTLSR-------LQQMQHVLWLILKLRQICCHP 421
           +KT+  ++++    E     +A  E  NT+ R       L+    VL +++KLRQ+CCHP
Sbjct: 539 DKTVCVEQVELSQTEREEYELARTEGRNTIRRYVAEGNILRSYADVLVILMKLRQLCCHP 598

Query: 422 YLAM 433
            L +
Sbjct: 599 DLLL 602


>UniRef50_Q97DN1 Cluster: DNA/RNA helicase, SNF2; n=2;
            Clostridium|Rep: DNA/RNA helicase, SNF2 - Clostridium
            acetobutylicum
          Length = 949

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +1

Query: 520  DILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
            +I+   + K++L SQ+   L   E   +++ I      G  K +DRI     FN  ++  
Sbjct: 786  EIIRGHEGKVLLFSQFTSALYKIEECLRKEKIKFFHLDGSTKPQDRINMVNDFN--SNNA 843

Query: 700  HRILLLSIKCGGVGLNLIGGN 762
             ++ L+S+K GG GLNL   N
Sbjct: 844  IKVFLISLKAGGTGLNLTSAN 864



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW--KMLNKNNDSTNRIKSIIKK 179
           + A  R+ +TGTPI N   +++S+ +FL          +  K +    D+   +K +I  
Sbjct: 639 IKAYTRFALTGTPIENNLTELWSIFDFLMPGYLYSREKFEEKFVFGEEDNLESLKLLIAP 698

Query: 180 IVLKRDKSEISFNIP 224
            +L+R K E+   +P
Sbjct: 699 FILRRTKKEVVAELP 713


>UniRef50_A2ZYF1 Cluster: Putative uncharacterized protein; n=4; Oryza
            sativa|Rep: Putative uncharacterized protein - Oryza
            sativa subsp. japonica (Rice)
          Length = 1282

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 6/72 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN------RIKS 167
            L A  RWC++GTPI N   D+YS   FL+  P+ + + +  + K   S N      +++ 
Sbjct: 805  LRAKRRWCLSGTPIQNAVEDLYSYFRFLRYDPYAEYKKFCFMIKTPISRNPITGYKKLQV 864

Query: 168  IIKKIVLKRDKS 203
            ++K ++L+R K+
Sbjct: 865  VLKTVMLRRTKA 876



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +2

Query: 254  FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
            F  EE+  Y+ L+ ES E + +  AA     T+   Q   ++L ++L+LRQ C HP+L
Sbjct: 899  FTSEERAFYNTLEAESREQFKEYAAA----GTVK--QNYVNILLMLLRLRQACDHPHL 950



 Score = 37.9 bits (84), Expect = 0.29
 Identities = 19/71 (26%), Positives = 35/71 (49%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            +K I+ SQW   L + E   K  +++     G + V  R  A   FN   +    ++++S
Sbjct: 1128 EKAIVFSQWTRMLDLVEVHLKSSHLSYRRLDGTMSVAARDRAVKDFNTNPEVS--VMIMS 1185

Query: 721  IKCGGVGLNLI 753
            +K   +GLN++
Sbjct: 1186 LKAASLGLNMV 1196


>UniRef50_Q4UAK1 Cluster: DEAD-box family (SNF2-like) helicase,
            putative; n=1; Theileria annulata|Rep: DEAD-box family
            (SNF2-like) helicase, putative - Theileria annulata
          Length = 1165

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 454  NKRLF*NGLYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLM-Y 630
            NK+L+   L   +++    L+ +I+   + KI++ SQ+  YL I E   K +N+  ++  
Sbjct: 1007 NKKLY---LESTKIRKMLELISNIIKKKE-KILIFSQFTNYLDIIEYIMKLENMKPILRL 1062

Query: 631  TGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
             G + + +R      FNN  D    ILL+SIK G VGLNL
Sbjct: 1063 DGTVTLIEREKIIKKFNNE-DVY--ILLISIKVGNVGLNL 1099


>UniRef50_Q23KF5 Cluster: Type III restriction enzyme, res subunit
            family protein; n=2; Tetrahymena thermophila|Rep: Type
            III restriction enzyme, res subunit family protein -
            Tetrahymena thermophila SB210
          Length = 2184

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            KI++ SQ+V  L + E + + + +      G +K ++R  A   FN+  D +  + LLS 
Sbjct: 1159 KILIFSQFVYMLNLLEEYLRYRQLKYEKIDGSVKSKERQNAIDRFNDP-DKKRDVFLLST 1217

Query: 724  KCGGVGLNLIGGN 762
            K GG+G+NL   N
Sbjct: 1218 KAGGLGINLTSAN 1230



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 19/84 (22%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
            +TGTPI N   ++++++N+++   F   + +K      +N +  + ++  IK  +L+R K
Sbjct: 988  LTGTPIQNNTEELWTLLNYIEPNKFASLQEFKEQFGELQNKEQVDNLQVKIKPFLLRRMK 1047

Query: 201  SEISFNIP--KHTVEYVHVNLMKK 266
             ++  +IP  + T+  + +  ++K
Sbjct: 1048 EDVEDSIPPLQETIIDIEMTTLQK 1071


>UniRef50_Q0V2N7 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 861

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/90 (27%), Positives = 50/90 (55%), Gaps = 8/90 (8%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV---W--KMLNKN-NDSTNRIKSIIKKI 182
           RWC+TGTPIHN   D  ++++FL    F +  +   W  K + +N ++    ++++++  
Sbjct: 520 RWCLTGTPIHNSLDDYGALLSFLDVPGFTERTMFERWITKPIRENKSEGYTMLQTLVRST 579

Query: 183 VLKRDKSEIS--FNIPKHTVEYVHVNLMKK 266
            L+R K  +    ++P+   +  HVNL ++
Sbjct: 580 CLRRTKESMGDILHLPQRHEKIEHVNLSQE 609


>UniRef50_Q0UNL0 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1201

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +1

Query: 532  TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA-DTQHRI 708
            T D K+I+ SQ+   L + E F +++      Y G ++ +   L E + +    D + R+
Sbjct: 989  TPDHKVIVFSQFTSMLDLIEPFLRRQGYNFTRYDGSMRND---LREASLHKLREDKRTRV 1045

Query: 709  LLLSIKCGGVGLNL 750
            LL S+KCG +GLNL
Sbjct: 1046 LLCSLKCGSLGLNL 1059



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 6/69 (8%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLNKNNDSTNRIKSIIKKI 182
           RWC+TGTP+ N   ++ S+I FL+ +P+ D   WK      M N   +   R   I  K 
Sbjct: 558 RWCLTGTPMQNNLDELQSLIRFLRIQPYCDMSNWKDSISGPMKNGRGNLAMRRLQIFLKA 617

Query: 183 VLKRDKSEI 209
            +KR   E+
Sbjct: 618 FMKRRTKEV 626


>UniRef50_A4RF63 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 901

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/73 (31%), Positives = 44/73 (60%), Gaps = 7/73 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLN-KNNDSTNRI 161
           AL +  RWC+TGTP+ N   ++ S+++FL+  P++D + W+      M N K + +  R+
Sbjct: 268 ALRSEFRWCLTGTPMQNNLDELQSLVSFLRIAPYDDLKHWREYIDQPMKNGKGHLAIRRL 327

Query: 162 KSIIKKIVLKRDK 200
            S+++  + +R K
Sbjct: 328 HSLLRCFMKRRTK 340



 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/71 (35%), Positives = 38/71 (53%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           + K I+ SQ+   L +   FF ++      Y G +K + R   E+  +   D + RILL 
Sbjct: 706 EHKFIVFSQFTSMLDLVAPFFDREGFKYTRYEGSMKNDLR--EESLHSLRNDPKTRILLC 763

Query: 718 SIKCGGVGLNL 750
           S+KCG +GLNL
Sbjct: 764 SLKCGSLGLNL 774


>UniRef50_A4R562 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1430

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN-AADTQHRILL 714
            DDKII+ + WV   +I    F+ + I  L Y G + +  R  A   F         ++L+
Sbjct: 1078 DDKIIIFTHWVPLARILGRVFEAEKIRFLYYFGSMGMGQRKTAVEKFTTIIGPLAPKLLI 1137

Query: 715  LSIKCGGVGLNLIGGN 762
             S +CGG  LNL   N
Sbjct: 1138 ASSRCGGQALNLTAAN 1153



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM----LNKNNDSTN-RIKSI 170
           L + +RW ++GTPIHN   ++Y  + FL+     D + +K        +NDS N R+ ++
Sbjct: 692 LRSKHRWALSGTPIHNTIEELYPYMRFLRVEWAADMKDFKKKFGGTPGDNDSENSRLAAV 751

Query: 171 IKKIVLKRDKSEISFN------IPKHTVEYVHVNLMKKKK 272
           +  ++++R   +           P H V+ + V L  ++K
Sbjct: 752 VPSLMIRRRVHDTFMGQPILRIPPTHPVKTISVELSTEEK 791


>UniRef50_A3LSV1 Cluster: SNF2 family DNA-dependent ATPase; n=2;
           Saccharomycetaceae|Rep: SNF2 family DNA-dependent ATPase
           - Pichia stipitis (Yeast)
          Length = 715

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/82 (30%), Positives = 49/82 (59%), Gaps = 14/82 (17%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLNKNND------- 146
           L A  R+C++GTP+ N   ++Y +I FLQ RP+N+ + ++      + +KN +       
Sbjct: 213 LRADYRFCLSGTPMQNNVEELYPIIRFLQIRPYNEEQRFRVDIAIPLKSKNREYDDYDKT 272

Query: 147 -STNRIKSIIKKIVLKRDKSEI 209
            S  ++++I+K I+L+R K+ +
Sbjct: 273 QSMKKLRAILKAILLRRSKTTL 294



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +1

Query: 472 NGLYEQ-QVQTSAHLVDDILNT-SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLK 645
           NGL    ++     L+ +I  +   +KII+ SQ+     I +    ++ I  L Y G + 
Sbjct: 534 NGLTPSAKISKCVELLREIFKSYPGEKIIVFSQFTSLFDIMKLVLDKEEIDFLRYDGSMT 593

Query: 646 VEDRILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
           ++ +    +T         ++LLLS+K G VGL L
Sbjct: 594 IDHK---NSTIKRFYQEDVKVLLLSLKAGNVGLTL 625


>UniRef50_Q5K8T2 Cluster: Helicase SWR1; n=1; Filobasidiella
            neoformans|Rep: Helicase SWR1 - Cryptococcus neoformans
            (Filobasidiella neoformans)
          Length = 1246

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/81 (29%), Positives = 41/81 (50%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L +   ++++ +Q    L I E F        L   G  K+EDR +    FN  +D++  
Sbjct: 950  LKSEGHRVLIFTQMTRVLDILEMFLSHNGHRYLRLDGSTKIEDRQVLTERFN--SDSRIF 1007

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + + S + GGVG+NL G +T+
Sbjct: 1008 VFIASSRSGGVGINLTGADTV 1028


>UniRef50_Q59U81 Cluster: Helicase SWR1; n=3; Saccharomycetales|Rep:
            Helicase SWR1 - Candida albicans (Yeast)
          Length = 1641

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/93 (29%), Positives = 47/93 (50%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q  A L+ + L +   + ++ +Q  + L I E F        +   G  K+EDR L  
Sbjct: 1367 KLQKLATLLQE-LTSQGHRALIFTQMTKVLDILEQFLNIHGYRYMRLDGATKIEDRQLLT 1425

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +  + +LS + GG+G+NL G +T+
Sbjct: 1426 EKFNR--DPKIPVFILSTRSGGLGINLTGADTV 1456


>UniRef50_P38086 Cluster: DNA repair and recombination protein RDH54
           (RAD homolog 54) (Recombination factor TID1) (Two hybrid
           interaction with DMC1 protein 1) [Includes: DNA
           topoisomerase (EC 5.99.1.-); Putative helicase (EC
           3.6.1.-)]; n=5; Saccharomycetaceae|Rep: DNA repair and
           recombination protein RDH54 (RAD homolog 54)
           (Recombination factor TID1) (Two hybrid interaction with
           DMC1 protein 1) [Includes: DNA topoisomerase (EC
           5.99.1.-); Putative helicase (EC 3.6.1.-)] -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 924

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/86 (31%), Positives = 43/86 (50%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L++ I   + +K+++VS + + L I EN      ++     G +  + R    T+FN   
Sbjct: 638 LLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNRNP 697

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
                  LLS K GGVGLNL+G + L
Sbjct: 698 AIFG--FLLSAKSGGVGLNLVGRSRL 721


>UniRef50_UPI0000499756 Cluster: DNA repair protein RAD54; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DNA repair protein
           RAD54 - Entamoeba histolytica HM-1:IMSS
          Length = 884

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/81 (33%), Positives = 37/81 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L    +KI++VS + E L    +  K+     +   G +    R      FNN  +    
Sbjct: 618 LRKHKEKIVIVSNYTETLNFIAHHCKKCGYPYIQLDGSVAATKRTQMVNRFNNP-ELDEF 676

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I LLS K GG GLNL+GG  L
Sbjct: 677 IFLLSSKAGGCGLNLVGGANL 697


>UniRef50_Q11P03 Cluster: Superfamily II DNA/RNA helicase, SNF2
           family; n=3; Flexibacteraceae|Rep: Superfamily II
           DNA/RNA helicase, SNF2 family - Cytophaga hutchinsonii
           (strain ATCC 33406 / NCIMB 9469)
          Length = 977

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 7/96 (7%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINF-----LQCRPFNDPRVWKMLNKNND--STNRIK 164
           L + +R  +TGTP+ N   D++S + F     L  + F        + K +D   T R+ 
Sbjct: 660 LNSKHRLILTGTPVENSTMDLWSQMTFVNPGLLGSQQFFRNEFLNPIEKKHDEVKTKRLY 719

Query: 165 SIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           SIIK  +L+R KS++  ++P+  +E VH   M  ++
Sbjct: 720 SIIKPFILRRQKSQVVKDLPE-KIENVHYCTMSPEQ 754



 Score = 39.1 bits (87), Expect = 0.12
 Identities = 25/81 (30%), Positives = 42/81 (51%)
 Frame = +1

Query: 508  HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNA 687
            +++D+ L     KI++ SQ+V++L ++     +  I      GQ +  DR      F N 
Sbjct: 818  YMLDNALELGH-KILVFSQFVKHLHLYAKLLDKAGIKYAYLDGQTR--DRQAEVERFQNE 874

Query: 688  ADTQHRILLLSIKCGGVGLNL 750
                 R+ L+S+K GG+GLNL
Sbjct: 875  EGI--RVFLISLKAGGLGLNL 893


>UniRef50_A4J9J5 Cluster: SNF2 helicase associated domain protein;
            n=1; Desulfotomaculum reducens MI-1|Rep: SNF2 helicase
            associated domain protein - Desulfotomaculum reducens
            MI-1
          Length = 1084

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +1

Query: 481  YEQQVQTSAHLVDDILNTSDDK--IILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVED 654
            Y  Q      L++ I NT ++K  +++ SQ+   L I      + N +     GQ   +D
Sbjct: 911  YSGQSGKLEQLMEIIENTLENKRRLLVFSQFASMLGIICEELDRLNKSYFYLDGQTPAKD 970

Query: 655  RILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL*CWSL 783
            R+     FNN    +  + L+S+K GG GLNL G +T+  + L
Sbjct: 971  RVEMTQRFNNG---EKDLFLISLKAGGTGLNLTGADTVILYDL 1010


>UniRef50_A7APE4 Cluster: DNA repair protein rhp16, putative; n=1;
            Babesia bovis|Rep: DNA repair protein rhp16, putative -
            Babesia bovis
          Length = 1289

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/76 (34%), Positives = 38/76 (50%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQH 702
            +L T+ DK I+ SQ+   L +     K  NI   +  G  K+E R      FN   +   
Sbjct: 1131 VLTTTSDKSIVFSQYCSMLDLIAYRLKTANIECAVLVGNTKIESRRNILLEFNK--NPSL 1188

Query: 703  RILLLSIKCGGVGLNL 750
            R++L+S+  GG GLNL
Sbjct: 1189 RVMLISLNAGGEGLNL 1204



 Score = 41.5 bits (93), Expect = 0.023
 Identities = 14/28 (50%), Positives = 22/28 (78%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPF 104
           RWC+TGTP+ N+  D++S+I FL+  P+
Sbjct: 806 RWCLTGTPLQNRVGDVFSLIRFLRMYPY 833


>UniRef50_Q6PK83 Cluster: CHD1L protein; n=6; Eutheria|Rep: CHD1L
           protein - Homo sapiens (Human)
          Length = 789

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 187 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 246

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 247 RVKAEVATELPKKTEVVIYHGMSALQKK 274


>UniRef50_A5YM64 Cluster: CHD1L protein; n=45; Eumetazoa|Rep: CHD1L
           protein - Homo sapiens (Human)
          Length = 900

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRV------WKMLNKNNDSTNRIKSIIKKIVLK 191
           +TGTPI N   ++YS+++F++   F+   V      ++ + K ++S + +  +++  +L+
Sbjct: 204 LTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLR 263

Query: 192 RDKSEISFNIPKHT--VEYVHVNLMKKK 269
           R K+E++  +PK T  V Y  ++ ++KK
Sbjct: 264 RVKAEVATELPKKTEVVIYHGMSALQKK 291



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 22/81 (27%), Positives = 40/81 (49%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L +   +++L SQ  + L I +++   +  +     G ++ E+R LA     N       
Sbjct: 362 LYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLA---IKNFGQQPIF 418

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GGVG+NL   +T+
Sbjct: 419 VFLLSTRAGGVGMNLTAADTV 439


>UniRef50_Q8NIR3 Cluster: Related to DNA repair protein RAD26; n=12;
           Pezizomycotina|Rep: Related to DNA repair protein RAD26
           - Neurospora crassa
          Length = 1178

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
           S DK+++ S  V  L+I ++ F   +       G L  E+R      FN   D +  + L
Sbjct: 596 SGDKVLVFSHSVRLLRILQHLFHNTSYNVSFLDGALSYEERQRVVDEFNT--DPRQFVFL 653

Query: 715 LSIKCGGVGLNLIGGN 762
           +S K GGVGLN+   N
Sbjct: 654 ISTKAGGVGLNITSAN 669


>UniRef50_Q2KGE6 Cluster: Putative uncharacterized protein; n=7;
            Pezizomycotina|Rep: Putative uncharacterized protein -
            Magnaporthe grisea 70-15
          Length = 2047

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 20/102 (19%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------------MLNKN 140
            L + +RWC+TGTP+ N   +++S+I FL+  P+N    +K               M ++ 
Sbjct: 1454 LRSEHRWCLTGTPMMNGAHELFSLIRFLRIAPYNSATAFKSAFGCLTPKGATNRSMASRT 1513

Query: 141  NDSTNRIKSIIKKIVLKRDK-SEIS----FNIPKHTVEYVHV 251
              +  +++ ++K I+L+R+K S+I+      +P    E VHV
Sbjct: 1514 AKAIKQLQVVLKAIMLRREKTSKINGKPILELPPKFEEVVHV 1555



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +2

Query: 254  FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
            F+E+E + Y  L+  S+    K +       TL +     H L L+L+LRQ  CHP L
Sbjct: 1557 FSEDEASFYRDLETSSQNQINKYIR----RGTLRK--NYAHALVLLLRLRQAACHPQL 1608


>UniRef50_Q0CSH0 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus terreus NIH2624|Rep: Putative
           uncharacterized protein - Aspergillus terreus (strain
           NIH 2624)
          Length = 1205

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/96 (28%), Positives = 54/96 (56%), Gaps = 15/96 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFND----------PRVWKMLNKNNDSTN 155
           L AT RWC++GTP+ N   +++S++ FL+ RP+++          P     L +++ +  
Sbjct: 677 LNATYRWCMSGTPMMNNVEELHSLLKFLRIRPYSNLERFNKDFTRPLKSASLQEHDRAMT 736

Query: 156 RIKSIIKKIVLKRDK-SEIS----FNIPKHTVEYVH 248
           +++ ++K ++L+R K S+I       +P+   E VH
Sbjct: 737 QLQVLLKAVLLRRTKESKIDGRPILQLPRRISEKVH 772



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 1/92 (1%)
 Frame = +1

Query: 490  QVQTSAHLVDDILN-TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILA 666
            +++ +  ++D I     ++K I+ SQ+   L + E    ++      Y G +K +DR  +
Sbjct: 1031 KIEKTLEILDGIRQGEGNEKTIIFSQFTSLLDLLEVPISRRGWNYRRYDGSMKPQDRNAS 1090

Query: 667  ETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
               F +  D   RI+L+S+K G  GLNL+  +
Sbjct: 1091 VLDFTD--DPDCRIMLVSLKAGNSGLNLVAAS 1120



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+E+E  LY  L+ +++  + + + A     T+ R     ++L L+L+LRQ CCHP+L
Sbjct: 775 FSEDEMELYQALETKTQLQFNRYLEA----GTVGR--NYSNILVLLLRLRQACCHPHL 826


>UniRef50_Q0CCD8 Cluster: Predicted protein; n=1; Aspergillus
           terreus NIH2624|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 752

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 8/92 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPR--------VWKMLNKNNDSTNRI 161
           L A  RWC+TGTPI NK  D+ +++ FL+  PF+D          +  + +   D +  +
Sbjct: 442 LQACRRWCLTGTPIQNKLEDLGALVAFLKTPPFDDRSQTRFKQHIIDPLFSGMKDPSQNL 501

Query: 162 KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNL 257
           + +++ + L+R K   S NI  +T E + ++L
Sbjct: 502 RLLLQSLCLRRTKHS-SQNITVNT-ELIKLSL 531


>UniRef50_A6S4F7 Cluster: Putative uncharacterized protein; n=2;
            Sclerotiniaceae|Rep: Putative uncharacterized protein -
            Botryotinia fuckeliana B05.10
          Length = 1420

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = +1

Query: 538  DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
            DDK+++  Q+    +I     K +    L  TG   +E R  A   F N  D Q  IL+ 
Sbjct: 1222 DDKVVIYVQFRTLARIIGRMCKAEGWGFLYLTGDASLEHRSKATKEFRNRDDIQ--ILIA 1279

Query: 718  SIKCGGVGLN 747
             +KCGG+GLN
Sbjct: 1280 GLKCGGLGLN 1289



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIK 176
            L +  RWC+TGTP+ N+  +++  + FL+     D R ++        +D  NRI +++ 
Sbjct: 881  LKSVYRWCLTGTPLLNRLEELFPYLRFLKANYAMDWRTFQQYFCDPDADDCNNRIATLLS 940

Query: 177  KIVLKRDKSEISFNIPKHTVEYVH 248
              +++R       N P  T+   H
Sbjct: 941  YAMMRRTMKTTILNRPIITLPKPH 964


>UniRef50_A6S040 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1096

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKN-IATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           K +L SQ V+ L I E F K+      L   G   V+DR      FNN  D +  + LL+
Sbjct: 682 KTLLFSQGVQMLDILEEFVKKLGGFNYLRMDGGTAVKDRQTLVDQFNN--DPEMHVFLLT 739

Query: 721 IKCGGVGLNLIGGN 762
            K GG+G+NL G N
Sbjct: 740 TKVGGLGVNLTGAN 753


>UniRef50_A0PA46 Cluster: DNA repair and recombination protein MUS41;
            n=1; Neurospora crassa|Rep: DNA repair and recombination
            protein MUS41 - Neurospora crassa
          Length = 1175

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/115 (25%), Positives = 60/115 (52%), Gaps = 13/115 (11%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKN-NDSTNRIK 164
            + A +RW +TGTPI N+  D++S++ FL+  P+N+   W+        +KN   + + ++
Sbjct: 701  IAAEHRWVLTGTPIVNRLEDLFSLVRFLRVEPWNNFSFWRTFITVPFESKNFVRALDVVQ 760

Query: 165  SIIKKIVLKRDK------SEISFNIPKHTVEYVHVNLMKKKKRCTIS*NVNRKRR 311
            ++++ +V++R K       +    +P   +E V + L  + +R       NR +R
Sbjct: 761  TVLEPLVMRRTKDMKTPDGQFLVPLPPKHIEIVDIEL-SEPERAVYDYVFNRAKR 814



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K +++SQ+  +L +  +   +  I+ L   G +  + R    T F +    +  +LLLS+
Sbjct: 1023 KSLVISQFTSFLSLISSALTRHKISFLRLDGSMSQKARAAVLTEFQST--NKFCVLLLSL 1080

Query: 724  KCGGVGLNL 750
            K GGVGLNL
Sbjct: 1081 KAGGVGLNL 1089


>UniRef50_Q6CA87 Cluster: Helicase SWR1; n=1; Yarrowia lipolytica|Rep:
            Helicase SWR1 - Yarrowia lipolytica (Candida lipolytica)
          Length = 1772

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/93 (26%), Positives = 47/93 (50%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q  A L+ D++     + ++ +Q  + L + E F     +  +   G  K+E R L  
Sbjct: 1470 KLQRLATLLQDLI-AGGHRALIFTQMTKVLDVLEQFLNIHGLRYMRLDGATKIEQRQLLT 1528

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +  + +LS + GG+G+NL G +T+
Sbjct: 1529 ERFNT--DPKIPVFILSTRSGGLGINLTGADTV 1559


>UniRef50_Q6CJ38 Cluster: Helicase SWR1; n=2; Saccharomycetaceae|Rep:
            Helicase SWR1 - Kluyveromyces lactis (Yeast) (Candida
            sphaerica)
          Length = 1572

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/93 (27%), Positives = 48/93 (51%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++Q  A L+ + L  +  + ++ +Q  + L I E F        +   G  K+EDR +  
Sbjct: 1311 KLQKLAQLLQN-LKDNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQILT 1369

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN+  D +  + +LS + GG+G+NL G +T+
Sbjct: 1370 ERFNS--DPRITVFILSSRSGGLGINLTGADTV 1400


>UniRef50_Q7S1P9 Cluster: DNA repair protein rad-5; n=5;
            Pezizomycotina|Rep: DNA repair protein rad-5 - Neurospora
            crassa
          Length = 1222

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 29/115 (25%), Positives = 60/115 (52%), Gaps = 13/115 (11%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKN-NDSTNRIK 164
            + A +RW +TGTPI N+  D++S++ FL+  P+N+   W+        +KN   + + ++
Sbjct: 748  IAAEHRWVLTGTPIVNRLEDLFSLVRFLRVEPWNNFSFWRTFITVPFESKNFVRALDVVQ 807

Query: 165  SIIKKIVLKRDK------SEISFNIPKHTVEYVHVNLMKKKKRCTIS*NVNRKRR 311
            ++++ +V++R K       +    +P   +E V + L  + +R       NR +R
Sbjct: 808  TVLEPLVMRRTKDMKTPDGQFLVPLPPKHIEIVDIEL-SEPERAVYDYVFNRAKR 861



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K +++SQ+  +L +  +   +  I+ L   G +  + R    T F +    +  +LLLS+
Sbjct: 1070 KSLVISQFTSFLSLISSALTRHKISFLRLDGSMSQKARAAVLTEFQST--NKFCVLLLSL 1127

Query: 724  KCGGVGLNL 750
            K GGVGLNL
Sbjct: 1128 KAGGVGLNL 1136


>UniRef50_UPI0000DB74BA Cluster: PREDICTED: similar to DNA repair
           and recombination protein RAD54B (RAD54 homolog B); n=1;
           Apis mellifera|Rep: PREDICTED: similar to DNA repair and
           recombination protein RAD54B (RAD54 homolog B) - Apis
           mellifera
          Length = 797

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/81 (32%), Positives = 41/81 (50%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +++K++L+S + + L + E     + +  L   G      R      FN+  D  ++
Sbjct: 541 LKKTNEKLVLISYYTQTLDLLERVCNMECLQFLRLDGNTTSSTRSKIIEQFNSTNDN-NK 599

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I LLS K GGVGLNL G + L
Sbjct: 600 IFLLSAKAGGVGLNLPGASRL 620


>UniRef50_A6LWU4 Cluster: Non-specific serine/threonine protein
            kinase; n=1; Clostridium beijerinckii NCIMB 8052|Rep:
            Non-specific serine/threonine protein kinase -
            Clostridium beijerinckii NCIMB 8052
          Length = 1057

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/91 (25%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCR-PFNDPRVWKMLNKNNDSTNRIKSIIKKI 182
            + A N++ +TGTP+ N   +++S+ +F+     +N     K    N+ ST  ++  I+  
Sbjct: 745  IKAKNKFVLTGTPLENNLIELWSIFDFIMPNYLYNSTFFKKKFIDNDSSTIELQKFIRPF 804

Query: 183  VLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +L+R K ++   +P    +  +V L K++K+
Sbjct: 805  MLRRLKKDVIRELPDKIEKNYYVELKKEQKK 835



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 23/93 (24%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            +++ + +L++D +  +  KI+L SQ+   L        +  I  +   G  K   R    
Sbjct: 887  KLEEALNLIEDNI-ANGHKILLFSQFTSVLNNISKELSENKIEHMYLDGSTKATKRSELV 945

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN +   ++++ L+S+K GG GLNL   + +
Sbjct: 946  DEFNGS--DKYKVFLISLKAGGTGLNLTSADII 976


>UniRef50_A6DIK8 Cluster: SNF2-related protein; n=2; Bacteria|Rep:
           SNF2-related protein - Lentisphaera araneosa HTCC2155
          Length = 880

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/70 (34%), Positives = 41/70 (58%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKI 182
           AL + NR  +TGTPI N   D++S+ +FL      + + +  L K+ D  +RI+ +I   
Sbjct: 558 ALQSKNRLALTGTPIENSLGDLWSLFDFLNPGLLGNKKEFTRLAKSKD-LSRIRQVISPY 616

Query: 183 VLKRDKSEIS 212
           +L+R K++ S
Sbjct: 617 ILRRLKTDKS 626


>UniRef50_A7R3I3 Cluster: Chromosome undetermined scaffold_525,
           whole genome shotgun sequence; n=3; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_525, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 954

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNK---NNDSTN---RIKS 167
           L A  RWC++GTPI N   D+YS   FL+  P+   + +    K     + TN   ++++
Sbjct: 490 LRAKRRWCLSGTPIQNAVDDLYSYFRFLRYDPYAVYKSFCSTIKVPITRNPTNGYRKLQA 549

Query: 168 IIKKIVLKRDK-----SEISFNIPKHTVEYVHVNLMKKKK 272
           ++K I+L+R K      E    +P  +VE   V+  K+++
Sbjct: 550 VLKTIMLRRTKGTLLDGEPIITLPPKSVELKKVDFSKEER 589



 Score = 41.9 bits (94), Expect = 0.018
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +1

Query: 532  TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
            T+ +K I+ SQW   L + E+  K  +I      G + V  R  A   FN   +    ++
Sbjct: 797  TTSEKAIVFSQWTRMLDLLESCLKNSSIQYRRLDGTMSVVARDKAVKDFNTLPEVS--VM 854

Query: 712  LLSIKCGGVGLNLI 753
            ++S+K   +GLN++
Sbjct: 855  IMSLKAASLGLNMV 868



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F++EE+  Y +L+ +S   +    AA     T+   Q   ++L ++L+LRQ C HP L
Sbjct: 584 FSKEERDFYSRLEADSRAQFEVYAAA----GTVK--QNYVNILLMLLRLRQACDHPLL 635


>UniRef50_A5AIW5 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1435

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNK---NNDSTN---RIKS 167
            L A  RWC++GTPI N   D+YS   FL+  P+   + +    K     + TN   ++++
Sbjct: 910  LRAKRRWCLSGTPIQNAVDDLYSYFRFLRYDPYAVYKSFCSTIKVPITRNPTNGYRKLQA 969

Query: 168  IIKKIVLKRDK-----SEISFNIPKHTVEYVHVNLMKKKK 272
            ++K I+L+R K      E    +P  +VE   V+  K+++
Sbjct: 970  VLKTIMLRRTKGTLLDGEPIITLPPKSVELKKVDFSKEER 1009



 Score = 39.5 bits (88), Expect = 0.094
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            +K I+ SQW   L + E+  K  +I      G + V  R  A   FN   +    ++++S
Sbjct: 1254 EKAIVFSQWTRMLDLLESCLKNSSIQYRRLDGTMSVVARDKAVKDFNTLPEVS--VMIMS 1311

Query: 721  IKCGGVGLNLI 753
            +K   +GLN++
Sbjct: 1312 LKAASLGLNMV 1322



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +2

Query: 254  FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
            F++EE+  Y +L+ +S   +    AA     T+   Q   ++L ++L+LRQ C HP L
Sbjct: 1004 FSKEERDFYSRLEADSRAQFEVYAAA----GTVK--QNYVNILLMLLRLRQACDHPLL 1055


>UniRef50_A2FGX6 Cluster: SNF2 family N-terminal domain containing
           protein; n=1; Trichomonas vaginalis G3|Rep: SNF2 family
           N-terminal domain containing protein - Trichomonas
           vaginalis G3
          Length = 1454

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ  + L I E++ + K        G +K EDR  A   FN+       
Sbjct: 539 LKKDGHRVLIFSQMTKMLDILEDYLRYKRYNYERIDGSVKTEDRQQAIDRFNDEKSNSF- 597

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           I LL  + GG+G+NL+  +T+
Sbjct: 598 IFLLCTRAGGLGINLVSADTV 618



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 19/67 (28%), Positives = 40/67 (59%), Gaps = 3/67 (4%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVW-KMLNKNNDS--TNRIKSIIKKIVLKRDK 200
           +TGTP+ N   ++++++NFL    F D  ++ +   K  D+     +++I+K ++L+R K
Sbjct: 366 LTGTPLQNNTKELWTLLNFLDTERFADHHIFDEKFGKLQDAEQIKELQAILKPLMLRRLK 425

Query: 201 SEISFNI 221
            ++  NI
Sbjct: 426 GDVEKNI 432


>UniRef50_Q7SBI2 Cluster: Putative uncharacterized protein NCU06190.1;
            n=1; Neurospora crassa|Rep: Putative uncharacterized
            protein NCU06190.1 - Neurospora crassa
          Length = 1930

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/74 (36%), Positives = 39/74 (52%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            DK+++ SQ +  L   ++ FK K I      G+  V  R  A   FN A D+   + L+S
Sbjct: 1381 DKVLVFSQSIPTLNFLQDLFKLKKINYRKLDGKTPVSQRQAAVKEFN-AVDSLD-VYLIS 1438

Query: 721  IKCGGVGLNLIGGN 762
             + GGVGLN+ G N
Sbjct: 1439 TRAGGVGLNIPGAN 1452


>UniRef50_Q5KHC6 Cluster: DNA repair protein rad16, putative; n=4;
           Filobasidiella neoformans|Rep: DNA repair protein rad16,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1045

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 16/35 (45%), Positives = 26/35 (74%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN 107
           AL AT +WC++GTP+ N+  ++YS++ FL   PF+
Sbjct: 592 ALKATYKWCLSGTPLQNRVGELYSLVRFLGADPFS 626


>UniRef50_Q5K9G4 Cluster: Putative uncharacterized protein; n=2;
            Filobasidiella neoformans|Rep: Putative uncharacterized
            protein - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 1558

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++  Q  E + I  +FF  +        G  K EDR    +TFN+  ++ +++ +LS 
Sbjct: 1030 KVLIFFQMTEIMTIVSDFFDFRGWKYCRLDGSTKAEDRQTLLSTFND-PNSPYQVFILST 1088

Query: 724  KCGGVGLNLIGGNTL 768
            + GG+GLNL   +T+
Sbjct: 1089 RAGGLGLNLQSADTV 1103


>UniRef50_Q2H4Z6 Cluster: Putative uncharacterized protein; n=2;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 1203

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/64 (28%), Positives = 38/64 (59%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKI 182
           ++ AT RWC+TGTP+ N   ++Y +I FL+ RP+ D + ++   +   + + +  I +  
Sbjct: 616 SIKATYRWCLTGTPMMNGVSELYPLIRFLRIRPYCDFKTFQRTFRGLTAKSNVTEITRDN 675

Query: 183 VLKR 194
            +++
Sbjct: 676 AMRQ 679



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+E+E+  Y  L+ +S+  + K + A     T+ +     ++L L+L+LRQ CCHP+L
Sbjct: 717 FSEDERQFYRDLESKSQVQFNKFLRA----GTVGK--NYSNILVLLLRLRQACCHPHL 768


>UniRef50_Q000Q7 Cluster: RING-13 protein; n=1; Gibberella zeae|Rep:
           RING-13 protein - Gibberella zeae (Fusarium graminearum)
          Length = 1133

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/77 (29%), Positives = 47/77 (61%), Gaps = 9/77 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPF---NDPR--VWKMLNKNNDSTN----R 158
           L + +RWC+TGTP+ N   ++YS++ FL+ RP+   +D R    ++  +  D+ +    +
Sbjct: 593 LKSIHRWCLTGTPMMNGVLELYSLVRFLKVRPYCKWDDFRQSFGRLFGRQGDTKSTAMRK 652

Query: 159 IKSIIKKIVLKRDKSEI 209
           ++  +K I+L+R K+ +
Sbjct: 653 LQVFLKAIMLRRKKNSL 669



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+ EE   Y +L+  ++    K +     E ++S+      +L L+L+LRQ CCHP+L
Sbjct: 690 FSPEELDFYKQLEKNAQVLVNKYIR----EKSVSK--NYSSILVLLLRLRQACCHPHL 741


>UniRef50_A7THE2 Cluster: Putative uncharacterized protein; n=1;
            Vanderwaltozyma polyspora DSM 70294|Rep: Putative
            uncharacterized protein - Vanderwaltozyma polyspora DSM
            70294
          Length = 1385

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 3/96 (3%)
 Frame = +1

Query: 490  QVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRI 660
            +V     L+D +L     S  ++++  Q  + + I E+F + +++  +   G  K EDR 
Sbjct: 823  RVSGKFELLDRVLPKFKASGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGATKAEDRT 882

Query: 661  LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                 F NA ++ +   LLS + GG+GLNL   +T+
Sbjct: 883  DMLKVF-NAPNSDYFCFLLSTRAGGLGLNLQTADTV 917


>UniRef50_A5DXJ8 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 936

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/81 (24%), Positives = 48/81 (59%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           +++ + K ++ SQ+ + + + +++   +NI      G    E+R    + FN++ ++ ++
Sbjct: 676 VSSQNHKCLIFSQFTKVMDLIQDWLHFQNIKACRLDGLTPQEERAKQISQFNDS-NSSYK 734

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+G+NL G +T+
Sbjct: 735 VFLLSTRAGGLGINLTGADTV 755



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 23/84 (27%), Positives = 44/84 (52%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIV 185
           L  TNR  ITGTP+ N   +++S++NF+    F+D  +++     ++ T    +I +   
Sbjct: 348 LNTTNRLLITGTPLQNNLNELWSLLNFILPDIFHDLELFQQWFNFDELT----TIEQNEQ 403

Query: 186 LKRDKSEISFNIPKHTVEYVHVNL 257
            +  K  I +NI +  ++ +H  L
Sbjct: 404 DEETKKFIKYNIQETLIKNLHTIL 427


>UniRef50_A2QHB0 Cluster: Contig An03c0200, complete genome; n=1;
           Aspergillus niger|Rep: Contig An03c0200, complete genome
           - Aspergillus niger
          Length = 961

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 28/94 (29%), Positives = 50/94 (53%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNR------IK 164
           +L A  RWC+TGTPI N+  D  +++ F+Q  PF     ++ +   + S N+      ++
Sbjct: 473 SLQAQYRWCLTGTPIQNRLADYGALLEFIQAPPFESRGSFERMIVGSISENKRRSFDLLR 532

Query: 165 SIIKKIVLKRDK--SEISFNIPKHT--VEYVHVN 254
           +++    L+R K  S     +P+ T  VE VH++
Sbjct: 533 NVVTATCLRRTKRNSATELCLPQKTELVERVHMD 566


>UniRef50_Q05471 Cluster: Helicase SWR1; n=3; Saccharomycetaceae|Rep:
            Helicase SWR1 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1514

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/81 (27%), Positives = 41/81 (50%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  + ++ +Q  + L + E F        +   G  K+EDR +    FN   D++  
Sbjct: 1258 LKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNT--DSRIT 1315

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + +LS + GG+G+NL G +T+
Sbjct: 1316 VFILSSRSGGLGINLTGADTV 1336


>UniRef50_Q6CJM4 Cluster: DNA repair protein RAD5; n=1;
           Kluyveromyces lactis|Rep: DNA repair protein RAD5 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 1114

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/74 (29%), Positives = 43/74 (58%), Gaps = 7/74 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-----LNKNN--DSTNRI 161
           AL ++ +W +TGTPI N+  D++S++ FL   P++    WK        K N   + + I
Sbjct: 645 ALRSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFDVI 704

Query: 162 KSIIKKIVLKRDKS 203
            ++++ ++L+R K+
Sbjct: 705 NAVLEPVLLRRTKN 718



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 4/74 (5%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFE----NFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            ++II+ SQ+  +L I E    +   +  +    + G+L +++R      F++   +  ++
Sbjct: 958  EQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDMKERTRILEQFHDKDLSCIKL 1017

Query: 709  LLLSIKCGGVGLNL 750
            LLLS+K GGVGLNL
Sbjct: 1018 LLLSLKTGGVGLNL 1031


>UniRef50_UPI00006CB005 Cluster: SNF2 family N-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: SNF2 family N-terminal domain containing
           protein - Tetrahymena thermophila SB210
          Length = 1046

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/83 (28%), Positives = 40/83 (48%)
 Frame = +1

Query: 520 DILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
           +I   S ++II+VS W + L + +   KQKN+  +   G +  + R      F +  +  
Sbjct: 662 EIAQKSTERIIIVSYWTQTLDVLQIMIKQKNLKFVRLDGSVNAQKRQELIDRFQDPTN-D 720

Query: 700 HRILLLSIKCGGVGLNLIGGNTL 768
            ++ LL    GG GLNL   N +
Sbjct: 721 IKVFLLCGSAGGTGLNLSAANRM 743


>UniRef50_UPI000049868D Cluster: chromodomain-helicase-DNA-binding
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           chromodomain-helicase-DNA-binding protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 1247

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/86 (25%), Positives = 47/86 (54%), Gaps = 4/86 (4%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIKKIVLKRD 197
           +TGTPI N   ++++++N+++ + F         +  L+K+ +  N+++  IK   L+R 
Sbjct: 465 LTGTPIQNNLGELWTLLNYIEPKTFPSLEEFDHEFNSLDKSAEQVNKLQESIKPFFLRRM 524

Query: 198 KSEISFNIPKHTVEYVHVNLMKKKKR 275
           K+E+  +IP      + V L   +K+
Sbjct: 525 KNEVEKSIPPKEETIIEVELTMVQKQ 550



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 5/101 (4%)
 Frame = +1

Query: 481 YEQQVQTSAHLV--DDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLK 645
           + Q +++S  LV  D +L        K+++ SQ  + L I E + K K        G +K
Sbjct: 611 FNQLIRSSGKLVLLDKLLPKLYADHHKVLIFSQLKKVLNIIEKYLKYKGYFYERLDGSIK 670

Query: 646 VEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            EDR  A   F N  +    I LL  + GG G+NL   +T+
Sbjct: 671 SEDRQNAIDRFMNP-EMNRFIFLLCTRAGGFGINLSEADTV 710


>UniRef50_Q3ICM5 Cluster: Putative DNA helicase with SNF2 domain; n=2;
            Alteromonadales|Rep: Putative DNA helicase with SNF2
            domain - Pseudoalteromonas haloplanktis (strain TAC 125)
          Length = 1048

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/75 (33%), Positives = 42/75 (56%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+I+ SQ+   L +     K+ NI   + TGQ +  D+++ E  F + A +   + L+S+
Sbjct: 900  KVIIFSQFTSALDLIAERLKEININFSLLTGQTRQRDKVIDE--FTSGATS---VFLISL 954

Query: 724  KCGGVGLNLIGGNTL 768
            K GG GLNL   +T+
Sbjct: 955  KAGGTGLNLTQADTV 969



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 7/83 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-------LNKNNDSTNRIK 164
           L A  + C++GTPI N  +++ S+++F           +K           N +   ++K
Sbjct: 731 LNADFKLCLSGTPIENNLFELKSLLDFAMPSLLGSQTHFKTHFQTPIERESNAERAQQLK 790

Query: 165 SIIKKIVLKRDKSEISFNIPKHT 233
            +I   +L+R K++++  +P  T
Sbjct: 791 DLIMPFILRRTKAQVAQELPLKT 813


>UniRef50_Q21RH3 Cluster: SNF2-related; n=1; Rhodoferax ferrireducens
            T118|Rep: SNF2-related - Rhodoferax ferrireducens (strain
            DSM 15236 / ATCC BAA-621 / T118)
          Length = 1178

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/75 (33%), Positives = 42/75 (56%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            +I+L SQ+   LK+ E   +++NI  +  TGQ +  D ++ + T          + L+S+
Sbjct: 1026 RILLFSQFTSMLKLIEAELQKRNIPWIKLTGQSQKRDALIEQFTSGAVP-----LFLISL 1080

Query: 724  KCGGVGLNLIGGNTL 768
            K GGVGLNL   +T+
Sbjct: 1081 KAGGVGLNLPQADTV 1095


>UniRef50_Q8IDQ5 Cluster: DNA helicase, putative; n=2; Plasmodium|Rep:
            DNA helicase, putative - Plasmodium falciparum (isolate
            3D7)
          Length = 1446

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-----MLNKN--NDSTNRIK 164
            L     WC+TGTPI N  +D++ +  FL  +P+     W       +NKN  N + + ++
Sbjct: 906  LRGERNWCLTGTPIQNSIFDIFPLFRFLGIKPYGTIEWWNKEIVDYVNKNKLNLALDVVR 965

Query: 165  SIIKKIVLKRDKSEISFN 218
             I   I+L+R K   + N
Sbjct: 966  KISSPILLRRTKKSKTKN 983



 Score = 40.7 bits (91), Expect = 0.041
 Identities = 32/101 (31%), Positives = 45/101 (44%), Gaps = 20/101 (19%)
 Frame = +1

Query: 508  HLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN-- 681
            H+ +D+ N  +  I++ SQW+ +LKI E      NIA  +Y G L  E R      FN  
Sbjct: 1250 HVQNDMQN--ELHIVVFSQWIGFLKIIEKLLNLYNIANKIYDGSLTFEQRKATLNWFNIQ 1307

Query: 682  ------------------NAADTQHRILLLSIKCGGVGLNL 750
                                 +   ++LL S+K GGVGLNL
Sbjct: 1308 KGKIYQPGVGFIKPSYVIPVENFAGKVLLCSLKAGGVGLNL 1348


>UniRef50_Q8IB35 Cluster: ATP-dependant helicase, putative; n=7;
            Plasmodium|Rep: ATP-dependant helicase, putative -
            Plasmodium falciparum (isolate 3D7)
          Length = 2110

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/76 (32%), Positives = 38/76 (50%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            +K +L +Q+++ L I E F    N + +   G  KVE R    T FNN  D    I + S
Sbjct: 1785 NKCLLFTQFIKMLDILEIFLNHLNYSFIRLDGSTKVEQRQKIVTKFNN--DKSIFIFISS 1842

Query: 721  IKCGGVGLNLIGGNTL 768
             + G +G+NL   N +
Sbjct: 1843 TRSGSIGINLTAANVV 1858


>UniRef50_Q55C32 Cluster: SNF2-related domain-containing protein; n=9;
            Eukaryota|Rep: SNF2-related domain-containing protein -
            Dictyostelium discoideum AX4
          Length = 3247

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/81 (30%), Positives = 44/81 (54%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ  + + I E FF  K+   L   G  K ++R      FN A ++++ 
Sbjct: 2038 LKAAGHRVLIFSQMTQLINILEVFFAYKDYKFLRLDGSTKSDERGHLLELFN-APNSEYF 2096

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I +LS + GG+GLNL   +T+
Sbjct: 2097 IFVLSTRAGGLGLNLQTADTV 2117


>UniRef50_Q17L58 Cluster: E1a binding protein P400; n=2; cellular
            organisms|Rep: E1a binding protein P400 - Aedes aegypti
            (Yellowfever mosquito)
          Length = 3081

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 28/93 (30%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L +   ++++ +Q    L + E F        L   G  KVE R L  
Sbjct: 1625 KLQTLDRLLKQ-LKSGGHRVLIFTQMTRMLDVLEAFLNYHGHIYLRLDGTTKVEQRQLLM 1683

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +  + +LS + GGVG+NL G +T+
Sbjct: 1684 ERFNG--DKRVFVFILSTRSGGVGINLTGADTV 1714



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 13/98 (13%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKNNDST----NRI 161
            R  +TGTP+ N   +++S+++FL    F   R +K         M+  N++       R+
Sbjct: 1022 RLLLTGTPLQNNLMELWSLMHFLMPHVFQSHREFKEWFSNPMTGMIEGNSEYNENIIKRL 1081

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
              +++  +L+R KSE+   +PK   +Y HV + +  KR
Sbjct: 1082 HKVLRPFLLRRLKSEVEKQMPK---KYEHVVMCRLSKR 1116


>UniRef50_A0C011 Cluster: Chromosome undetermined scaffold_14, whole
            genome shotgun sequence; n=4; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_14, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1668

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 3/83 (3%)
 Frame = +1

Query: 511  LVDDILN---TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFN 681
            L+D +LN       K+++ SQ+   L I E + K + +      GQ+K  +R  A   FN
Sbjct: 878  LLDKLLNKFRNEGKKMLIFSQFTMMLSILEEYLKFRQVKYEKIDGQIKARERQNAIDRFN 937

Query: 682  NAADTQHRILLLSIKCGGVGLNL 750
            +    +  + LLS K GG G+NL
Sbjct: 938  D-PQKKREVFLLSTKAGGQGINL 959



 Score = 39.5 bits (88), Expect = 0.094
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 4/69 (5%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIKKIVLKRD 197
           +TGTPI N   +++S++NF++   F++     R +  L + +D   ++  ++K  +L+R 
Sbjct: 720 LTGTPIQNNTEELFSLLNFIEPYQFSNLISFKREYGQL-ETSDQVEKLNVLLKPYILRRQ 778

Query: 198 KSEISFNIP 224
           K ++   IP
Sbjct: 779 KEDVEQMIP 787


>UniRef50_Q8SUC5 Cluster: Similarity to THE ATPase COMPONENT OF THE
           TWO-SUBUNIT CHROMATIN REMODELING FACTOR; n=1;
           Encephalitozoon cuniculi|Rep: Similarity to THE ATPase
           COMPONENT OF THE TWO-SUBUNIT CHROMATIN REMODELING FACTOR
           - Encephalitozoon cuniculi
          Length = 823

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 5/85 (5%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNND-----STNRIKSIIKKI 182
           +R  ITGTP+ N   ++++++NF+    FND   ++    N D     +  RI+S+++  
Sbjct: 203 HRLLITGTPLQNNVHELWALLNFIVPEIFNDAEKFESYVMNIDEGDGEAIRRIRSVLQLF 262

Query: 183 VLKRDKSEISFNIPKHTVEYVHVNL 257
            L+R+K ++  ++P   +  ++  L
Sbjct: 263 FLRREKIDVEMSLPPKKIVNLYSKL 287



 Score = 34.3 bits (75), Expect = 3.5
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +        G     DR  A   FN A  ++  
Sbjct: 364 LKAKGSRVLIFSQMSMMLDILEDYAMFREYEYCRIDGSTSYRDRTEAIDGFN-AEGSEKF 422

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LL+ + GG+G+NL   +T+
Sbjct: 423 LFLLTTRAGGLGINLSTADTV 443


>UniRef50_Q2GSU4 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 890

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK 125
           AL +  RWC+TGTP+ N   ++ S+++FL+  P++D   W+
Sbjct: 269 ALRSEYRWCLTGTPMQNNLDELQSLVHFLRISPYDDLAEWR 309



 Score = 41.5 bits (93), Expect = 0.023
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = +1

Query: 475 GLYEQQVQTSAHLVD--DILN--TSDDKIILVSQWVEYLKIFENFFK-QKNIATLMYTGQ 639
           G     V TSA + +   IL    S  K I+ SQ+   L + E F + Q  +  + Y G+
Sbjct: 660 GSSSNSVMTSAKIRELLSILRKEASVHKFIVFSQFTSMLDLVEPFLRAQPGLKAVRYDGK 719

Query: 640 LKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
           +  + R  A        D   RILL S+KCG +GLNL
Sbjct: 720 MPNDAREAALRALRT--DPHTRILLCSLKCGSLGLNL 754


>UniRef50_Q0UDA4 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1104

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 26/102 (25%), Positives = 57/102 (55%), Gaps = 13/102 (12%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML----NKNND---STNRIK 164
           L A +RW +TGTPI N+  D++S++ FL+  P+++   WK       ++ D   + + ++
Sbjct: 650 LYAKHRWVLTGTPIVNRLEDLFSLVRFLKVEPWSNFSFWKTFITVPFESGDFIRALDVVQ 709

Query: 165 SIIKKIVLKRDK------SEISFNIPKHTVEYVHVNLMKKKK 272
           ++++ +VL+R K       E+   +P  T++   + L + ++
Sbjct: 710 TVLEPLVLRRTKDMKTPDGEMLVPLPPRTIDVERIVLSQDER 751



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K ++ SQ+  +L + E    + +I  L + G L  + R    T F ++      +LLLS+
Sbjct: 954  KSVVFSQFTSFLDLIEPALARDHIPFLRFDGSLSQKARAHILTEFTSSPKPY--VLLLSL 1011

Query: 724  KCGGVGLNL 750
            + GGVGLNL
Sbjct: 1012 RAGGVGLNL 1020



 Score = 33.1 bits (72), Expect = 8.2
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMH 436
           +++E+ +YD +   ++  +    AA     TL  L+    +   IL+LRQ CCHP L   
Sbjct: 747 SQDERDVYDHIYTRAKSVF----AANAEAGTL--LKSYTTIFAQILRLRQSCCHPILTRK 800

Query: 437 GRNLLETND 463
              + +  D
Sbjct: 801 ANIVADEED 809


>UniRef50_A6S0R3 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 1081

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 15/34 (44%), Positives = 25/34 (73%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF 104
           AL A ++WC++GTP+ N+  + +S++ FL  RPF
Sbjct: 638 ALKANHKWCLSGTPLQNRIGEFFSLVRFLDIRPF 671



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 24/76 (31%), Positives = 35/76 (46%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
            S  K I+ SQ+   L++ E   ++  I T+M  G +    R  +   F    D      L
Sbjct: 926  SSSKSIIFSQFTTMLQLVEWRLRRAGITTVMLDGSMTPAQRQASINHF--MTDVNVECFL 983

Query: 715  LSIKCGGVGLNLIGGN 762
            +S+K GGV LNL   N
Sbjct: 984  VSLKAGGVALNLTEAN 999


>UniRef50_A1DC46 Cluster: DNA excision repair protein Rad16,
           putative; n=10; Pezizomycotina|Rep: DNA excision repair
           protein Rad16, putative - Neosartorya fischeri (strain
           ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus
           fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181))
          Length = 977

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 15/34 (44%), Positives = 26/34 (76%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPF 104
           AL A+ +WC++GTP+ N+  + +S++ FL+ RPF
Sbjct: 530 ALKASYKWCLSGTPVQNRIGEFFSLLRFLEVRPF 563



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 22/69 (31%), Positives = 35/69 (50%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQ+   L++ E   ++    T+M  G +    R  +   F N  D +  + L+S+
Sbjct: 824  KSIVFSQFTSMLQLVEWRLRRAGFNTVMLDGTMTPAQRQKSIDYFMNNVDVE--VFLVSL 881

Query: 724  KCGGVGLNL 750
            K GGV LNL
Sbjct: 882  KAGGVALNL 890


>UniRef50_P47264 Cluster: Uncharacterized ATP-dependent helicase
            MG018; n=7; Mycoplasma|Rep: Uncharacterized ATP-dependent
            helicase MG018 - Mycoplasma genitalium
          Length = 1031

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/69 (33%), Positives = 42/69 (60%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+IL +Q+++ +  F+   K + I  L++ G+  V++R      FN+A +    ++L S+
Sbjct: 881  KVILFTQFLDVIDCFKQTLKNQKIDHLVFDGRKTVKNRNTIIQKFNSAKEPC--VMLASL 938

Query: 724  KCGGVGLNL 750
            K GGVG+NL
Sbjct: 939  KAGGVGINL 947



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 19/85 (22%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---MLNKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTPI N+  D++S  +F+      + + +       KN++S  ++       +L+R K
Sbjct: 729 LTGTPIENRLLDLWSCFDFVLPNFLGNKKQFSDQFEKEKNDESFQKLMKKTSPFILRRTK 788

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           +++   +PK  +  ++V L ++ ++
Sbjct: 789 NKVLKELPKKIITDIYVELSEEHQK 813


>UniRef50_Q6FK48 Cluster: Helicase SWR1; n=1; Candida glabrata|Rep:
            Helicase SWR1 - Candida glabrata (Yeast) (Torulopsis
            glabrata)
          Length = 1450

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/81 (28%), Positives = 40/81 (49%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     + ++ +Q  + L I E F        +   G  K+EDR +    FN+  D +  
Sbjct: 1190 LKDGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNS--DPKIT 1247

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + +LS + GG+G+NL G +T+
Sbjct: 1248 VFILSSRSGGLGINLTGADTV 1268


>UniRef50_P22082 Cluster: Transcription regulatory protein SNF2; n=3;
            Saccharomycetales|Rep: Transcription regulatory protein
            SNF2 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1703

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/81 (29%), Positives = 43/81 (53%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++  Q  + + I E+F +  NI  L   G  K ++R      FN A D+++ 
Sbjct: 1099 LKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFN-APDSEYL 1157

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              +LS + GG+GLNL   +T+
Sbjct: 1158 CFILSTRAGGLGLNLQTADTV 1178


>UniRef50_UPI0000E4914C Cluster: PREDICTED: similar to MGC81081
           protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to MGC81081 protein -
           Strongylocentrotus purpuratus
          Length = 361

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/90 (26%), Positives = 44/90 (48%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIV 185
           L A  RW +   PI N   +M+S   FL+  P+ +  VWK L  N   T ++ +++K I+
Sbjct: 96  LEARARWAVIAYPIQNNTLEMFSFFRFLRFTPYAEYPVWKKLVTN---TEKLHTLVKGIL 152

Query: 186 LKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +    + S   P  ++  +H   +  ++R
Sbjct: 153 WRTKDQQTSNGNPIVSLPEIHNISLSSEER 182



 Score = 39.9 bits (89), Expect = 0.071
 Identities = 25/75 (33%), Positives = 37/75 (49%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++VSQ+ E L +  +               +  + R  A   FNN    +  ++L+S+
Sbjct: 249 KSVIVSQFTEMLDVVASHLSWAGFEYWSIRRAIPPKKRSEAMDDFNNNPRGRE-VMLVSL 307

Query: 724 KCGGVGLNLIGGNTL 768
           K G VGLNLIGGN L
Sbjct: 308 KAGRVGLNLIGGNHL 322


>UniRef50_UPI0000D562AE Cluster: PREDICTED: similar to Transcriptional
            regulator ATRX homolog (ATP-dependent helicase XNP)
            (X-linked nuclear protein) (dXNP) (d-xnp); n=1; Tribolium
            castaneum|Rep: PREDICTED: similar to Transcriptional
            regulator ATRX homolog (ATP-dependent helicase XNP)
            (X-linked nuclear protein) (dXNP) (d-xnp) - Tribolium
            castaneum
          Length = 1225

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 8/96 (8%)
 Frame = +1

Query: 499  TSAHLVDDILNT---SDDKIILVSQWVEYLKIFENFFKQ-----KNIATLMYTGQLKVED 654
            T   L+ DI++    +++K+++  Q++  L I E+F KQ      N+      G   VE+
Sbjct: 958  TKIKLILDIISECMRNNEKVLIFGQYLVELDIVEHFLKQFRNWRPNVDYYRMDGDTSVEN 1017

Query: 655  RILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            R +    FN+  +   ++ LL+ K GG+GLNL G N
Sbjct: 1018 RDILCKKFNS--NPTSKVFLLTHKVGGLGLNLTGAN 1051


>UniRef50_A2RUZ9 Cluster: LOC553504 protein; n=7; Danio rerio|Rep:
           LOC553504 protein - Danio rerio (Zebrafish) (Brachydanio
           rerio)
          Length = 1105

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/97 (25%), Positives = 48/97 (49%)
 Frame = +1

Query: 478 LYEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDR 657
           +Y  +++    L++  +    DK++L S   + L + E++   + +      G  K +DR
Sbjct: 437 MYSGKMKVMQKLLNHFI-AKKDKVLLFSLSTKLLDVLESYCMAEGLEYHRLDGNTKSKDR 495

Query: 658 ILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
           +     FN++ D    + L+S   GG+GLN IG N +
Sbjct: 496 VKIVKEFNSSRDV--NLCLVSTLAGGLGLNFIGANVV 530


>UniRef50_Q97EW0 Cluster: Superfamily II DNA/RNA helicase, SNF2
            family; n=1; Clostridium acetobutylicum|Rep: Superfamily
            II DNA/RNA helicase, SNF2 family - Clostridium
            acetobutylicum
          Length = 1052

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/73 (31%), Positives = 39/73 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            +I++ SQ+   LK  ++   +K+I  +   G  K++DR      FN     +  + L+S+
Sbjct: 899  RILVFSQFTSVLKSIKDKLIEKDIDVMYLDGNTKMKDRFQLADEFNKG---KGEVFLISL 955

Query: 724  KCGGVGLNLIGGN 762
            K GG GLNL G +
Sbjct: 956  KAGGTGLNLTGAD 968


>UniRef50_Q8EP30 Cluster: Helicase; n=1; Oceanobacillus iheyensis|Rep:
            Helicase - Oceanobacillus iheyensis
          Length = 1051

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/78 (26%), Positives = 41/78 (52%)
 Frame = +1

Query: 535  SDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILL 714
            ++ ++++ SQ+   L++     + K+I      G+   E+R+     FN        + L
Sbjct: 894  ANKRLLIFSQFTSMLQLIGKELRNKDILYYYIDGETPAEERVEICRAFNQG---NREVCL 950

Query: 715  LSIKCGGVGLNLIGGNTL 768
            +S+K GG GLNL+G +T+
Sbjct: 951  ISLKAGGTGLNLVGADTV 968



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 26/95 (27%), Positives = 52/95 (54%), Gaps = 1/95 (1%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIV 185
            L + +R+ +TGTP+ NK  D++S+ + +      + + +  L   ND   R    I   +
Sbjct: 740  LRSEHRFALTGTPLENKIEDIWSIFHVVFPELLGNIKDFSWL--TNDQVIR---RITPFM 794

Query: 186  LKRDKSEISFNIPKHTVEYV-HVNLMKKKKRCTIS 287
            L+R+K ++   +P   VEYV  ++L +++K+  +S
Sbjct: 795  LRREKKDVMQELPT-KVEYVERISLTEEQKQLYVS 828


>UniRef50_Q01KF9 Cluster: OSIGBa0158F05.11 protein; n=4; Oryza
           sativa|Rep: OSIGBa0158F05.11 protein - Oryza sativa
           (Rice)
          Length = 863

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 30/91 (32%), Positives = 42/91 (46%)
 Frame = +1

Query: 496 QTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETT 675
           Q  A L+  + N    ++++ SQW   L I E   +   +      G   V +R     T
Sbjct: 691 QALAELLPSLANDGH-RVLIFSQWTTMLDILEWTLEVIGVTYRRLDGGTPVTERQTIVDT 749

Query: 676 FNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
           FNN  D      LLS + GG GLNLIG +T+
Sbjct: 750 FNN--DRSIFACLLSTRAGGQGLNLIGADTV 778



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPF--NDPRVWKMLN-KNNDSTNRIKSIIKKI 182
           A  R  +TGTP+ N   +++S++ F+    F   D  + K+LN ++++  +RIKSI+   
Sbjct: 476 ARQRLMLTGTPLQNDLHELWSLLEFMMPDIFATGDIDLKKLLNAEDHELISRIKSILGPF 535

Query: 183 VLKRDKSEI 209
           +L+R KS++
Sbjct: 536 ILRRLKSDV 544


>UniRef50_Q7QIL9 Cluster: ENSANGP00000007696; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000007696 - Anopheles gambiae
           str. PEST
          Length = 469

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 28/76 (36%), Positives = 36/76 (47%)
 Frame = +1

Query: 541 DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           +KI++VS + + L +        N       G     DR      FNN A+    ILLLS
Sbjct: 318 EKIVIVSYYSKTLDMIGGLCDHYNYKYCRLDGSTAGPDRSRIVAAFNNPANDSF-ILLLS 376

Query: 721 IKCGGVGLNLIGGNTL 768
            K GG GLNLIG + L
Sbjct: 377 AKAGGAGLNLIGASRL 392


>UniRef50_Q4H3V6 Cluster: ATRX protein; n=1; Ciona intestinalis|Rep:
           ATRX protein - Ciona intestinalis (Transparent sea
           squirt)
          Length = 1086

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = +1

Query: 607 KNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           K++      G  K E R      FNN +DT+ R++L+S + GG+G+NL+G N
Sbjct: 717 KDVDYYRMDGSTKNERRKTIIDQFNNESDTRCRLMLVSTRAGGIGINLVGAN 768


>UniRef50_Q23D60 Cluster: SNF2 family N-terminal domain containing
            protein; n=2; Tetrahymena thermophila|Rep: SNF2 family
            N-terminal domain containing protein - Tetrahymena
            thermophila SB210
          Length = 1612

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/75 (34%), Positives = 40/75 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K+++ SQ+   L I   FF  K  A     G   V DR     +FN+  D++ +I LLS 
Sbjct: 1009 KMLIFSQFTMMLDIMGEFFNFKGWAFERLDGTTSVIDRQKTIDSFNSK-DSKAKIFLLST 1067

Query: 724  KCGGVGLNLIGGNTL 768
            + GG+G+NL   +T+
Sbjct: 1068 RAGGLGINLTSADTI 1082


>UniRef50_A7RMN4 Cluster: Predicted protein; n=4; Fungi/Metazoa
           group|Rep: Predicted protein - Nematostella vectensis
          Length = 1360

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 27/93 (29%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIK 176
           L   +R  +TGTP+ N   +++S++NFL+   F     + M     K     +++K ++K
Sbjct: 385 LQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAFLMEFGDLKTESQVDKLKQLLK 444

Query: 177 KIVLKRDKSEISFNI-PK-HTVEYVHVNLMKKK 269
            ++L+R K ++  NI PK  T+  V +  ++KK
Sbjct: 445 PMMLRRLKEDVEKNIAPKEETIIEVELTTVQKK 477



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     K+++ SQ V  L I E++            G+++   R  A   F+   D+   
Sbjct: 560 LKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKP-DSDRF 618

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LL  + GG+G+NL   +T+
Sbjct: 619 VFLLCTRAGGLGINLTAADTV 639


>UniRef50_A5K871 Cluster: Putative uncharacterized protein; n=2;
            Plasmodium|Rep: Putative uncharacterized protein -
            Plasmodium vivax
          Length = 1529

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 7/72 (9%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-----MLNKN--NDSTNRIK 164
            L     WC+TGTPI N  +D++ +  FL  +P+     W       +NKN  N + + ++
Sbjct: 988  LRGERNWCLTGTPIQNSIFDIFPLFRFLGIKPYGTIEWWNKEIIDYVNKNKLNLALDVVR 1047

Query: 165  SIIKKIVLKRDK 200
             I   I+L+R K
Sbjct: 1048 KISSPILLRRTK 1059



 Score = 38.3 bits (85), Expect = 0.22
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 21/114 (18%)
 Frame = +1

Query: 472  NGLYEQQV-QTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKV 648
            N +Y  ++ Q   H+ +D+ N  +  I++ SQW+ +LKI +      NI   +Y G L  
Sbjct: 1320 NFVYSTKLKQLFDHIQNDMQN--ELHIVVFSQWIGFLKIIQKLLTLHNIPNKIYDGSLTY 1377

Query: 649  EDRILAETTFN--------------------NAADTQHRILLLSIKCGGVGLNL 750
            E+R      FN                       +   ++LL S+K GGVGLNL
Sbjct: 1378 EERKTTLFWFNVQRGKVYQPGIGFTTPSSPIAVENFAGKVLLCSLKAGGVGLNL 1431


>UniRef50_Q7S6P9 Cluster: Putative uncharacterized protein
           NCU04786.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU04786.1 - Neurospora crassa
          Length = 1197

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 7/77 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK-------MLNKNNDSTNRI 161
           AL +  RWC+TGTP+ N   ++ S+I+FL+  P+++   W+          K + +  R+
Sbjct: 480 ALRSEYRWCLTGTPMQNNLDELQSLIHFLRIAPYDNLTEWRAQIDTPMKQGKGHIAIQRL 539

Query: 162 KSIIKKIVLKRDKSEIS 212
            SI++  + +R K  ++
Sbjct: 540 HSILRCFMKRRTKEVLT 556



 Score = 38.7 bits (86), Expect = 0.16
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTS--DDKIILVSQWVEYLKIFENFFKQK--NIATLMYTGQLKVEDR 657
            Q+ +  H +  IL       K I+ SQ+   L + E F +    +I  + Y G++  + R
Sbjct: 960  QISSKIHELIAILRREAPTHKFIVFSQFTSMLDLVEPFLRHHLPDIKHVRYDGKMSNDAR 1019

Query: 658  ILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
              +  +     D + RILL S+KCG +GLNL
Sbjct: 1020 EASLHSLRK--DPRTRILLCSLKCGSLGLNL 1048


>UniRef50_Q7RYI6 Cluster: Putative uncharacterized protein NCU06488.1;
            n=5; Pezizomycotina|Rep: Putative uncharacterized protein
            NCU06488.1 - Neurospora crassa
          Length = 1455

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/75 (33%), Positives = 40/75 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            ++++  Q    + I E+F + + I  L   G  K EDR      FN A D+ + + LLS 
Sbjct: 849  RVLMFFQMTAIMDIMEDFLRFRGIQYLRLDGTTKAEDRSELLRLFN-APDSPYFMFLLST 907

Query: 724  KCGGVGLNLIGGNTL 768
            + GG+GLNL   +T+
Sbjct: 908  RAGGLGLNLQTADTV 922


>UniRef50_Q6BSL5 Cluster: Similar to CA0917|CaRAD16 Candida albicans
           CaRAD16; n=1; Debaryomyces hansenii|Rep: Similar to
           CA0917|CaRAD16 Candida albicans CaRAD16 - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 456

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 15/29 (51%), Positives = 23/29 (79%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFN 107
           +WC+TGTP+ N+  +MYS+I FL+  PF+
Sbjct: 379 KWCLTGTPLQNRIGEMYSLIRFLKLEPFH 407


>UniRef50_Q2H1X5 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 450

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 9/77 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP---RVW------KMLNKNNDSTNR 158
           L A +RWC+TGTPI NK  D+ ++  F++  PF      R W      + L  +    NR
Sbjct: 31  LHANSRWCLTGTPIQNKLADIGALFAFIRAEPFTRASVFRKWIEIPFEQSLENSTAVKNR 90

Query: 159 IKSIIKKIVLKRDKSEI 209
           +  +++ + L+R K  +
Sbjct: 91  LVMLLEALCLRRTKDAV 107


>UniRef50_A7F1B3 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1301

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 12/80 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFN----DPRVWKMLNKNNDS-------T 152
           L A  R+C+TGTP+ N   ++YS+I FL+ RP+N      + +  L+K + S        
Sbjct: 728 LRALTRFCLTGTPMMNNITELYSLIKFLRIRPYNIWHSFVKDFGCLSKGSYSDEHIQITM 787

Query: 153 NRIKSIIKKIVLKR-DKSEI 209
            R++ ++K I+L+R  KSEI
Sbjct: 788 QRLQGVLKAILLRRTKKSEI 807



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 24/77 (31%), Positives = 38/77 (49%)
 Frame = +1

Query: 532  TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
            T  +K I+ SQ+V +L + +    +K      Y G +  + R  A   F N  D    I+
Sbjct: 1145 TEGEKTIIFSQFVTFLDLLQVPIGEKGWKCERYDGSINAKRRDDAIKQFTNKPDC--NIM 1202

Query: 712  LLSIKCGGVGLNLIGGN 762
            L+S+K G  GLNL+  +
Sbjct: 1203 LISLKAGNAGLNLVAAS 1219



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F+++E   Y+ L+ +++  + K   A     T+ +     ++L L+L+LRQ CCHP+L
Sbjct: 827 FSKDEWEFYESLRDKTQLQFNKYRKA----GTVGK--NYSNILVLLLRLRQCCCHPHL 878


>UniRef50_A7E474 Cluster: Putative uncharacterized protein; n=2;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 1103

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKN-IATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
           K +L SQ V+ L I E F K+      L   G   ++DR      FNN  D    + LL+
Sbjct: 775 KTLLFSQGVQMLDILEEFVKKLGGFNYLRMDGGTAIKDRQTLVDQFNN--DPNMHVFLLT 832

Query: 721 IKCGGVGLNLIGGN 762
            K GG+G+NL G N
Sbjct: 833 TKVGGLGVNLTGAN 846


>UniRef50_A6SHP4 Cluster: Putative uncharacterized protein; n=2;
            Sclerotiniaceae|Rep: Putative uncharacterized protein -
            Botryotinia fuckeliana B05.10
          Length = 1607

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 25/81 (30%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     + ++ +Q  + L I E F        L   G  K+E R +    FNN  DT+  
Sbjct: 1298 LQAGGHRALIFTQMTKVLDILEQFLNIHGHKYLRLDGATKIEQRQILTDRFNN--DTRIL 1355

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              +LS + GG+G+NL G +T+
Sbjct: 1356 AFILSSRSGGLGINLTGADTV 1376


>UniRef50_A6RUI4 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 917

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           ++ +KI++VS +   L +  +     N+  L   G      R     TFN    +++   
Sbjct: 614 STTEKIVIVSNYTSTLDLLVSHLSSLNLPFLRLDGSTPQAKRQDLVNTFNKTPASKYFAF 673

Query: 712 LLSIKCGGVGLNLIGGNTL 768
           LLS K GG G+NLIG + L
Sbjct: 674 LLSAKSGGAGINLIGASRL 692


>UniRef50_Q9H4L7 Cluster: SWI/SNF-related matrix-associated
            actin-dependent regulator of chromatin subfamily A
            containing DEAD/H box 1; n=32; Eumetazoa|Rep:
            SWI/SNF-related matrix-associated actin-dependent
            regulator of chromatin subfamily A containing DEAD/H box
            1 - Homo sapiens (Human)
          Length = 1026

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    D+++L SQ+   L I E   K      L   G+ ++ +RI     FN   D    
Sbjct: 866  LKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIF-- 923

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG+G+NL   N +
Sbjct: 924  VFLLSTKAGGLGINLTSANVV 944



 Score = 37.5 bits (83), Expect = 0.38
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 13/86 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDP-----RVWKMLNKNNDSTN----- 155
           + A NR  +TGTP+ N   ++ S++NF+    F+       R++    K+ D  +     
Sbjct: 647 INANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKE 706

Query: 156 RI---KSIIKKIVLKRDKSEISFNIP 224
           RI   K IIK  +L+R K E+   +P
Sbjct: 707 RIAHAKQIIKPFILRRVKEEVLKQLP 732


>UniRef50_P32849 Cluster: DNA repair protein RAD5; n=4;
           Saccharomycetales|Rep: DNA repair protein RAD5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 1169

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 7/73 (9%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKN-NDSTNRI 161
           AL    +W +TGTPI N+  D+YS++ FL+  P+     WK        +KN   + + +
Sbjct: 699 ALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWRQINYWKTFVSTPFESKNYKQAFDVV 758

Query: 162 KSIIKKIVLKRDK 200
            +I++ ++L+R K
Sbjct: 759 NAILEPVLLRRTK 771



 Score = 43.6 bits (98), Expect = 0.006
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 4/78 (5%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQ---KNIATLM-YTGQLKVEDRILAETTFNNAADT 696
            +++ +++++ SQ+  YL I E        K++A +  + G+L +++R      F     +
Sbjct: 1009 SSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYS 1068

Query: 697  QHRILLLSIKCGGVGLNL 750
            + +ILLLS+K GGVGLNL
Sbjct: 1069 RQKILLLSLKAGGVGLNL 1086


>UniRef50_UPI0000F2008D Cluster: PREDICTED: similar to Rad54b; n=1;
            Danio rerio|Rep: PREDICTED: similar to Rad54b - Danio
            rerio
          Length = 1067

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/76 (35%), Positives = 39/76 (51%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            D+++LVS   + L + ++   Q         GQ  V  R     +FN+   +   +LLLS
Sbjct: 816  DRVVLVSNHTQTLDLLQDVCDQIGYKWCRLDGQTPVGQRQKIVDSFNSPHSSSF-LLLLS 874

Query: 721  IKCGGVGLNLIGGNTL 768
             K GGVGLNLIG + L
Sbjct: 875  SKAGGVGLNLIGASHL 890


>UniRef50_UPI00015A5AC0 Cluster: UPI00015A5AC0 related cluster; n=2;
            Danio rerio|Rep: UPI00015A5AC0 UniRef100 entry - Danio
            rerio
          Length = 2014

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/96 (28%), Positives = 43/96 (44%)
 Frame = +1

Query: 481  YEQQVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRI 660
            Y+     + HL+   L     ++++ +Q    L + E F        L   G  +VE R 
Sbjct: 1655 YDSGKLQTLHLLLRRLKAEGHRVLIFTQMTRMLDVLEQFLNYHGHIYLRLDGSTRVEQRQ 1714

Query: 661  LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
                 FN  AD +    +LS + GGVG+NL G +T+
Sbjct: 1715 ALMDRFN--ADRRIFCFILSTRSGGVGVNLTGADTV 1748



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 13/97 (13%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------ML----NKNNDSTNRI 161
           R  +TGTP+ N   +++S+++FL    F   R +K         M+      N     R+
Sbjct: 702 RLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRL 761

Query: 162 KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             +++  +L+R K+++   +PK     V   L K+++
Sbjct: 762 HKVLRPFLLRRIKADVEKQMPKKYEHVVRCRLSKRQR 798


>UniRef50_Q14MF0 Cluster: Hypothetical dna/rna helicase protein; n=1;
            Spiroplasma citri|Rep: Hypothetical dna/rna helicase
            protein - Spiroplasma citri
          Length = 1098

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 26/83 (31%), Positives = 41/83 (49%)
 Frame = +1

Query: 520  DILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
            D L  S  KI++ SQ+   LK  +   ++  +      G+ + E R+L    FN   D  
Sbjct: 937  DDLAGSGHKILIFSQFTTVLKRIKAIVEEIGLQYFYLDGKTRSESRVLMTEKFNE--DKI 994

Query: 700  HRILLLSIKCGGVGLNLIGGNTL 768
              + L+S+K GGVGLNL   + +
Sbjct: 995  INVFLISLKAGGVGLNLTAADVV 1017


>UniRef50_A5G9S7 Cluster: Non-specific serine/threonine protein
            kinase; n=1; Geobacter uraniumreducens Rf4|Rep:
            Non-specific serine/threonine protein kinase - Geobacter
            uraniumreducens Rf4
          Length = 1164

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = +1

Query: 511  LVDDILNTSDD--KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNN 684
            L D++L   D+    ++ SQ+  YL + E   KQ+ +ATL   G   V  R      F  
Sbjct: 999  LADNLLELRDEGHSALVFSQFTSYLDLVEEGLKQRGLATLRLDGSTPVPRRKELVRQFQQ 1058

Query: 685  AADTQHRILLLSIKCGGVGLNL 750
            + +    + L+S+K GG GLNL
Sbjct: 1059 SEEP--LVFLISLKAGGKGLNL 1078


>UniRef50_Q5CVY6 Cluster: Brahma like protein with a HSA domain, SNF2
            like helicase and a bromo domain; n=2;
            Cryptosporidium|Rep: Brahma like protein with a HSA
            domain, SNF2 like helicase and a bromo domain -
            Cryptosporidium parvum Iowa II
          Length = 1673

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/81 (30%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ  + L + E F   +N+  L   G    EDR  +   FN A ++ + 
Sbjct: 1071 LRAAGHRVLIFSQMTKLLTLLEVFLSLRNMPFLRLDGTTLSEDRQESLKLFN-AENSPYF 1129

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS K GG G+NL   +T+
Sbjct: 1130 VFLLSTKAGGFGINLQSADTV 1150


>UniRef50_Q5CVU2 Cluster: SNF2L ortholog with a SWI/SNF2 like ATpase
           and a Myb domain; n=2; Cryptosporidium|Rep: SNF2L
           ortholog with a SWI/SNF2 like ATpase and a Myb domain -
           Cryptosporidium parvum Iowa II
          Length = 1308

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 28/99 (28%), Positives = 54/99 (54%), Gaps = 9/99 (9%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML--NKNNDSTNRIKSIIKK 179
           L + NR  ITGTP+ N   +++S++NFL    F+    ++ L      +S ++ K +IK 
Sbjct: 357 LKSKNRLLITGTPLQNNLRELWSLLNFLMPNLFSSSEDFESLFDFSKLESDDQQKCVIKT 416

Query: 180 I-------VLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           +       +L+R K+++  ++P     YV++ L K +K+
Sbjct: 417 LHQILRPFMLRRLKADVERDLPPKRELYVYIGLSKLQKK 455


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 763,393,909
Number of Sequences: 1657284
Number of extensions: 15020864
Number of successful extensions: 47520
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 44045
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47326
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 67085240885
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -