SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P24655 Cluster: Uncharacterized Bro-N domain-containing...   143   3e-33
UniRef50_Q9YML3 Cluster: Uncharacterized Bro-N domain-containing...   134   2e-30
UniRef50_Q287E9 Cluster: BRO-D; n=3; unclassified Nucleopolyhedr...   116   7e-25
UniRef50_Q0N3Z7 Cluster: BRO-B; n=13; Nucleopolyhedrovirus|Rep: ...   108   1e-22
UniRef50_Q287M2 Cluster: BRO-A; n=1; Agrotis segetum nucleopolyh...   107   2e-22
UniRef50_A1YJ59 Cluster: BRO; n=1; Spodoptera frugiperda MNPV|Re...    94   3e-18
UniRef50_Q06KR1 Cluster: Baculovirus repeated ORF-a; n=6; Nucleo...    84   3e-15
UniRef50_Q0IL61 Cluster: Bro-e; n=1; Leucania separata nuclear p...    83   5e-15
UniRef50_Q9E231 Cluster: Orf60-like protien; n=14; Baculoviridae...    64   4e-09
UniRef50_Q9PYR4 Cluster: ORF131; n=1; Xestia c-nigrum granulovir...    63   7e-09
UniRef50_A4KXK3 Cluster: Bro17; n=2; Heliothis virescens ascovir...    51   2e-05
UniRef50_Q8QLB2 Cluster: BRO-f; n=4; Nucleopolyhedrovirus|Rep: B...    50   4e-05
UniRef50_Q8QLB1 Cluster: BRO-g; n=3; Nucleopolyhedrovirus|Rep: B...    49   1e-04
UniRef50_Q99GY7 Cluster: Bro; n=27; root|Rep: Bro - Helicoverpa ...    46   9e-04
UniRef50_A5IZW6 Cluster: Bro-5; n=2; Spodoptera litura granulovi...    46   0.001
UniRef50_Q9PYR5 Cluster: ORF130; n=1; Xestia c-nigrum granulovir...    45   0.002
UniRef50_Q4KT11 Cluster: BRO-B; n=2; Nucleopolyhedrovirus|Rep: B...    45   0.002
UniRef50_A5IZQ5 Cluster: Bro-2; n=1; Spodoptera litura granulovi...    45   0.002
UniRef50_A3HNE6 Cluster: BRO domain protein domain protein; n=1;...    44   0.003
UniRef50_Q0IKW6 Cluster: Bro-i; n=3; dsDNA viruses, no RNA stage...    44   0.005
UniRef50_Q0I4I5 Cluster: Putative uncharacterized protein; n=2; ...    44   0.005
UniRef50_A4XBY6 Cluster: BRO domain protein domain protein; n=2;...    43   0.006
UniRef50_Q5UP77 Cluster: Uncharacterized Bro-N domain-containing...    43   0.006
UniRef50_Q919R4 Cluster: CUN001 putative bro protein, ATP_GTP_A ...    43   0.008
UniRef50_Q4KT25 Cluster: BRO-A; n=3; root|Rep: BRO-A - Chrysodei...    43   0.008
UniRef50_Q06KD3 Cluster: Baculovirus repeated ORF; n=1; Anticars...    43   0.008
UniRef50_A4KXK8 Cluster: Bro20; n=1; Heliothis virescens ascovir...    43   0.008
UniRef50_Q7N339 Cluster: Similar to bacteriophage protein; n=2; ...    43   0.008
UniRef50_Q2L2E4 Cluster: Phage protein; n=1; Bordetella avium 19...    42   0.011
UniRef50_A7LYR8 Cluster: Putative uncharacterized protein; n=2; ...    42   0.011
UniRef50_A4P0J2 Cluster: Possible prophage antirepressor; n=1; H...    42   0.011
UniRef50_A4KXE7 Cluster: Bro9; n=1; Heliothis virescens ascoviru...    42   0.015
UniRef50_Q47HX8 Cluster: BRO, N-terminal; n=1; Dechloromonas aro...    42   0.015
UniRef50_Q3Y2L0 Cluster: BRO, N-terminal; n=1; Enterococcus faec...    42   0.015
UniRef50_A4TYQ8 Cluster: BRO, N-terminal; n=1; Magnetospirillum ...    41   0.026
UniRef50_Q919G9 Cluster: CUN108 putative bro protein, ATP_GTP_A ...    41   0.034
UniRef50_Q1J4V4 Cluster: Phage antirepressor protein; n=1; Strep...    41   0.034
UniRef50_A0A7D8 Cluster: Prophage antirepressor; n=1; Cyanophage...    41   0.034
UniRef50_Q9PYY1 Cluster: ORF62; n=1; Xestia c-nigrum granuloviru...    40   0.045
UniRef50_Q185G9 Cluster: Putative phage-related regulatory prote...    40   0.045
UniRef50_A1AN22 Cluster: BRO domain protein domain protein; n=1;...    40   0.045
UniRef50_P44189 Cluster: Uncharacterized protein HI1418; n=8; Pa...    40   0.045
UniRef50_Q8QLL3 Cluster: BRO-a; n=1; Mamestra configurata NPV-A|...    40   0.059
UniRef50_Q8G2Q7 Cluster: BRO family protein; n=3; Brucella|Rep: ...    40   0.059
UniRef50_A6PK75 Cluster: BRO domain protein; n=1; Victivallis va...    40   0.059
UniRef50_A5MYH6 Cluster: Predicted prophage antirepressor; n=1; ...    40   0.059
UniRef50_A3QSE3 Cluster: Putative antirepressor; n=1; Clostridiu...    40   0.059
UniRef50_Q3J623 Cluster: Putative uncharacterized protein; n=1; ...    40   0.078
UniRef50_Q03FD4 Cluster: Uncharacterized phage-encoded protein; ...    40   0.078
UniRef50_A6NXW4 Cluster: Putative uncharacterized protein; n=1; ...    40   0.078
UniRef50_Q65PV1 Cluster: Lj965 prophage antirepressor; n=4; root...    39   0.10 
UniRef50_A7A2N3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.10 
UniRef50_A6NWY1 Cluster: Putative uncharacterized protein; n=1; ...    39   0.10 
UniRef50_A3M6B7 Cluster: Putative uncharacterized protein; n=1; ...    39   0.10 
UniRef50_Q80LR2 Cluster: Baculovirus repeated ORF; n=1; Adoxophy...    39   0.14 
UniRef50_Q92FM4 Cluster: Lin0080 protein; n=14; root|Rep: Lin008...    39   0.14 
UniRef50_Q8FRD3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.14 
UniRef50_Q5F6A8 Cluster: Putative uncharacterized protein; n=2; ...    39   0.14 
UniRef50_Q7Y4K9 Cluster: Gp15; n=9; root|Rep: Gp15 - Streptococc...    39   0.14 
UniRef50_UPI0000397D5D Cluster: COG3617: Prophage antirepressor;...    38   0.18 
UniRef50_Q8QNG2 Cluster: EsV-1-117; n=1; Ectocarpus siliculosus ...    38   0.18 
UniRef50_A0RLT8 Cluster: Antirepressor, phage associated; n=3; B...    38   0.18 
UniRef50_A5IZL9 Cluster: Bro-1; n=1; Spodoptera litura granulovi...    38   0.24 
UniRef50_A3DI85 Cluster: BRO-like protein; n=1; Clostridium ther...    38   0.24 
UniRef50_Q8W644 Cluster: Putative uncharacterized protein; n=2; ...    38   0.24 
UniRef50_A6N1W8 Cluster: Putative uncharacterized protein; n=1; ...    38   0.24 
UniRef50_Q9YVP8 Cluster: ORF MSV194 ALI motif gene family protei...    38   0.32 
UniRef50_Q9YML4 Cluster: Ld-bro-i; n=1; Lymantria dispar MNPV|Re...    38   0.32 
UniRef50_Q9PAJ2 Cluster: Phage-related protein; n=22; Gammaprote...    37   0.42 
UniRef50_Q30XK5 Cluster: Prophage antirepressor-like; n=2; Desul...    37   0.42 
UniRef50_Q0SWM4 Cluster: BRO family, N-terminal domain protein; ...    37   0.42 
UniRef50_A6TLJ8 Cluster: Prophage antirepressor; n=5; root|Rep: ...    37   0.42 
UniRef50_A3VVX0 Cluster: Hypothetical BRO family protein; n=1; R...    37   0.42 
UniRef50_Q9YMQ6 Cluster: Ld-bro-c; n=6; dsDNA viruses, no RNA st...    37   0.55 
UniRef50_Q91FW9 Cluster: 201R; n=2; Invertebrate iridescent viru...    37   0.55 
UniRef50_Q8QLL0 Cluster: BRO-b; n=2; Nucleopolyhedrovirus|Rep: B...    37   0.55 
UniRef50_Q6NK48 Cluster: Putative anti-repressor protein; n=3; C...    37   0.55 
UniRef50_Q47D43 Cluster: BRO family protein; n=1; Dechloromonas ...    37   0.55 
UniRef50_A0VJ08 Cluster: BRO-like; n=1; Delftia acidovorans SPH-...    37   0.55 
UniRef50_Q8JM96 Cluster: Putative uncharacterized protein; n=1; ...    36   0.73 
UniRef50_Q4KT10 Cluster: BRO-C; n=1; Chrysodeixis chalcites nucl...    36   0.73 
UniRef50_Q197E1 Cluster: Putative uncharacterized protein; n=1; ...    36   0.73 
UniRef50_Q1A0E0 Cluster: Gp77; n=1; Mycobacterium phage Che12|Re...    36   0.73 
UniRef50_Q91BW9 Cluster: Bro-a; n=3; Nucleopolyhedrovirus|Rep: B...    36   0.96 
UniRef50_A6LVQ3 Cluster: Prophage antirepressor; n=3; root|Rep: ...    36   0.96 
UniRef50_A7IY79 Cluster: Putative antirepressor; n=1; Corynebact...    36   0.96 
UniRef50_Q84IK9 Cluster: Antirepressor protein; n=1; Clostridium...    36   1.3  
UniRef50_A3X9C1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_A0QB24 Cluster: Gp54 protein; n=2; Mycobacterium avium ...    36   1.3  
UniRef50_A5YK15 Cluster: Gp47; n=3; unclassified Siphoviridae|Re...    36   1.3  
UniRef50_Q06VQ4 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q8D9R6 Cluster: Prophage antirepressor; n=1; Vibrio vul...    35   1.7  
UniRef50_Q6AC67 Cluster: Prophage antirepressor protein; n=2; Le...    35   1.7  
UniRef50_Q5L2M6 Cluster: Phage associated-antirepressor; n=4; ro...    35   1.7  
UniRef50_A3DG82 Cluster: BRO-like protein; n=1; Clostridium ther...    35   1.7  
UniRef50_A3DFZ3 Cluster: BRO-like protein; n=1; Clostridium ther...    34   2.9  
UniRef50_A1AE06 Cluster: Putative anti-repressor protein; n=3; r...    34   3.9  
UniRef50_A5ZCZ9 Cluster: Putative uncharacterized protein; n=1; ...    34   3.9  
UniRef50_Q0IL00 Cluster: Bro-f; n=1; Leucania separata nuclear p...    33   5.1  
UniRef50_Q8YHA3 Cluster: PHAGE-RELATED DNA BINDING PROTEIN; n=4;...    33   5.1  
UniRef50_Q3JTQ5 Cluster: BRO family, N-terminal domain protein; ...    33   5.1  
UniRef50_A1FKV6 Cluster: BRO-like; n=1; Pseudomonas putida W619|...    33   5.1  
UniRef50_Q37938 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_Q4KA85 Cluster: Probable phage protein YPO2126; n=1; Ps...    33   6.8  
UniRef50_A5I4G4 Cluster: BRO family protein; n=1; Clostridium bo...    33   9.0  
UniRef50_Q4ZAE4 Cluster: ORF018; n=4; Staphylococcus phage 53 se...    33   9.0  
UniRef50_Q54LT3 Cluster: Putative uncharacterized protein; n=1; ...    33   9.0  
UniRef50_A7ESI7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.0  

>UniRef50_P24655 Cluster: Uncharacterized Bro-N domain-containing
           protein ORF2; n=12; Nucleopolyhedrovirus|Rep:
           Uncharacterized Bro-N domain-containing protein ORF2 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 328

 Score =  143 bits (347), Expect = 3e-33
 Identities = 67/72 (93%), Positives = 71/72 (98%)
 Frame = +2

Query: 260 NSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPA 439
           NSV K+GDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPA
Sbjct: 72  NSVVKRGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPA 131

Query: 440 IKQQEEKNKQLV 475
           IKQ+EE++KQLV
Sbjct: 132 IKQREEESKQLV 143



 Score =  138 bits (334), Expect = 1e-31
 Identities = 86/220 (39%), Positives = 116/220 (52%), Gaps = 1/220 (0%)
 Frame = +3

Query: 42  MAQVKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKYT 221
           MA+VKIG+FKFG+DTF LRYVLE+ + QV+FVAKD+A+SLKY  C  A+  HVD KYK  
Sbjct: 1   MARVKIGEFKFGEDTFNLRYVLER-DQQVRFVAKDVANSLKYTVCDKAIRVHVDNKYKSL 59

Query: 222 YSESGARLPPSLQTAWQSKAIRCICSRIQCLLLNRA*FN*L*RASFRTP*NYKNGF*KK* 401
           + ++     P+  +    +           L+        + ++        +    ++ 
Sbjct: 60  FEQTIQNGGPTSNSV-VKRGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEV 118

Query: 402 FLKCYARASTTPQLNNRRKRTNSW*LXXLRHLPSTQRAARVV-AQKTEELFKKQEFIERX 578
             +        P +  R + +       +        A + V AQKTEEL KKQEFIER 
Sbjct: 119 IPQVLCTGKYDPAIKQREEESKQLVTKLIATFTEHTNALQAVVAQKTEELVKKQEFIERI 178

Query: 579 XXXXXXXXXXXXLQVTRVMTDLNRMYTGFQETMQRKDEMM 698
                       LQVTRVMTDLNRMYTGFQETMQ+KDE+M
Sbjct: 179 VAIKDKQIEAKDLQVTRVMTDLNRMYTGFQETMQKKDEIM 218


>UniRef50_Q9YML3 Cluster: Uncharacterized Bro-N domain-containing
           protein J; n=1; Lymantria dispar MNPV|Rep:
           Uncharacterized Bro-N domain-containing protein J -
           Lymantria dispar multicapsid nuclear polyhedrosis virus
           (LdMNPV)
          Length = 403

 Score =  134 bits (324), Expect = 2e-30
 Identities = 60/74 (81%), Positives = 68/74 (91%)
 Frame = +2

Query: 251 LAPNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           LA N++AKQGDPLYL PHTVL+TK GVIQLIMKSKLPYA+ELQ WLLEEVIPQVLCTGKY
Sbjct: 69  LASNALAKQGDPLYLHPHTVLVTKEGVIQLIMKSKLPYAVELQAWLLEEVIPQVLCTGKY 128

Query: 431 DPAIKQQEEKNKQL 472
           DPAIK Q+E+ K++
Sbjct: 129 DPAIKHQQEETKRM 142



 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 47/67 (70%), Positives = 53/67 (79%)
 Frame = +3

Query: 42  MAQVKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKYT 221
           M+QVKIGQFKFGQDTFTLRYVL  G  QVKFVAKDIAS+LK+ NC +AV +HVD KYK T
Sbjct: 1   MSQVKIGQFKFGQDTFTLRYVLG-GEQQVKFVAKDIASNLKHANCAEAVRKHVDGKYKST 59

Query: 222 YSESGAR 242
           +     R
Sbjct: 60  FEHGEIR 66



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 21/26 (80%), Positives = 25/26 (96%)
 Frame = +3

Query: 621 VTRVMTDLNRMYTGFQETMQRKDEMM 698
           VTRVMTDLNRMY+ FQ+TMQRKD++M
Sbjct: 193 VTRVMTDLNRMYSSFQDTMQRKDDIM 218


>UniRef50_Q287E9 Cluster: BRO-D; n=3; unclassified
           Nucleopolyhedrovirus|Rep: BRO-D - Agrotis segetum
           nuclear polyhedrosis virus (AsNPV)
          Length = 336

 Score =  116 bits (278), Expect = 7e-25
 Identities = 51/57 (89%), Positives = 56/57 (98%)
 Frame = +2

Query: 272 KQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAI 442
           K+G+PLYLQPHT+LITKSGVIQLIMKSKLPYA+ELQEWLLEEVIPQVLCTGKY PA+
Sbjct: 86  KKGNPLYLQPHTILITKSGVIQLIMKSKLPYAVELQEWLLEEVIPQVLCTGKYQPAV 142



 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 37/67 (55%), Positives = 49/67 (73%)
 Frame = +3

Query: 42  MAQVKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKYT 221
           MAQVKIG FKFG+D F LRYV++  + QV FV KDIA  LKY +CK A+ +HV++KYK  
Sbjct: 1   MAQVKIGVFKFGEDEFELRYVVDN-DMQVLFVGKDIARVLKYNDCKQAIHKHVNEKYKCV 59

Query: 222 YSESGAR 242
           + + G +
Sbjct: 60  FEKMGGQ 66



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 18/26 (69%), Positives = 23/26 (88%)
 Frame = +3

Query: 621 VTRVMTDLNRMYTGFQETMQRKDEMM 698
           + RVM D+NRMYTGFQ+TMQ+KDE +
Sbjct: 188 INRVMADMNRMYTGFQQTMQKKDEQV 213


>UniRef50_Q0N3Z7 Cluster: BRO-B; n=13; Nucleopolyhedrovirus|Rep:
           BRO-B - Clanis bilineata nucleopolyhedrosis virus
          Length = 339

 Score =  108 bits (260), Expect = 1e-22
 Identities = 48/61 (78%), Positives = 54/61 (88%)
 Frame = +2

Query: 275 QGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQE 454
           +GD LYLQPHT+LITK GVIQLIMKSKLPYA+ELQ WLLEEVIPQVLCTGKY PA++   
Sbjct: 76  KGDSLYLQPHTILITKEGVIQLIMKSKLPYAVELQAWLLEEVIPQVLCTGKYAPAVEMDT 135

Query: 455 E 457
           +
Sbjct: 136 D 136



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 39/58 (67%), Positives = 46/58 (79%)
 Frame = +3

Query: 51  VKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKYTY 224
           VKIG FKFG+DTF LRYV+E+    VKFVAKD+AS+LK+ N K AV  HVD+KYK TY
Sbjct: 5   VKIGNFKFGEDTFRLRYVVER--EIVKFVAKDVASNLKHQNTKKAVKDHVDEKYKSTY 60


>UniRef50_Q287M2 Cluster: BRO-A; n=1; Agrotis segetum
           nucleopolyhedrovirus|Rep: BRO-A - Agrotis segetum
           nuclear polyhedrosis virus (AsNPV)
          Length = 324

 Score =  107 bits (258), Expect = 2e-22
 Identities = 49/74 (66%), Positives = 57/74 (77%)
 Frame = +2

Query: 236 GETTALAPNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVL 415
           G   ++    + K+G PL+L   T+LITKSGVIQLIMKSKLPYA+ELQEWLLEEVIPQVL
Sbjct: 79  GVEVSIIKKDLIKKGHPLFLYDQTILITKSGVIQLIMKSKLPYAVELQEWLLEEVIPQVL 138

Query: 416 CTGKYDPAIKQQEE 457
           CTGKY PA+    E
Sbjct: 139 CTGKYQPAVANNSE 152



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 42/69 (60%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query: 42  MAQVKIGQFKFGQDTFTLRYVLEQGNPQ-VKFVAKDIASSLKYGNCKDAVSRHVDKKYKY 218
           M QVKIG FKFG+D F LRYV+  GN + V FVAKDIAS LKY    +AV++HVDKKYK 
Sbjct: 1   MPQVKIGVFKFGEDKFKLRYVV--GNDKDVLFVAKDIASVLKYEKPANAVAKHVDKKYKC 58

Query: 219 TYSESGARL 245
            + E G R+
Sbjct: 59  YFLEKGPRI 67


>UniRef50_A1YJ59 Cluster: BRO; n=1; Spodoptera frugiperda MNPV|Rep:
           BRO - Spodoptera frugiperda nuclear polyhedrosis virus
           (SfNPV)
          Length = 334

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 42/58 (72%), Positives = 47/58 (81%)
 Frame = +2

Query: 287 LYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEK 460
           LY+ P T++I KSGVIQLIMKSKL YA+ELQEW+ EEVIPQVLCTGKY P     EEK
Sbjct: 89  LYVHPQTIMINKSGVIQLIMKSKLSYAVELQEWMFEEVIPQVLCTGKYSPQAALTEEK 146



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 35/75 (46%), Positives = 44/75 (58%)
 Frame = +3

Query: 42  MAQVKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKYT 221
           MA VKI  FKFG +   LRYV+   N +V FV KDIA+ LKY N K A+  HVD KYK  
Sbjct: 1   MASVKINLFKFGDEEIELRYVIGD-NDEVFFVGKDIATMLKYENTKKAIIDHVDDKYKIA 59

Query: 222 YSESGARLPPSLQTA 266
           + +    +P  +  A
Sbjct: 60  FGDIKTLMPSVIVNA 74


>UniRef50_Q06KR1 Cluster: Baculovirus repeated ORF-a; n=6;
           Nucleopolyhedrovirus|Rep: Baculovirus repeated ORF-a -
           Anticarsia gemmatalis nuclear polyhedrosis virus
           (AgMNPV)
          Length = 243

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 43/63 (68%), Positives = 50/63 (79%)
 Frame = +3

Query: 42  MAQVKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYKYT 221
           MAQVKIGQFKFG+DTFTLRYVL++    VKFVAKDIASSL Y    +AV ++VD KYK T
Sbjct: 1   MAQVKIGQFKFGEDTFTLRYVLDK--DIVKFVAKDIASSLGYEKFSNAVKKYVDIKYKST 58

Query: 222 YSE 230
           Y +
Sbjct: 59  YGD 61



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 26/48 (54%), Positives = 36/48 (75%)
 Frame = +2

Query: 272 KQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVL 415
           K+GD LYLQPHT+L++  GV+QLI +SK+P A E Q+W  + V+P  L
Sbjct: 69  KRGDLLYLQPHTILLSNIGVLQLISRSKMPNAAEFQDWFYDHVLPACL 116


>UniRef50_Q0IL61 Cluster: Bro-e; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: Bro-e - Leucania separata
           nuclear polyhedrosis virus (LsNPV)
          Length = 354

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 39/46 (84%), Positives = 41/46 (89%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           L P TVLI KSGVIQLIM SKLPYA+ELQEWLLEEVIPQVL TG+Y
Sbjct: 105 LHPQTVLINKSGVIQLIMHSKLPYAVELQEWLLEEVIPQVLSTGRY 150



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 29/59 (49%), Positives = 37/59 (62%)
 Frame = +3

Query: 39  KMAQVKIGQFKFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYK 215
           KM  V +  FKFG  T  LRY ++Q N  V FV +DIA  LKY   +DA+ +HV+ KYK
Sbjct: 27  KMCTVVVRDFKFGDITMRLRYTIDQDNC-VWFVGRDIAKLLKYQRTQDAIKKHVNVKYK 84


>UniRef50_Q9E231 Cluster: Orf60-like protien; n=14;
           Baculoviridae|Rep: Orf60-like protien - Helicoverpa zea
           SNPV
          Length = 501

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 29/56 (51%), Positives = 40/56 (71%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQ 451
           PL  QP+T+ IT++G+  LIM+SKLP A E Q WL EEV+P++  TGKY    ++Q
Sbjct: 77  PLNWQPNTLFITEAGIYALIMRSKLPAAEEFQSWLFEEVLPELRRTGKYSIENRRQ 132


>UniRef50_Q9PYR4 Cluster: ORF131; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF131 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 442

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 29/50 (58%), Positives = 38/50 (76%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           P   QP+TV IT++GV  LI+KSKLP A + Q+WL EEV+P++  TGKYD
Sbjct: 60  PANWQPNTVFITEAGVWALIIKSKLPAAEKFQKWLFEEVLPELRRTGKYD 109


>UniRef50_A4KXK3 Cluster: Bro17; n=2; Heliothis virescens ascovirus
           3e|Rep: Bro17 - Heliothis virescens ascovirus 3e
          Length = 502

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           P   QP+TV IT+  + +L  KS LP A E Q+W+ EEV+P +  TG Y+
Sbjct: 79  PANWQPNTVFITEPAIYKLCTKSTLPEAEEFQDWIYEEVLPTIRRTGGYN 128


>UniRef50_Q8QLB2 Cluster: BRO-f; n=4; Nucleopolyhedrovirus|Rep:
           BRO-f - Mamestra configurata NPV-A
          Length = 357

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +3

Query: 525 VAQKTEELFKKQEFIERXXXXXXXXXXXXXL----QVTRVMTDLNRMYTGFQETMQRKDE 692
           + +K E+L + Q+ +++             +    Q+ RVM D+NRMYTGFQ+TMQ+KDE
Sbjct: 166 IVRKDEQLHENQQMMQKICAEKDELIQKIVVHKDQQINRVMADMNRMYTGFQDTMQKKDE 225

Query: 693 MM 698
           ++
Sbjct: 226 IL 227



 Score = 41.9 bits (94), Expect = 0.015
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 2/46 (4%)
 Frame = +2

Query: 299 PHTVLITKSGVIQLIMKSKLP-YAIE-LQEWLLEEVIPQVLCTGKY 430
           PHTV + + G+ Q+I+ SKL    +E  ++W+ EEV+P +  TG+Y
Sbjct: 80  PHTVFVNEPGLYQMILSSKLKNNRVEPFKKWVFEEVLPTIRKTGQY 125


>UniRef50_Q8QLB1 Cluster: BRO-g; n=3; Nucleopolyhedrovirus|Rep:
           BRO-g - Mamestra configurata NPV-A
          Length = 235

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/38 (52%), Positives = 29/38 (76%)
 Frame = +2

Query: 299 PHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQV 412
           PHTV + K+G++Q+I K KL  A +LQ+WL EEV P++
Sbjct: 82  PHTVSVNKAGLVQMITKCKLKNADKLQKWLYEEVFPKI 119


>UniRef50_Q99GY7 Cluster: Bro; n=27; root|Rep: Bro - Helicoverpa
           armigera nucleopolyhedrovirus G4
          Length = 527

 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 19/59 (32%), Positives = 36/59 (61%)
 Frame = +2

Query: 281 DPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEE 457
           D + L P +  I ++G+ +LI  S++P A E ++W+  +++P++   GKYD A    +E
Sbjct: 250 DDVTLHPMSKFINRAGLFELIQASRMPKAQEFRDWINSDLLPKLCDDGKYDMAADAPKE 308



 Score = 35.1 bits (77), Expect = 1.7
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPA 439
           P  +Q  T  I ++GV +LI  S +P A   Q W   +++P +   G+Y  A
Sbjct: 74  PRNIQAKTKFINRAGVFELINASDMPGAKRFQAWNNNDLLPSLCQEGEYKMA 125


>UniRef50_A5IZW6 Cluster: Bro-5; n=2; Spodoptera litura
           granulovirus|Rep: Bro-5 - Spodoptera litura granulovirus
          Length = 256

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/48 (43%), Positives = 32/48 (66%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGK 427
           P   QP+TV I+++GV  LIM+ KL  A   ++WL EEV+P++   G+
Sbjct: 75  PANWQPNTVFISEAGVYALIMRCKLHTADLFRQWLFEEVLPELRKNGR 122


>UniRef50_Q9PYR5 Cluster: ORF130; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF130 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 237

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/43 (51%), Positives = 29/43 (67%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQV 412
           P   QP+TV IT++GV  LI KSKL  A   +EWL + +IPQ+
Sbjct: 51  PSNWQPNTVFITEAGVYALINKSKLAGAEIFREWLFDTIIPQM 93


>UniRef50_Q4KT11 Cluster: BRO-B; n=2; Nucleopolyhedrovirus|Rep:
           BRO-B - Chrysodeixis chalcites nucleopolyhedrovirus
          Length = 635

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 18/47 (38%), Positives = 31/47 (65%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           L P T  I K+G+ +LI  SK+P A E ++W+  +++P++   G+YD
Sbjct: 74  LHPKTKFINKAGLFELIQNSKMPKAQEFKQWINFDLLPKLCDKGRYD 120


>UniRef50_A5IZQ5 Cluster: Bro-2; n=1; Spodoptera litura
           granulovirus|Rep: Bro-2 - Spodoptera litura granulovirus
          Length = 368

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/44 (47%), Positives = 28/44 (63%)
 Frame = +2

Query: 344 MKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEKNKQLV 475
           M+SKLP A E Q WL EEV+P++  +GKYD   +Q     K+ V
Sbjct: 1   MRSKLPAAEEFQRWLFEEVLPELRKSGKYDMTKRQSVNWAKKYV 44


>UniRef50_A3HNE6 Cluster: BRO domain protein domain protein; n=1;
           Pseudomonas putida GB-1|Rep: BRO domain protein domain
           protein - Pseudomonas putida (strain GB-1)
          Length = 285

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +2

Query: 281 DPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           D   L P   +I +  V +L+M+SK+P A   +EW++ EV+P +  TG Y
Sbjct: 79  DSFTLGPSANIIPERDVYRLVMRSKMPQAERFEEWVVSEVLPSIRKTGGY 128


>UniRef50_Q0IKW6 Cluster: Bro-i; n=3; dsDNA viruses, no RNA
           stage|Rep: Bro-i - Leucania separata nuclear
           polyhedrosis virus (LsNPV)
          Length = 263

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/59 (30%), Positives = 35/59 (59%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEKNKQ 469
           L P +  I K+G+++L++KS++ YA E + WL+ E+ P +      D  + + +  N+Q
Sbjct: 96  LHPSSRFINKAGLLELVLKSRMRYAAEFRFWLVNELFPSLKIDALEDFEVWRVDPNNRQ 154


>UniRef50_Q0I4I5 Cluster: Putative uncharacterized protein; n=2;
           Histophilus somni|Rep: Putative uncharacterized protein
           - Haemophilus somnus (strain 129Pt) (Histophilus somni
           (strain 129Pt))
          Length = 204

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQ 448
           I +  + ++I KS+   A+E Q W+ EEV+PQ+  TGKY    KQ
Sbjct: 69  INEPNLYRIIFKSRKAEAVEFQNWVFEEVLPQIRKTGKYQLKPKQ 113


>UniRef50_A4XBY6 Cluster: BRO domain protein domain protein; n=2;
           Salinispora|Rep: BRO domain protein domain protein -
           Salinispora tropica CNB-440
          Length = 284

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +2

Query: 263 SVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD--P 436
           S A+  D +  + H  +  +SG+  LI +S+ P A   + W+  EV+P +  TG+Y+  P
Sbjct: 73  STAEVIDGMGRRQHVRITNESGLYDLIFQSRKPEARAFRRWVTHEVLPAIRATGRYESVP 132

Query: 437 AIKQQEEKNKQL 472
           A+ Q      QL
Sbjct: 133 AVPQSYADALQL 144


>UniRef50_Q5UP77 Cluster: Uncharacterized Bro-N domain-containing
           protein L2; n=1; Acanthamoeba polyphaga mimivirus|Rep:
           Uncharacterized Bro-N domain-containing protein L2 -
           Mimivirus
          Length = 246

 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/59 (37%), Positives = 33/59 (55%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEK 460
           P  L   T  I  SG   LI  SK P+A+++++WL +EVIP ++  G Y    K+ + K
Sbjct: 168 PKTLDKKTKFINLSGFCNLIHHSKKPFAMKIKKWLDDEVIPALIMDGVYSMQPKELKVK 226


>UniRef50_Q919R4 Cluster: CUN001 putative bro protein, ATP_GTP_A
           motif, similar to AcMNPV ORF 2; n=1; Culex nigripalpus
           NPV|Rep: CUN001 putative bro protein, ATP_GTP_A motif,
           similar to AcMNPV ORF 2 - Culex nigripalpus NPV
          Length = 593

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 18/50 (36%), Positives = 33/50 (66%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEE 457
           V++ + GV QLI++S+LP A   ++W+   V+P +  TG+YD    ++E+
Sbjct: 244 VMLNEGGVQQLILESRLPNAKRYKQWVCGTVLPSIRRTGRYDVRDVKRED 293


>UniRef50_Q4KT25 Cluster: BRO-A; n=3; root|Rep: BRO-A - Chrysodeixis
           chalcites nucleopolyhedrovirus
          Length = 517

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDP 436
           L P T  I K+G+ +LI  SK+P A E ++W+  +++P +    +Y P
Sbjct: 116 LHPKTKFINKAGLFELIQNSKMPQAQEFKQWINSDLLPTLCQQREYSP 163


>UniRef50_Q06KD3 Cluster: Baculovirus repeated ORF; n=1; Anticarsia
           gemmatalis nucleopolyhedrovirus|Rep: Baculovirus
           repeated ORF - Anticarsia gemmatalis nuclear
           polyhedrosis virus (AgMNPV)
          Length = 60

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 248 ALAPNSVAKQGDPLYLQPHTVLITK 322
           A A ++VAKQ DPLYLQPHT+LITK
Sbjct: 30  APAADTVAKQRDPLYLQPHTILITK 54



 Score = 33.1 bits (72), Expect = 6.8
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 2/34 (5%)
 Frame = +3

Query: 177 KDAVSRHVDKKYKYTYSES--GARLPPSLQTAWQ 272
           ++AV++HVD KYK+TY E   G R P +   A Q
Sbjct: 6   RNAVNQHVDDKYKFTYGEQTPGVRAPAADTVAKQ 39


>UniRef50_A4KXK8 Cluster: Bro20; n=1; Heliothis virescens ascovirus
           3e|Rep: Bro20 - Heliothis virescens ascovirus 3e
          Length = 191

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 15/47 (31%), Positives = 31/47 (65%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           ++  T  I ++G+ +LIM S++P A + Q W+  +++P++   G+YD
Sbjct: 90  IRARTKFINRAGMFELIMSSRMPRARKFQRWVFSDLLPKLCQNGQYD 136


>UniRef50_Q7N339 Cluster: Similar to bacteriophage protein; n=2;
           Enterobacteriaceae|Rep: Similar to bacteriophage protein
           - Photorhabdus luminescens subsp. laumondii
          Length = 314

 Score = 42.7 bits (96), Expect = 0.008
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQE 454
           +L  +S + +L+M+S LP A   Q+W+ E V+P ++ TG Y  +IKQ +
Sbjct: 139 ILAGQSDMFRLVMRSNLPSAERFQDWVCEAVLPSIMETGSY--SIKQSQ 185


>UniRef50_Q2L2E4 Cluster: Phage protein; n=1; Bordetella avium
           197N|Rep: Phage protein - Bordetella avium (strain 197N)
          Length = 374

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 10/66 (15%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY----------DPAIKQQEE 457
           V+I +SG+  L+++S+ P A +  +W+  EV+PQ+  TG Y          D   KQQ+E
Sbjct: 135 VIINESGLYALVLRSRKPEARKFAKWVTSEVLPQIRKTGAYLPKEFAVNPGDILTKQQQE 194

Query: 458 KNKQLV 475
             +QLV
Sbjct: 195 VLRQLV 200


>UniRef50_A7LYR8 Cluster: Putative uncharacterized protein; n=2;
           Bacteroides ovatus ATCC 8483|Rep: Putative
           uncharacterized protein - Bacteroides ovatus ATCC 8483
          Length = 269

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 18/39 (46%), Positives = 26/39 (66%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  VI+LIM+SKLP A   Q+W+ EE++P +   G Y
Sbjct: 78  INEGDVIRLIMRSKLPQAEAFQDWVCEEILPSIRKHGAY 116


>UniRef50_A4P0J2 Cluster: Possible prophage antirepressor; n=1;
           Haemophilus influenzae 22.4-21|Rep: Possible prophage
           antirepressor - Haemophilus influenzae 22.4-21
          Length = 210

 Score = 42.3 bits (95), Expect = 0.011
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD---PAIKQQE 454
           I +  + ++I +S    AIE Q W+ EEV+PQ+  TGKY+   PA+   E
Sbjct: 69  INEPNLYRIIFRSNKAEAIEFQNWIFEEVLPQIRKTGKYEISQPALPMPE 118


>UniRef50_A4KXE7 Cluster: Bro9; n=1; Heliothis virescens ascovirus
           3e|Rep: Bro9 - Heliothis virescens ascovirus 3e
          Length = 521

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 16/50 (32%), Positives = 31/50 (62%)
 Frame = +2

Query: 290 YLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPA 439
           Y+Q  +  I ++G+ +LI  S++P A+E + W+   ++P++   G YD A
Sbjct: 74  YVQAKSKFINRAGLFELIQASRMPKALEFKNWINSVLLPKLCDDGSYDMA 123


>UniRef50_Q47HX8 Cluster: BRO, N-terminal; n=1; Dechloromonas
           aromatica RCB|Rep: BRO, N-terminal - Dechloromonas
           aromatica (strain RCB)
          Length = 111

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 16/41 (39%), Positives = 29/41 (70%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +L+++SG+ +LIM+S  P A   Q+W+ +EV+P +  TG +
Sbjct: 57  ILVSESGLYKLIMRSDKPQAKAFQDWVTKEVLPSIRKTGSF 97


>UniRef50_Q3Y2L0 Cluster: BRO, N-terminal; n=1; Enterococcus faecium
           DO|Rep: BRO, N-terminal - Enterococcus faecium DO
          Length = 248

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 18/40 (45%), Positives = 28/40 (70%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +I +S V +LI+KS LP A + + W++EEV+P +  TG Y
Sbjct: 67  VIPESDVYRLIIKSNLPSAEKFEAWVMEEVLPTIRKTGSY 106


>UniRef50_A4TYQ8 Cluster: BRO, N-terminal; n=1; Magnetospirillum
           gryphiswaldense|Rep: BRO, N-terminal - Magnetospirillum
           gryphiswaldense
          Length = 300

 Score = 41.1 bits (92), Expect = 0.026
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           ++++  V++LI+ SKLP A+  + W+ EEV+P +  TG  D
Sbjct: 68  ILSEPDVLRLIVGSKLPAAVRFERWVFEEVLPTIRTTGGSD 108


>UniRef50_Q919G9 Cluster: CUN108 putative bro protein, ATP_GTP_A
           motif, similar to AcMNPV ORF2; n=1; Culex nigripalpus
           NPV|Rep: CUN108 putative bro protein, ATP_GTP_A motif,
           similar to AcMNPV ORF2 - Culex nigripalpus NPV
          Length = 601

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 16/42 (38%), Positives = 29/42 (69%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           V++ + GV QLI++S+LP A   ++W+   V+P +  TG+Y+
Sbjct: 241 VMLNEGGVQQLILESRLPNAKRYKQWVCGTVLPSIRKTGRYE 282


>UniRef50_Q1J4V4 Cluster: Phage antirepressor protein; n=1;
           Streptococcus pyogenes MGAS10750|Rep: Phage
           antirepressor protein - Streptococcus pyogenes serotype
           M4 (strain MGAS10750)
          Length = 244

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 19/55 (34%), Positives = 34/55 (61%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEKNKQLV 475
           +I +SG+  LI+ SKLP A   + W+  EV+P +   G Y   + Q+++ N++L+
Sbjct: 70  IINESGLYSLILSSKLPQAKIFKAWVTREVLPSIRKNGGY--IVGQEKKTNEELL 122


>UniRef50_A0A7D8 Cluster: Prophage antirepressor; n=1; Cyanophage
           Ma-LMM01|Rep: Prophage antirepressor - Cyanophage
           Ma-LMM01
          Length = 270

 Score = 40.7 bits (91), Expect = 0.034
 Identities = 15/39 (38%), Positives = 29/39 (74%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I++SG+ +L++ S+ P A   Q+W+++EV+P +  TG+Y
Sbjct: 75  ISESGLYRLVLSSRKPQAELFQDWVVQEVLPTIRKTGRY 113


>UniRef50_Q9PYY1 Cluster: ORF62; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF62 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 211

 Score = 40.3 bits (90), Expect = 0.045
 Identities = 18/48 (37%), Positives = 26/48 (54%)
 Frame = +2

Query: 254 APNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEE 397
           +P S      P++ Q +T+ I K G+I LI  S LP A E + W L +
Sbjct: 78  SPCSPGPNNQPIHWQSNTLFINKDGIISLINNSTLPVAHEFKRWFLAQ 125


>UniRef50_Q185G9 Cluster: Putative phage-related regulatory protein;
           n=1; Clostridium difficile 630|Rep: Putative
           phage-related regulatory protein - Clostridium difficile
           (strain 630)
          Length = 121

 Score = 40.3 bits (90), Expect = 0.045
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +T+SGV +LI KS+   A   Q+W+ +EV+P +  TG Y
Sbjct: 74  LTESGVYKLIFKSRKEEAERFQDWISDEVLPSIRQTGAY 112


>UniRef50_A1AN22 Cluster: BRO domain protein domain protein; n=1;
           Pelobacter propionicus DSM 2379|Rep: BRO domain protein
           domain protein - Pelobacter propionicus (strain DSM
           2379)
          Length = 247

 Score = 40.3 bits (90), Expect = 0.045
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           LQ  T+ I +  + +LIM+SKLP A   +EW++ EV+P +  TG Y+
Sbjct: 63  LQEMTI-IPERDLYRLIMRSKLPAAERFEEWVVAEVLPAIRKTGFYN 108


>UniRef50_P44189 Cluster: Uncharacterized protein HI1418; n=8;
           Pasteurellaceae|Rep: Uncharacterized protein HI1418 -
           Haemophilus influenzae
          Length = 201

 Score = 40.3 bits (90), Expect = 0.045
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  + +LI+KS+ P A   + W+ EEV+PQ+  TGKY
Sbjct: 86  INEPNLYRLIIKSRKPEAEPFEAWVFEEVLPQIRKTGKY 124


>UniRef50_Q8QLL3 Cluster: BRO-a; n=1; Mamestra configurata
           NPV-A|Rep: BRO-a - Mamestra configurata NPV-A
          Length = 161

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +2

Query: 254 APNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEV 400
           AP     +  P +   +TV I ++GV+ LIM S++ YA E ++W  EE+
Sbjct: 16  APKPRNMENAPKHWHSNTVFIDEAGVMSLIMNSEISYAKEFKKWFYEEL 64


>UniRef50_Q8G2Q7 Cluster: BRO family protein; n=3; Brucella|Rep: BRO
           family protein - Brucella suis
          Length = 140

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 16/47 (34%), Positives = 30/47 (63%)
 Frame = +2

Query: 290 YLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           + QP  + +++SG+ +LIM+S+ P A + Q W+ + V+P +   G Y
Sbjct: 70  FRQPSLLSVSESGLYKLIMRSRKPEAKKFQNWVTQVVLPAIRKDGMY 116


>UniRef50_A6PK75 Cluster: BRO domain protein; n=1; Victivallis
           vadensis ATCC BAA-548|Rep: BRO domain protein -
           Victivallis vadensis ATCC BAA-548
          Length = 357

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 16/40 (40%), Positives = 28/40 (70%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +++++ V++LI  SKLP A + + W+ EEV+P +  TG Y
Sbjct: 70  ILSEADVMRLICGSKLPAAQKFERWVFEEVLPAIRRTGSY 109


>UniRef50_A5MYH6 Cluster: Predicted prophage antirepressor; n=1;
           Clostridium kluyveri DSM 555|Rep: Predicted prophage
           antirepressor - Clostridium kluyveri DSM 555
          Length = 267

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 16/50 (32%), Positives = 31/50 (62%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEKN 463
           I +  + +L+  S+LP A E + W+ ++V+PQ+  TG Y P  + + E++
Sbjct: 71  IPEGDIYRLVANSELPGAQEFESWIFDKVLPQINHTGGYIPNNEDESEED 120


>UniRef50_A3QSE3 Cluster: Putative antirepressor; n=1; Clostridium
           phage phiC2|Rep: Putative antirepressor - Clostridium
           phage phiC2
          Length = 212

 Score = 39.9 bits (89), Expect = 0.059
 Identities = 17/40 (42%), Positives = 27/40 (67%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           LIT+  V +LI+ S LP A + + W+ +EV+P +  TG+Y
Sbjct: 66  LITEGDVYRLIVGSNLPNAEKFESWVFDEVLPTIRQTGQY 105


>UniRef50_Q3J623 Cluster: Putative uncharacterized protein; n=1;
           Rhodobacter sphaeroides 2.4.1|Rep: Putative
           uncharacterized protein - Rhodobacter sphaeroides
           (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM158)
          Length = 151

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +LI++SG+ +L+M+   P A + Q+W+  EV+P +  TG Y
Sbjct: 63  MLISESGLNKLVMRPDKPEAKKFQDWVTREVLPSIRKTGTY 103


>UniRef50_Q03FD4 Cluster: Uncharacterized phage-encoded protein;
           n=3; root|Rep: Uncharacterized phage-encoded protein -
           Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)
          Length = 267

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +I++ G+ QL  +SKLP A   Q+W+ EEV+P +   G Y
Sbjct: 68  VISEPGIYQLAGQSKLPTAEPFQDWIYEEVLPSIRKHGAY 107


>UniRef50_A6NXW4 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 309

 Score = 39.5 bits (88), Expect = 0.078
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +2

Query: 263 SVAKQGDPLYLQPHTV-LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           ++ K+  P+  +  ++  I +  V +LI++SKLP A + + W+ +EVIP +  TG Y
Sbjct: 107 AITKRSTPISGKVQSINFIPEGDVYRLIIRSKLPAAEKFELWVFDEVIPTIRKTGGY 163


>UniRef50_Q65PV1 Cluster: Lj965 prophage antirepressor; n=4;
           root|Rep: Lj965 prophage antirepressor - Lactobacillus
           johnsonii
          Length = 278

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +2

Query: 305 TVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           T++  +SG+  LI+ SKLP A + + W+  EV+P +   G Y
Sbjct: 69  TIITNESGMYSLILSSKLPSAKKFKRWVTSEVLPAIREDGAY 110


>UniRef50_A7A2N3 Cluster: Putative uncharacterized protein; n=1;
           Bifidobacterium adolescentis L2-32|Rep: Putative
           uncharacterized protein - Bifidobacterium adolescentis
           L2-32
          Length = 263

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 16/41 (39%), Positives = 27/41 (65%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           ++I++ G+ +LIM+S+ P A E Q W+  EV+P +   G Y
Sbjct: 69  LIISEPGLYKLIMRSRKPEAKEFQRWVTHEVLPSIRKHGAY 109


>UniRef50_A6NWY1 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 153

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           LI +SG+  L++ SKLP A + + W+  EV+P +   G Y
Sbjct: 68  LINESGLYSLVLSSKLPKAKQFRRWVTSEVLPSIRKHGAY 107


>UniRef50_A3M6B7 Cluster: Putative uncharacterized protein; n=1;
           Acinetobacter baumannii ATCC 17978|Rep: Putative
           uncharacterized protein - Acinetobacter baumannii
           (strain ATCC 17978 / NCDC KC 755)
          Length = 220

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 17/50 (34%), Positives = 31/50 (62%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEKN 463
           + +  + ++I +S  P A + Q+W+  EV+P +  TGKY+ A K  E++N
Sbjct: 23  VNEPNLYRIIFRSNKPEAKQFQDWVFNEVLPTIRKTGKYE-APKPVEKRN 71


>UniRef50_Q80LR2 Cluster: Baculovirus repeated ORF; n=1; Adoxophyes
           honmai NPV|Rep: Baculovirus repeated ORF - Adoxophyes
           honmai nucleopolyhedrovirus
          Length = 113

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +3

Query: 135 VAKDIASSLKYGNCKDAVSRHVDKKYKYTYS 227
           +AKD+A++LKY +CK A+  +VD+KYK  ++
Sbjct: 1   MAKDVAAALKYVDCKQAIRINVDEKYKCKFN 31



 Score = 36.7 bits (81), Expect = 0.55
 Identities = 18/28 (64%), Positives = 20/28 (71%)
 Frame = +2

Query: 233 GGETTALAPNSVAKQGDPLYLQPHTVLI 316
           G  T   A NSVAK+GDPLYLQ +TV I
Sbjct: 33  GCTTHTPASNSVAKRGDPLYLQSNTVFI 60


>UniRef50_Q92FM4 Cluster: Lin0080 protein; n=14; root|Rep: Lin0080
           protein - Listeria innocua
          Length = 257

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I ++G+ QLI KSKL  A   Q+W+  EV+P V   G Y
Sbjct: 69  INEAGLYQLIFKSKLESAERFQDWVTSEVLPSVRKHGAY 107



 Score = 33.5 bits (73), Expect = 5.1
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +3

Query: 93  LRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYK 215
           +R V  +  P   F+ KD+A  L Y N +DA+ RHV  K K
Sbjct: 14  VRTVFIENEPH--FIGKDVAKVLGYSNSRDALKRHVFLKNK 52


>UniRef50_Q8FRD3 Cluster: Putative uncharacterized protein; n=1;
           Corynebacterium efficiens|Rep: Putative uncharacterized
           protein - Corynebacterium efficiens
          Length = 262

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 2/48 (4%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY--DPAIKQ 448
           +IT+SG+   I++S+ P A E + W+  EV+P +   G Y  DP I++
Sbjct: 65  VITESGLYSCILRSRKPEAKEFKRWVTREVLPSIRRHGGYLTDPKIEE 112


>UniRef50_Q5F6A8 Cluster: Putative uncharacterized protein; n=2;
           Neisseria gonorrhoeae FA 1090|Rep: Putative
           uncharacterized protein - Neisseria gonorrhoeae (strain
           ATCC 700825 / FA 1090)
          Length = 332

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           + I +  + ++I +S+   A++ Q+W+ EEVIPQ+  TG Y
Sbjct: 117 LFINEPNLYRVIFRSRKAEAVKFQDWIFEEVIPQIRKTGGY 157


>UniRef50_Q7Y4K9 Cluster: Gp15; n=9; root|Rep: Gp15 - Streptococcus
           phage SM1
          Length = 239

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           ++I +SG+  LI+ SKLP A E + W+  EV+P +   G +
Sbjct: 65  LIINESGLYSLILSSKLPQAREFKRWVTSEVLPAIRKQGGF 105


>UniRef50_UPI0000397D5D Cluster: COG3617: Prophage antirepressor;
           n=1; Actinobacillus pleuropneumoniae serovar 1 str.
           4074|Rep: COG3617: Prophage antirepressor -
           Actinobacillus pleuropneumoniae serovar 1 str. 4074
          Length = 215

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  + ++I +S    AI+ Q W+ EEV+PQ+  TG+Y
Sbjct: 15  INEPNLYRIIFRSNKSQAIDFQNWVFEEVLPQIRKTGQY 53


>UniRef50_Q8QNG2 Cluster: EsV-1-117; n=1; Ectocarpus siliculosus
           virus 1|Rep: EsV-1-117 - Ectocarpus siliculosus virus 1
          Length = 524

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +2

Query: 305 TVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           TV +T+ GV +LIM+S+ P A   Q+W+  EV+  +   GKY
Sbjct: 68  TVFVTEKGVYKLIMRSRKPVAKPFQDWVF-EVLKTIRKRGKY 108


>UniRef50_A0RLT8 Cluster: Antirepressor, phage associated; n=3;
           Bacillus cereus group|Rep: Antirepressor, phage
           associated - Bacillus thuringiensis (strain Al Hakam)
          Length = 262

 Score = 38.3 bits (85), Expect = 0.18
 Identities = 16/39 (41%), Positives = 25/39 (64%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  + +LI+KSKLP A + + W+ EEV+P +   G Y
Sbjct: 76  INEPNLYRLIVKSKLPQAEQFETWVFEEVLPSIRKHGAY 114


>UniRef50_A5IZL9 Cluster: Bro-1; n=1; Spodoptera litura
           granulovirus|Rep: Bro-1 - Spodoptera litura granulovirus
          Length = 471

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 14/46 (30%), Positives = 30/46 (65%)
 Frame = +2

Query: 293 LQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           L P++  I ++G+ +LI  S +P A + ++W+  +++ ++  TGKY
Sbjct: 70  LHPYSKFINQAGLFELIQSSCMPKAQQFKDWVTSKLLTRLCKTGKY 115


>UniRef50_A3DI85 Cluster: BRO-like protein; n=1; Clostridium
           thermocellum ATCC 27405|Rep: BRO-like protein -
           Clostridium thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 248

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +2

Query: 281 DPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQ 448
           D L     T ++ ++G+  LI+ S+   A E + W+  EVIPQ+  TG Y    KQ
Sbjct: 59  DSLGRLQETYVVNEAGLYNLILGSRKQEAKEFKRWITHEVIPQIRKTGIYALEPKQ 114


>UniRef50_Q8W644 Cluster: Putative uncharacterized protein; n=2;
           root|Rep: Putative uncharacterized protein -
           Enterobacteria phage phiP27
          Length = 274

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +L+ +SG+  LI+KS+   A   + W+  EVIP +  TG Y
Sbjct: 72  LLVNESGLYALIIKSRKKQARRFKRWITSEVIPSIRKTGNY 112


>UniRef50_A6N1W8 Cluster: Putative uncharacterized protein; n=1;
           Microbacterium phage Min1|Rep: Putative uncharacterized
           protein - Microbacterium phage Min1
          Length = 250

 Score = 37.9 bits (84), Expect = 0.24
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY---DPAIKQ 448
           +I +  +++LI  S+LP A   + W  EEV+P V+ TG Y    PA+ Q
Sbjct: 65  VIGEPDLLRLITGSRLPQAERFERWAFEEVLPTVIRTGSYTAPPPALPQ 113



 Score = 34.7 bits (76), Expect = 2.2
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +3

Query: 72  FGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRH 197
           FG D   +R VL +G P  +FVA+D+AS+L Y +   A+ +H
Sbjct: 4   FGFDGHHVRVVLVEGLP--RFVARDVASALGYTDPTSAIKQH 43


>UniRef50_Q9YVP8 Cluster: ORF MSV194 ALI motif gene family protein;
           n=2; Melanoplus sanguinipes entomopoxvirus|Rep: ORF
           MSV194 ALI motif gene family protein - Melanoplus
           sanguinipes entomopoxvirus (MsEPV)
          Length = 409

 Score = 37.5 bits (83), Expect = 0.32
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +2

Query: 290 YLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           Y + +T+ I++SG+  LI+ SK   A   ++W+  EV+P +   G+Y
Sbjct: 69  YNEKNTIYISESGLYSLILSSKKSEAKIFKKWITNEVLPNIRKHGEY 115


>UniRef50_Q9YML4 Cluster: Ld-bro-i; n=1; Lymantria dispar MNPV|Rep:
           Ld-bro-i - Lymantria dispar multicapsid nuclear
           polyhedrosis virus (LdMNPV)
          Length = 346

 Score = 37.5 bits (83), Expect = 0.32
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +2

Query: 266 VAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           VA    P    P T+ + + GV  L+ +S  P A E  +++ E ++P +  TGK++
Sbjct: 77  VAPPTTPANWHPETLFVLEPGVYALLARSNKPLAKERMKFVYETILPTIRKTGKFE 132


>UniRef50_Q9PAJ2 Cluster: Phage-related protein; n=22;
           Gammaproteobacteria|Rep: Phage-related protein - Xylella
           fastidiosa
          Length = 530

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +2

Query: 281 DPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTG 424
           D L     T +I++  +++LI+ SKLP A   + W+ EE++P +  TG
Sbjct: 219 DSLGRSRETRIISEPDMLRLIVSSKLPAAERFERWVFEELLPTLRKTG 266



 Score = 33.9 bits (74), Expect = 3.9
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +SG+  LIM S  P A   + W+  EV+P +  TG Y
Sbjct: 348 INESGLYALIMGSTKPAAKRFKRWVTSEVLPTLRKTGTY 386


>UniRef50_Q30XK5 Cluster: Prophage antirepressor-like; n=2;
           Desulfovibrio desulfuricans G20|Rep: Prophage
           antirepressor-like - Desulfovibrio desulfuricans (strain
           G20)
          Length = 197

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           ++I + G+  LI +S+ P AI  Q+W+ +EV+P +   G Y
Sbjct: 82  LIINEPGLYTLIFQSRKPEAIAFQDWVCKEVLPSIRKHGAY 122


>UniRef50_Q0SWM4 Cluster: BRO family, N-terminal domain protein;
           n=3; Clostridium perfringens|Rep: BRO family, N-terminal
           domain protein - Clostridium perfringens (strain SM101 /
           Type A)
          Length = 191

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 299 PHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           P  V+  + G+   I  SKLP  I  ++WL  EV+P++   G Y
Sbjct: 85  PKLVIFYEEGLYGFINYSKLPIGISFRKWLRREVLPELRAKGTY 128


>UniRef50_A6TLJ8 Cluster: Prophage antirepressor; n=5; root|Rep:
           Prophage antirepressor - Alkaliphilus metalliredigens
           QYMF
          Length = 276

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQE 454
           +I +SG+  LI+ SKLP A   + W+  EV+P +   G Y    K +E
Sbjct: 70  IINESGLYGLILSSKLPNAKRFKRWVTSEVLPSIQRHGVYMTPDKIEE 117



 Score = 36.7 bits (81), Expect = 0.55
 Identities = 22/49 (44%), Positives = 30/49 (61%)
 Frame = +3

Query: 69  KFGQDTFTLRYVLEQGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKKYK 215
           +FGQ    +R + + G P   FV KDIA SL Y N  DA+ +HVD++ K
Sbjct: 12  EFGQ----VRVLRQDGQPW--FVGKDIADSLGYKNPSDALLKHVDEEDK 54


>UniRef50_A3VVX0 Cluster: Hypothetical BRO family protein; n=1;
           Roseovarius sp. 217|Rep: Hypothetical BRO family protein
           - Roseovarius sp. 217
          Length = 163

 Score = 37.1 bits (82), Expect = 0.42
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           V++T+SG+ +L+M+S  P A   Q+W+   V+P +   G Y
Sbjct: 101 VIVTESGLYKLVMRSDKPEAKAFQDWVTGTVLPSIRKDGGY 141


>UniRef50_Q9YMQ6 Cluster: Ld-bro-c; n=6; dsDNA viruses, no RNA
           stage|Rep: Ld-bro-c - Lymantria dispar multicapsid
           nuclear polyhedrosis virus (LdMNPV)
          Length = 528

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +2

Query: 266 VAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           VA    P    P T+ + + GV  L+ +S  P A E  +++ E ++P +  TGK++
Sbjct: 77  VAPPTTPANWHPETLFVLEPGVYALMARSTKPMAKEKMKFVYETILPTIRKTGKFE 132


>UniRef50_Q91FW9 Cluster: 201R; n=2; Invertebrate iridescent virus
           6|Rep: 201R - Chilo iridescent virus (CIV) (Insect
           iridescent virus type 6)
          Length = 419

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +2

Query: 275 QGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           Q +  Y +  ++ I + G+  LIM S+ P+A + Q+ + E+++P +   G Y
Sbjct: 87  QNELSYHEGKSIYINEPGLYNLIMSSEAPFAEQFQDMVYEKILPSIRKYGSY 138


>UniRef50_Q8QLL0 Cluster: BRO-b; n=2; Nucleopolyhedrovirus|Rep:
           BRO-b - Mamestra configurata NPV-A
          Length = 372

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 15/48 (31%), Positives = 30/48 (62%)
 Frame = +2

Query: 287 LYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           L +Q  +  I ++G+ +LI  SK+P A E + W+  +++ ++  TG+Y
Sbjct: 111 LSVQAKSKFINRAGLFELIQASKMPKAQEFRNWINSDLLVKLCDTGEY 158


>UniRef50_Q6NK48 Cluster: Putative anti-repressor protein; n=3;
           Corynebacterium|Rep: Putative anti-repressor protein -
           Corynebacterium diphtheriae
          Length = 272

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 13/40 (32%), Positives = 27/40 (67%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           ++ +SG+ +L+ +S++P A E + W+  EV+P++   G Y
Sbjct: 67  VVNESGLYELLFQSRVPQAKEFRRWVTGEVLPEIRRHGMY 106


>UniRef50_Q47D43 Cluster: BRO family protein; n=1; Dechloromonas
           aromatica RCB|Rep: BRO family protein - Dechloromonas
           aromatica (strain RCB)
          Length = 58

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 12/40 (30%), Positives = 28/40 (70%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           L+ +SG+ +++++S+   A + Q+W+ +EV+P +  TG +
Sbjct: 12  LLAESGLYKMVLRSRTQQAQKFQDWVTKEVLPSIRKTGSF 51


>UniRef50_A0VJ08 Cluster: BRO-like; n=1; Delftia acidovorans
           SPH-1|Rep: BRO-like - Delftia acidovorans SPH-1
          Length = 270

 Score = 36.7 bits (81), Expect = 0.55
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY-DPAIKQ 448
           ++I +SG+   I+KS+   A   ++W+  EV+P +  TG Y  PA +Q
Sbjct: 67  IVINESGLYSAILKSERQEAKRFKKWVTSEVLPSIRRTGSYTGPAAQQ 114


>UniRef50_Q8JM96 Cluster: Putative uncharacterized protein; n=1;
           Mamestra configurata NPV-B|Rep: Putative uncharacterized
           protein - Mamestra configurata NPV-B
          Length = 134

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEE 397
           P+  +P+T  I K G+I LI  S LP A E ++W L +
Sbjct: 11  PIPWRPNTWFINKDGIISLINNSTLPVAHEFKKWFLAQ 48


>UniRef50_Q4KT10 Cluster: BRO-C; n=1; Chrysodeixis chalcites
           nucleopolyhedrovirus|Rep: BRO-C - Chrysodeixis chalcites
           nucleopolyhedrovirus
          Length = 268

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 16/52 (30%), Positives = 33/52 (63%)
 Frame = +2

Query: 305 TVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEEK 460
           T+ +  +GV++LI  S++  AI+L++WL   V+ ++   G+Y   + + +EK
Sbjct: 85  TIFVNLAGVLELIKGSQIQKAIDLRQWLASTVLIKLCTDGQY--FVNKNQEK 134


>UniRef50_Q197E1 Cluster: Putative uncharacterized protein; n=1;
           Aedes taeniorhynchus iridescent virus|Rep: Putative
           uncharacterized protein - Aedes taeniorhynchus
           iridescent virus
          Length = 406

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 230 VGGETTALAPNSVAKQGDPL-YLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIP 406
           VG +TT+    S      PL Y +   + I + G+  LIM S  P+A E Q+ + E+++P
Sbjct: 77  VGVQTTSTRLGS----NSPLTYNEGKAIYINEPGLYALIMHSNAPFAEEFQDLVYEQILP 132

Query: 407 QVLCTGKY 430
            +   G Y
Sbjct: 133 SIRKYGSY 140


>UniRef50_Q1A0E0 Cluster: Gp77; n=1; Mycobacterium phage Che12|Rep:
           Gp77 - Mycobacterium phage Che12
          Length = 280

 Score = 36.3 bits (80), Expect = 0.73
 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = +2

Query: 284 PLYLQPHT--VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTG 424
           P  + PH   ++I ++G+ +LIM+S +P A   Q+W+   V+P +  TG
Sbjct: 75  PGQVVPHRDMLVINEAGLYRLIMRSNVPAAAPFQDWVTAVVLPTIRKTG 123


>UniRef50_Q91BW9 Cluster: Bro-a; n=3; Nucleopolyhedrovirus|Rep:
           Bro-a - Helicoverpa armigera NPV
          Length = 244

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 284 PLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWL 388
           P  ++P+T  I ++GV +LIM S++ YA + + WL
Sbjct: 76  PRNMKPNTKFINRAGVFELIMSSQMEYARQFRYWL 110


>UniRef50_A6LVQ3 Cluster: Prophage antirepressor; n=3; root|Rep:
           Prophage antirepressor - Clostridium beijerinckii NCIMB
           8052
          Length = 251

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           +I +  + +L+ KS+LP A + + W+ +EV+P +  TG Y
Sbjct: 77  VIPEGDIYRLVAKSELPGAEKFEAWIFDEVLPCIRKTGMY 116


>UniRef50_A7IY79 Cluster: Putative antirepressor; n=1;
           Corynebacterium phage P1201|Rep: Putative antirepressor
           - Corynebacterium phage P1201
          Length = 307

 Score = 35.9 bits (79), Expect = 0.96
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQE 454
           +++SG+  +I+ S+ P A E + W+  EVIP +   G Y  + K +E
Sbjct: 113 VSESGLYDVILDSRKPEAKEFRRWITSEVIPSIRKHGAYLTSEKIEE 159


>UniRef50_Q84IK9 Cluster: Antirepressor protein; n=1; Clostridium
           sordellii|Rep: Antirepressor protein - Clostridium
           sordellii
          Length = 187

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +2

Query: 272 KQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           K GD +        I +  + +LI+KSKL    + + W+ EEV+P +   G+Y
Sbjct: 63  KSGDAIMQFVSKKFIDEGNLYRLILKSKLKKVRKFEMWVFEEVLPTIRKHGEY 115


>UniRef50_A3X9C1 Cluster: Putative uncharacterized protein; n=1;
           Roseobacter sp. MED193|Rep: Putative uncharacterized
           protein - Roseobacter sp. MED193
          Length = 150

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCT 421
           LI++SG+ +LI +S  P A   QEW+  +V+P V  T
Sbjct: 95  LISESGLYKLITRSDKPEAKPFQEWVTRDVLPSVRLT 131


>UniRef50_A0QB24 Cluster: Gp54 protein; n=2; Mycobacterium avium
           104|Rep: Gp54 protein - Mycobacterium avium (strain 104)
          Length = 263

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEE 457
           ++ +SG+  LI +S    A +++ W+  EV+P +  TG Y   +  ++E
Sbjct: 75  VVNESGMYALIFQSNKDRARDVRRWVTSEVLPSIRKTGSYGAPVLTEDE 123


>UniRef50_A5YK15 Cluster: Gp47; n=3; unclassified Siphoviridae|Rep:
           Gp47 - Mycobacterium phage Tweety
          Length = 334

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           V +T++GV  L+M S+ P     + W+  EV+P +  TG Y
Sbjct: 141 VAVTEAGVWSLLMISRSPKVKPFKRWMTHEVLPSIRKTGGY 181


>UniRef50_Q06VQ4 Cluster: Putative uncharacterized protein; n=1;
           Trichoplusia ni ascovirus 2c|Rep: Putative
           uncharacterized protein - Trichoplusia ni ascovirus 2c
          Length = 258

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/59 (25%), Positives = 31/59 (52%)
 Frame = +2

Query: 257 PNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           P        P  ++ ++  I K+G+ +LI  S +  A E ++W   +V+P++   G+Y+
Sbjct: 64  PREEEDDSSPFTIKYNSRFINKAGIWELIQNSPMKEAQEFRDWQNSDVMPKLCDVGEYN 122


>UniRef50_Q8D9R6 Cluster: Prophage antirepressor; n=1; Vibrio
           vulnificus|Rep: Prophage antirepressor - Vibrio
           vulnificus
          Length = 251

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDP 436
           +T+ GV ++ M++K   A + Q W+L+EV+P +   G Y P
Sbjct: 84  VTEPGVYRVAMQAKSSGAKKFQNWVLKEVMPSIRRFGIYPP 124


>UniRef50_Q6AC67 Cluster: Prophage antirepressor protein; n=2;
           Leifsonia xyli subsp. xyli|Rep: Prophage antirepressor
           protein - Leifsonia xyli subsp. xyli
          Length = 260

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           L+ + G+  LI++S+   A   + W+  EV+PQ+  TG Y
Sbjct: 69  LVNEPGLYSLILRSRKTEARAFKRWVTHEVLPQIRRTGSY 108


>UniRef50_Q5L2M6 Cluster: Phage associated-antirepressor; n=4;
           root|Rep: Phage associated-antirepressor - Geobacillus
           kaustophilus
          Length = 246

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = +2

Query: 221 VQRVGGETTALAPNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEV 400
           VQR+  +  +L P +     D L  +  T ++ + G+  LI+ S+   A + + W+  EV
Sbjct: 44  VQRLDEDERSLIPVT-----DSLGRKQETFIVNEPGLYTLILGSRKSEAKQFKRWVTHEV 98

Query: 401 IPQVLCTGKY 430
           IP +  TG Y
Sbjct: 99  IPTIRKTGGY 108


>UniRef50_A3DG82 Cluster: BRO-like protein; n=1; Clostridium
           thermocellum ATCC 27405|Rep: BRO-like protein -
           Clostridium thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 254

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  + +LI+KSKLP A   + W+ +EV+P +   G Y
Sbjct: 68  IPEGDLYRLIVKSKLPKAERFERWVFDEVLPSIRKHGIY 106


>UniRef50_A3DFZ3 Cluster: BRO-like protein; n=1; Clostridium
           thermocellum ATCC 27405|Rep: BRO-like protein -
           Clostridium thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 265

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  + +LI+KS+LP A   ++W+ +EV+P +   G Y
Sbjct: 71  IPEGDLFRLIVKSQLPAAERFEKWVFDEVLPTIRKYGVY 109


>UniRef50_A1AE06 Cluster: Putative anti-repressor protein; n=3;
           root|Rep: Putative anti-repressor protein - Escherichia
           coli O1:K1 / APEC
          Length = 231

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 7/66 (10%)
 Frame = +2

Query: 296 QPHTVLITKSGVIQLIMKSK-------LPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQE 454
           +  +++I++SG+  LI++ +       +PY    ++W+  EV+PQ+  TG Y      QE
Sbjct: 66  EQESIIISESGLYTLILRCRDAVTPGTIPY--RFRKWVTGEVLPQIRRTGSYIKNSLPQE 123

Query: 455 EKNKQL 472
           E+ K +
Sbjct: 124 ERIKMV 129


>UniRef50_A5ZCZ9 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides caccae ATCC 43185|Rep: Putative
           uncharacterized protein - Bacteroides caccae ATCC 43185
          Length = 255

 Score = 33.9 bits (74), Expect = 3.9
 Identities = 16/46 (34%), Positives = 28/46 (60%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQ 451
           + +SG+  LI++S+ P A   ++W+  EV+P +   G Y   IK+Q
Sbjct: 107 VNESGLYTLILQSRKPEAKPFRKWVTSEVLPSIRKKGYY--GIKKQ 150


>UniRef50_Q0IL00 Cluster: Bro-f; n=1; Leucania separata nuclear
           polyhedrosis virus|Rep: Bro-f - Leucania separata
           nuclear polyhedrosis virus (LsNPV)
          Length = 245

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +2

Query: 269 AKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQ 448
           AK   PL   P+  L+ + GV  L+M+S    A    +WL+  ++P++  T +    ++Q
Sbjct: 79  AKDEVPLNWHPNMWLLHEVGVYALVMRSNTTVARVFVQWLIGAILPELRKTDRVQLHLRQ 138


>UniRef50_Q8YHA3 Cluster: PHAGE-RELATED DNA BINDING PROTEIN; n=4;
           Brucella|Rep: PHAGE-RELATED DNA BINDING PROTEIN -
           Brucella melitensis
          Length = 191

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 14/41 (34%), Positives = 26/41 (63%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           V+++++ + +LIM+S  P A + Q W+   V+P +L  G Y
Sbjct: 90  VIVSEARLYKLIMRSTKPEAKKFQNWVTGTVLPAILKDGLY 130


>UniRef50_Q3JTQ5 Cluster: BRO family, N-terminal domain protein;
           n=1; Burkholderia pseudomallei 1710b|Rep: BRO family,
           N-terminal domain protein - Burkholderia pseudomallei
           (strain 1710b)
          Length = 239

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 13/40 (32%), Positives = 25/40 (62%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           ++++SG+  LIM+S+ P A   ++W+   V+P +   G Y
Sbjct: 65  VVSESGLYALIMRSRKPQARAFRKWVTSVVLPAIRKDGSY 104


>UniRef50_A1FKV6 Cluster: BRO-like; n=1; Pseudomonas putida
           W619|Rep: BRO-like - Pseudomonas putida W619
          Length = 256

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 15/49 (30%), Positives = 27/49 (55%)
 Frame = +2

Query: 311 LITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYDPAIKQQEE 457
           ++++ G+   + +S  P A+ LQ W+  EVIP +  TG Y   +   E+
Sbjct: 68  VLSEQGLYFFLGRSDKPGALPLQMWVAGEVIPSIRKTGSYQRPMTPAEQ 116


>UniRef50_Q37938 Cluster: Putative uncharacterized protein; n=1;
           Lactobacillus phage LL-H|Rep: Putative uncharacterized
           protein - Lactococcus delbrueckii bacteriophage LL-H
          Length = 69

 Score = 33.5 bits (73), Expect = 5.1
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 111 QGNPQVKFVAKDIASSLKYGNCKDAVSRHVDKK 209
           Q N +  FV KD+A+ L Y    DAV +HVD++
Sbjct: 19  QINGEAWFVGKDVATVLGYARTADAVRKHVDEE 51


>UniRef50_Q4KA85 Cluster: Probable phage protein YPO2126; n=1;
           Pseudomonas fluorescens Pf-5|Rep: Probable phage protein
           YPO2126 - Pseudomonas fluorescens (strain Pf-5 / ATCC
           BAA-477)
          Length = 294

 Score = 33.1 bits (72), Expect = 6.8
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +2

Query: 308 VLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKYD 433
           +++ +SG+  LI KS+   A   ++W+  EV+P +   G+Y+
Sbjct: 78  LVVNESGLYALIFKSRKAEAKRFKKWVTAEVLPAIRKHGRYE 119


>UniRef50_A5I4G4 Cluster: BRO family protein; n=1; Clostridium
           botulinum A str. ATCC 3502|Rep: BRO family protein -
           Clostridium botulinum A str. ATCC 3502
          Length = 266

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +2

Query: 314 ITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLCTGKY 430
           I +  + +LI  S+LP A + + W+ +E++P +  TG Y
Sbjct: 71  IDEGNLYRLITHSELPSAEKFEIWIFDEILPTIRKTGGY 109


>UniRef50_Q4ZAE4 Cluster: ORF018; n=4; Staphylococcus phage 53 sensu
           lato|Rep: ORF018 - Staphylococcus phage 92
          Length = 245

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +3

Query: 132 FVAKDIASSLKYGNCKDAVSRHVDKKYKYTYSESGA 239
           FV KDIA  L Y    +A+  HVD + K T+  S +
Sbjct: 25  FVGKDIAEILGYARADNAIRNHVDSEDKLTHQFSAS 60


>UniRef50_Q54LT3 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 636

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 30/103 (29%), Positives = 46/103 (44%), Gaps = 7/103 (6%)
 Frame = +1

Query: 328 RDSIDYEEQASVR----HRITRMAFRRSNSSSAMHGQVRPRN*TTGGKEQTVGDYXXCDI 495
           RDS DY      R    +R  R  +  S+SSS+  G+ R R+       ++  DY   D 
Sbjct: 384 RDSRDYRSSRDYRDDRDYRDNRDYYSSSSSSSSSSGRDRDRDYRDSRDYRSSRDYRDRDY 443

Query: 496 YRAHNALQGW---WRKKPRNFLKSKSLSNASSQLRTSRFRPKT 615
           + + ++L       R    +   S S S++SS LR  R R +T
Sbjct: 444 HSSSSSLSSRDRDHRSSRDHHHYSSSSSSSSSSLRRDRSRSRT 486


>UniRef50_A7ESI7 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 451

 Score = 32.7 bits (71), Expect = 9.0
 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = +2

Query: 248 ALAPNSV---AKQGDPLYLQPHTVLITKSGVIQLIMKSKLPYAIELQEWLLEEVIPQVLC 418
           A  PNS+   +++  P    P  + I +S   +   +S +P+ I + +W++  + P++L 
Sbjct: 86  AATPNSITASSRKAAPSSAPPRHLDIRESSPSRQPWRSNIPHTITVLQWIIRSISPEILR 145

Query: 419 TGKYDPAI 442
           T +  P +
Sbjct: 146 TDEVFPQL 153


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 662,275,672
Number of Sequences: 1657284
Number of extensions: 12734358
Number of successful extensions: 34566
Number of sequences better than 10.0: 108
Number of HSP's better than 10.0 without gapping: 33530
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34553
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55785129165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -