SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O10310 Cluster: Uncharacterized 17.0 kDa protein; n=12;...   140   2e-32
UniRef50_Q462C7 Cluster: Orf38; n=7; Nucleopolyhedrovirus|Rep: O...   104   2e-21
UniRef50_Q9YMS0 Cluster: LdOrf-54 peptide; n=10; Nucleopolyhedro...    81   2e-14
UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;...    81   3e-14
UniRef50_A1YRA1 Cluster: Late expression factor-10; n=2; Nucleop...    63   8e-09
UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9; Nucl...    53   6e-06
UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep: ...    49   1e-04
UniRef50_Q9PYM5 Cluster: ORF171; n=1; Xestia c-nigrum granulovir...    44   0.004
UniRef50_Q6QXI2 Cluster: ORF122; n=1; Agrotis segetum granulovir...    44   0.004
UniRef50_Q9DVS1 Cluster: PxORF112 peptide; n=1; Plutella xyloste...    44   0.005
UniRef50_Q6LCD2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_Q4UIM6 Cluster: Putative uncharacterized protein; n=3; ...    42   0.012
UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6; Nucleopolyh...    42   0.020
UniRef50_Q2QN37 Cluster: Zinc finger, C3HC4 type family protein,...    42   0.020
UniRef50_A2E9K3 Cluster: Putative uncharacterized protein; n=1; ...    41   0.027
UniRef50_Q01HI7 Cluster: OSIGBa0142I02-OSIGBa0101B20.2 protein; ...    40   0.082
UniRef50_A0D0N1 Cluster: Chromosome undetermined scaffold_33, wh...    39   0.14 
UniRef50_A0CBE9 Cluster: Chromosome undetermined scaffold_164, w...    39   0.14 
UniRef50_Q0U9D9 Cluster: Predicted protein; n=1; Phaeosphaeria n...    39   0.14 
UniRef50_Q8B562 Cluster: ORF53-like protein; n=6; Granulovirus|R...    38   0.25 
UniRef50_A3LVZ3 Cluster: Predicted protein; n=1; Pichia stipitis...    38   0.33 
UniRef50_Q57ZW8 Cluster: Putative uncharacterized protein; n=2; ...    37   0.44 
UniRef50_Q8H562 Cluster: C3HC4-type RING zinc finger protein-lik...    37   0.58 
UniRef50_A0E9M6 Cluster: Chromosome undetermined scaffold_85, wh...    37   0.58 
UniRef50_UPI0000499FA8 Cluster: hypothetical protein 41.t00023; ...    36   0.76 
UniRef50_Q0JPN4 Cluster: Os01g0212700 protein; n=3; Oryza sativa...    36   0.76 
UniRef50_A5AZN2 Cluster: Putative uncharacterized protein; n=1; ...    36   0.76 
UniRef50_Q4E1T1 Cluster: Putative uncharacterized protein; n=2; ...    36   0.76 
UniRef50_A7PSE2 Cluster: Chromosome chr14 scaffold_27, whole gen...    36   1.0  
UniRef50_A7PC80 Cluster: Chromosome chr2 scaffold_11, whole geno...    36   1.0  
UniRef50_A6RAV2 Cluster: Predicted protein; n=1; Ajellomyces cap...    36   1.0  
UniRef50_Q7XP61 Cluster: OSJNBa0013K16.6 protein; n=3; Oryza sat...    36   1.3  
UniRef50_Q2A9M7 Cluster: C3HC4 type (RING finger) Zinc finger co...    36   1.3  
UniRef50_Q1LYW2 Cluster: At4g33565; n=2; Arabidopsis thaliana|Re...    36   1.3  
UniRef50_Q0E2D7 Cluster: Os02g0249300 protein; n=5; Oryza sativa...    36   1.3  
UniRef50_A7R0H9 Cluster: Chromosome undetermined scaffold_309, w...    36   1.3  
UniRef50_Q23ZD4 Cluster: Zinc finger protein; n=1; Tetrahymena t...    36   1.3  
UniRef50_Q0UQS4 Cluster: Putative uncharacterized protein; n=1; ...    36   1.3  
UniRef50_Q8H564 Cluster: Putative uncharacterized protein OJ1714...    35   1.8  
UniRef50_Q2HTN3 Cluster: Zinc finger, RING-type; n=1; Medicago t...    35   1.8  
UniRef50_Q0JNA3 Cluster: Os01g0311400 protein; n=6; Oryza sativa...    35   1.8  
UniRef50_A7Q662 Cluster: Chromosome undetermined scaffold_55, wh...    35   1.8  
UniRef50_Q8LF65 Cluster: RING-H2 finger protein ATL4G; n=1; Arab...    35   1.8  
UniRef50_Q84W40 Cluster: RING-H2 finger protein ATL1N precursor;...    35   1.8  
UniRef50_Q94IZ7 Cluster: Ring-H2 zinc finger protein-like; n=2; ...    35   2.3  
UniRef50_Q6K5E4 Cluster: RING-H2 zinc finger protein ATL6-like; ...    35   2.3  
UniRef50_Q2QYS1 Cluster: Zinc finger, C3HC4 type family protein;...    35   2.3  
UniRef50_A7R0H3 Cluster: Chromosome undetermined scaffold_309, w...    35   2.3  
UniRef50_A5BQU5 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_A3BZR6 Cluster: Putative uncharacterized protein; n=2; ...    35   2.3  
UniRef50_A4VEQ2 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_A0BFU7 Cluster: Chromosome undetermined scaffold_105, w...    35   2.3  
UniRef50_Q8SUM5 Cluster: Putative uncharacterized protein ECU08_...    35   2.3  
UniRef50_Q9LF64 Cluster: Probable RING-H2 finger protein ATL5G; ...    35   2.3  
UniRef50_Q6ZHC6 Cluster: Putative ring finger protein; n=1; Oryz...    34   3.1  
UniRef50_Q10LP6 Cluster: Zinc finger, C3HC4 type family protein;...    34   3.1  
UniRef50_A0EA28 Cluster: Chromosome undetermined scaffold_85, wh...    34   3.1  
UniRef50_Q71X52 Cluster: Conserved domain protein; n=1; Listeria...    34   4.1  
UniRef50_A0FZL4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_Q5Z5G0 Cluster: EL5-like; n=1; Oryza sativa (japonica c...    34   4.1  
UniRef50_A7PJE0 Cluster: Chromosome chr12 scaffold_18, whole gen...    34   4.1  
UniRef50_A0DMN6 Cluster: Chromosome undetermined scaffold_57, wh...    34   4.1  
UniRef50_A0CZE6 Cluster: Chromosome undetermined scaffold_32, wh...    34   4.1  
UniRef50_Q9SN27 Cluster: RING-H2 finger protein ATL4F; n=2; Arab...    34   4.1  
UniRef50_Q8RXX9 Cluster: RING-H2 finger protein ATL3B precursor;...    34   4.1  
UniRef50_Q9SRQ8 Cluster: RING-H2 finger protein ATL3A; n=2; Arab...    34   4.1  
UniRef50_Q8LFY8 Cluster: RING-H2 finger protein ATL1O; n=1; Arab...    34   4.1  
UniRef50_O49869 Cluster: Ring finger protein; n=1; Hordeum vulga...    33   5.4  
UniRef50_A7Q7T5 Cluster: Chromosome chr18 scaffold_61, whole gen...    33   5.4  
UniRef50_A7NUT1 Cluster: Chromosome chr18 scaffold_1, whole geno...    33   5.4  
UniRef50_A5ARE6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_A2ZCI6 Cluster: Putative uncharacterized protein; n=2; ...    33   5.4  
UniRef50_A2FK55 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_A0D2R8 Cluster: Chromosome undetermined scaffold_35, wh...    33   5.4  
UniRef50_Q8QLA0 Cluster: LEF-10; n=5; Nucleopolyhedrovirus|Rep: ...    33   7.1  
UniRef50_Q9FHU0 Cluster: Similarity to RING zinc finger protein;...    33   7.1  
UniRef50_Q6Z5I2 Cluster: Zinc finger (C3HC4-type RING finger)-li...    33   7.1  
UniRef50_Q5VNT3 Cluster: Transcription factor X2-like; n=4; Oryz...    33   7.1  
UniRef50_Q2QSD5 Cluster: Zinc finger, C3HC4 type family protein,...    33   7.1  
UniRef50_A5BL01 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_Q22Z51 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_A0CWZ2 Cluster: Chromosome undetermined scaffold_3, who...    33   7.1  
UniRef50_Q59Z69 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_UPI0000F34576 Cluster: Zinc/RING finger protein 3 precu...    33   9.4  
UniRef50_Q08F26 Cluster: N1R-like RING finger host range protein...    33   9.4  
UniRef50_Q0JQI1 Cluster: Os01g0159300 protein; n=4; Oryza sativa...    33   9.4  
UniRef50_A7QJW3 Cluster: Chromosome undetermined scaffold_108, w...    33   9.4  
UniRef50_A7NUS9 Cluster: Chromosome chr18 scaffold_1, whole geno...    33   9.4  
UniRef50_A5Y773 Cluster: RING-H2 zinc finger; n=1; Triticum aest...    33   9.4  
UniRef50_A5AMA9 Cluster: Putative uncharacterized protein; n=1; ...    33   9.4  
UniRef50_Q5CY07 Cluster: Ring domain protein, possible 4 transme...    33   9.4  
UniRef50_A2G637 Cluster: Putative uncharacterized protein; n=1; ...    33   9.4  
UniRef50_A0DGD2 Cluster: Chromosome undetermined scaffold_5, who...    33   9.4  
UniRef50_A0C261 Cluster: Chromosome undetermined scaffold_143, w...    33   9.4  
UniRef50_Q5SSZ7 Cluster: Zinc/RING finger protein 3 precursor; n...    33   9.4  
UniRef50_Q9ULT6 Cluster: Zinc/RING finger protein 3 precursor; n...    33   9.4  
UniRef50_Q12483 Cluster: Vacuolar-sorting protein SNF8; n=5; Sac...    33   9.4  
UniRef50_Q7Z569 Cluster: BRCA1-associated protein; n=31; Eumetaz...    33   9.4  
UniRef50_Q8L9W3 Cluster: RING-H2 finger protein ATL5J; n=2; Arab...    33   9.4  
UniRef50_Q9LX93 Cluster: RING-H2 finger protein ATL5F; n=1; Arab...    33   9.4  

>UniRef50_O10310 Cluster: Uncharacterized 17.0 kDa protein; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 17.0 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 146

 Score =  140 bits (340), Expect = 2e-32
 Identities = 57/101 (56%), Positives = 72/101 (71%)
 Frame = +3

Query: 3   MFCTVCLKDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQ 182
           M  TV LKD+ YY+FKLF++ WP+CTTEC+ICLE +   GG+V +PD G+LNL+KMFH +
Sbjct: 1   MLLTVYLKDKQYYLFKLFREIWPSCTTECRICLETLGTEGGVVGVPDNGLLNLDKMFHAE 60

Query: 183 CIQRWRREHTRDPFNRAIKYYFNFPQKR*RNATRCFEKPKG 305
           CI+RW+R   RDPFNRAIKYYF FP           E  +G
Sbjct: 61  CIERWKRGRNRDPFNRAIKYYFAFPPPTLHECKALLEHTRG 101



 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 39/71 (54%), Positives = 46/71 (64%)
 Frame = +2

Query: 236 KILF*LSPKTLEECNAMLRETKGFIGDHEIDCVYKRVYQRVTQEDALDIELDFRNFFKKC 415
           K  F   P TL EC A+L  T+GFIGD E+D VY  V+QRVT EDALD+EL+F  FFK  
Sbjct: 79  KYYFAFPPPTLHECKALLEHTRGFIGDDEMDRVYSLVHQRVTTEDALDVELNFARFFK-- 136

Query: 416 NHDERMVRDGR 448
             D R V  G+
Sbjct: 137 -DDARAVGGGQ 146


>UniRef50_Q462C7 Cluster: Orf38; n=7; Nucleopolyhedrovirus|Rep:
           Orf38 - Trichoplusia ni SNPV
          Length = 151

 Score =  104 bits (250), Expect = 2e-21
 Identities = 45/101 (44%), Positives = 66/101 (65%)
 Frame = +3

Query: 3   MFCTVCLKDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQ 182
           M  TV L++++ Y++K FK  W     ECQIC + I+ N G++A+ +   LNLEKMFH+ 
Sbjct: 1   MLITVNLQNKDEYIYKTFKRMWNEYKIECQICFDLIE-NDGVIAVTEYRTLNLEKMFHQS 59

Query: 183 CIQRWRREHTRDPFNRAIKYYFNFPQKR*RNATRCFEKPKG 305
           C++RW+RE  RDPFNR +K++F+FP K     +   E  KG
Sbjct: 60  CLKRWQRERNRDPFNRNVKFWFDFPPKSLEQCSALLEHMKG 100



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 1/54 (1%)
 Frame = +2

Query: 236 KILF*LSPKTLEECNAMLRETKGFIGDHEIDCVYKRVYQRVTQEDA-LDIELDF 394
           K  F   PK+LE+C+A+L   KGFIGD + D  Y   Y R+ +E++ +DIELDF
Sbjct: 78  KFWFDFPPKSLEQCSALLEHMKGFIGDQQPDKDYADEYNRIVKENSVIDIELDF 131


>UniRef50_Q9YMS0 Cluster: LdOrf-54 peptide; n=10;
           Nucleopolyhedrovirus|Rep: LdOrf-54 peptide - Lymantria
           dispar multicapsid nuclear polyhedrosis virus (LdMNPV)
          Length = 142

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 5/99 (5%)
 Frame = +3

Query: 24  KDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR 203
           +D+  Y+F+ F   W   + EC IC ++I D+ G++ + +   LNLEKMFH  C +RW  
Sbjct: 9   RDKREYLFRTFNRLWRRVSVECCICFDRIGDD-GLIIVSEHATLNLEKMFHVACFERWAL 67

Query: 204 EHT-----RDPFNRAIKYYFNFPQKR*RNATRCFEKPKG 305
                   RDPFNR +KY FNFP K         E+ +G
Sbjct: 68  SSASANGRRDPFNRNVKYKFNFPPKTKGECASLLEQIRG 106



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)
 Frame = +2

Query: 236 KILF*LSPKTLEECNAMLRETKGFIGDHEIDCVYKRVYQRVTQEDALDIELDFRNFFK 409
           K  F   PKT  EC ++L + +GFIG+  +D +Y   YQR+  ED LD+E+DF    +
Sbjct: 84  KYKFNFPPKTKGECASLLEQIRGFIGEQSVDRLYSDEYQRIMGEDRLDLEVDFEKLLR 141


>UniRef50_O10312 Cluster: Uncharacterized 42.5 kDa protein; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 42.5 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 378

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 36/69 (52%), Positives = 47/69 (68%)
 Frame = +3

Query: 513 MCSTKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDML 692
           M   KK + L+ C SVKL P +P+R  K MQCW+HPRRA C+V R R+ Y D  NE+ +L
Sbjct: 1   MSCAKKLVTLNPCTSVKLVPHRPIRATK-MQCWMHPRRATCRVQRLRDAYHDERNESSLL 59

Query: 693 HMTVLNSVF 719
           HMTV + +F
Sbjct: 60  HMTVYSDIF 68


>UniRef50_A1YRA1 Cluster: Late expression factor-10; n=2;
           Nucleopolyhedrovirus|Rep: Late expression factor-10 -
           Maruca vitrata MNPV
          Length = 78

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 31/48 (64%), Positives = 34/48 (70%)
 Frame = +2

Query: 509 LNVFDQETDQVRPLCLGEINXXXXXXXXXXXXMLDTSSTSELQSNAST 652
           LNVFDQE DQ+R +CLGEI+            MLDTSSTSELQSNAST
Sbjct: 31  LNVFDQEKDQIRSMCLGEIDTFQTDATAEANAMLDTSSTSELQSNAST 78



 Score = 41.5 bits (93), Expect = 0.020
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = +3

Query: 420 MTNVWSATDVNLINCVLKDNLFL 488
           MTNV  A+DV+LINC+LKDNLFL
Sbjct: 1   MTNVLFASDVDLINCILKDNLFL 23


>UniRef50_Q9J832 Cluster: ORF105 vp1054 virion protein; n=9;
           Nucleopolyhedrovirus|Rep: ORF105 vp1054 virion protein -
           Spodoptera exigua MNPV
          Length = 346

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 27/62 (43%), Positives = 41/62 (66%)
 Frame = +3

Query: 534 IKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNS 713
           ++L+ CAS KLTPF+P++     QC IH  RANCKV +  +  +D + +N   H+T+LN 
Sbjct: 10  VRLNRCASEKLTPFRPIKVTS-TQCPIHLFRANCKVIKRYDAENDTNFDN---HLTILNG 65

Query: 714 VF 719
           V+
Sbjct: 66  VY 67


>UniRef50_A0EYU2 Cluster: Vp1054; n=2; Nucleopolyhedrovirus|Rep:
           Vp1054 - Ecotropis obliqua NPV
          Length = 366

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 21/49 (42%), Positives = 28/49 (57%)
 Frame = +3

Query: 513 MCSTKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNN 659
           M STK  +K   C S KLT FKP++ P    C  HP RANC+  +  ++
Sbjct: 1   MSSTKNVVKFKQCVSEKLTVFKPLKRPPRTVCRFHPLRANCRAIKQHDD 49


>UniRef50_Q9PYM5 Cluster: ORF171; n=1; Xestia c-nigrum
           granulovirus|Rep: ORF171 - Xestia c-nigrum granulosis
           virus (XnGV) (Xestia c-nigrumgranulovirus)
          Length = 139

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 1/59 (1%)
 Frame = +3

Query: 84  ECQICLEKIDD-NGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFP 257
           EC IC   ID  + G++ +   GM +LE +F ++C  +++R    DP+ R+I++ F FP
Sbjct: 29  ECAICCGTIDKYHSGVIVITCGGMADLEHLFCKECDVKFKR---NDPYKRSIEFKFAFP 84


>UniRef50_Q6QXI2 Cluster: ORF122; n=1; Agrotis segetum
           granulovirus|Rep: ORF122 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 136

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +3

Query: 84  ECQICLEKIDD-NGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFP 257
           EC +C + ID+ N G V +   G  +LE +F   C +++RR+   DP+ R I + F FP
Sbjct: 28  ECAVCYDIIDEKNKGCVYITCDGKADLEHIFCADCAKKFRRQ---DPYKRPIAFKFEFP 83


>UniRef50_Q9DVS1 Cluster: PxORF112 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF112 peptide - Plutella xylostella
           granulovirus
          Length = 137

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +3

Query: 84  ECQICLEKIDDNG-GIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFPQ 260
           EC IC   ID+N  G++ +  TGM +LE +F   C  ++ +   +DP+ R I Y   +P 
Sbjct: 29  ECAICCSAIDENHKGVINITSTGMADLEHLFCMDCHLKFLK---KDPYKRDIMYRHTYPF 85

Query: 261 KR*RNATRCFEKPK 302
           +   +A    ++ K
Sbjct: 86  ESDEDAREFIKRSK 99


>UniRef50_Q6LCD2 Cluster: Putative uncharacterized protein; n=1;
           Choristoneura fumiferana MNPV|Rep: Putative
           uncharacterized protein - Choristoneura fumiferana
           nuclear polyhedrosis virus (CfMNPV)
          Length = 114

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = -3

Query: 248 KIIFYSTIKRISSVFATPTLNALFVKHFFQV*HASVGHCHYAPVIVNFLKTYLAFCCAR 72
           KI+   T++R+ +V   P  NAL V+HF QV    VGH  +A +     +T  AF CAR
Sbjct: 56  KIVPDGTVERVPAVPVFPPRNALGVEHFVQVEQPVVGHADHAALNPQRFQTNSAFGCAR 114


>UniRef50_Q4UIM6 Cluster: Putative uncharacterized protein; n=3;
           Theileria|Rep: Putative uncharacterized protein -
           Theileria annulata
          Length = 598

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 1/84 (1%)
 Frame = +2

Query: 134 NARHWHVKLGKNVSRTMHSALASRTHSRSF*SCYKILF*LSPKTLEECNAMLRETKGF-I 310
           N+   H+KL KNVS +   A  S T +R    C +     +P  +  CN ++ E   F  
Sbjct: 277 NSETSHLKLSKNVSYSYSKASISGTVNRII--CVRDNKNGTPFVIGSCN-IIGEIGNFEF 333

Query: 311 GDHEIDCVYKRVYQRVTQEDALDI 382
           GD   +CV++ +YQR+TQE + DI
Sbjct: 334 GDLATNCVFEGIYQRLTQEFSDDI 357


>UniRef50_Q91BH6 Cluster: VP1054 virion protein; n=6;
           Nucleopolyhedrovirus|Rep: VP1054 virion protein -
           Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 352

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 23/67 (34%), Positives = 33/67 (49%)
 Frame = +3

Query: 519 STKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHM 698
           +T    K + C S K   FKP+   K  QC IHP RANC+V +    + + D +  + H 
Sbjct: 12  ATTTTTKYNQCVSEKSVSFKPITFRKS-QCPIHPLRANCRVIK---TFDEDDGKEIVYHF 67

Query: 699 TVLNSVF 719
           T +   F
Sbjct: 68  TFIEGYF 74


>UniRef50_Q2QN37 Cluster: Zinc finger, C3HC4 type family protein,
           expressed; n=3; Oryza sativa|Rep: Zinc finger, C3HC4
           type family protein, expressed - Oryza sativa subsp.
           japonica (Rice)
          Length = 258

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +TEC ICLE+  D  G++       L  + +FH  C++RW R  +  P+ RA
Sbjct: 205 STECSICLERCGDADGLLE------LRCKHIFHSACLERWLRSRSDCPYCRA 250


>UniRef50_A2E9K3 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 219

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +3

Query: 63  YWPTCTTE--CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           Y P C  E  C ICLE+ ++N  +V +P       +  FHE C+Q W + H+  P
Sbjct: 161 YTPGCCAENVCSICLEEFNENDEVVILP------CKHGFHEPCLQPWLKMHSECP 209


>UniRef50_Q01HI7 Cluster: OSIGBa0142I02-OSIGBa0101B20.2 protein;
           n=6; Oryza sativa|Rep: OSIGBa0142I02-OSIGBa0101B20.2
           protein - Oryza sativa (Rice)
          Length = 383

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TT+C +CL +  D   +  +P          FH+QCI  W + H+  P  RA
Sbjct: 154 TTDCSVCLGEFSDGESLRLLP-----RCSHAFHQQCIDTWLKSHSNCPLCRA 200


>UniRef50_A0D0N1 Cluster: Chromosome undetermined scaffold_33, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_33,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 435

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 5/77 (6%)
 Frame = +3

Query: 21  LKDRNYYMFKLFKDYWPTCTTECQICLE--KIDDNGGIVAMP---DTGMLNLEKMFHEQC 185
           L++ N   F+  K+       EC ICL+  +IDDN   V +P   D G   +  +FH++C
Sbjct: 354 LENLNSQKFQDLKNQDTNIHEECSICLQTYQIDDN--CVRLPCNVDGGNKKINHIFHDEC 411

Query: 186 IQRWRREHTRDPFNRAI 236
           I+ W ++    P  R I
Sbjct: 412 IRIWIQDQGSCPICRTI 428


>UniRef50_A0CBE9 Cluster: Chromosome undetermined scaffold_164,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_164,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 306

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = +3

Query: 75  CTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C  +C IC E+I+D   I+ +P     + + +FH QC ++W  +  R P  R
Sbjct: 241 CNLDCPICYEQINDADTIIQLP----CHQKHLFHSQCCKQWLFQDLRCPLCR 288


>UniRef50_Q0U9D9 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 140

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 1/82 (1%)
 Frame = +3

Query: 24  KDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMF-HEQCIQRWR 200
           ++R   +   F     TC  +C ICLE I DNGG         L L K F H QC+  W 
Sbjct: 9   EERRCELLVTFTTAIKTCEEDCSICLEPITDNGG-------HQLPLCKHFYHYQCLLTWT 61

Query: 201 REHTRDPFNRAIKYYFNFPQKR 266
            +++  P  R   +    P+++
Sbjct: 62  EQNSTCPMCRQEMFVPAKPERK 83


>UniRef50_Q8B562 Cluster: ORF53-like protein; n=6; Granulovirus|Rep:
           ORF53-like protein - Choristoneura fumiferana
           granulovirus (CfGV)
          Length = 112

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +3

Query: 84  ECQICLEKIDDN-GGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFPQ 260
           EC IC+++I++N  G V +    + +LE++  ++C + + +    DP+ R I Y F +P 
Sbjct: 5   ECAICVQEINNNEKGFVYITFGQIADLERLMCKRCDKLYEK---HDPYKREILYRFEYPF 61

Query: 261 KR*RNATRCFEKPK 302
               +A    EK K
Sbjct: 62  INNEHAKAFVEKSK 75


>UniRef50_A3LVZ3 Cluster: Predicted protein; n=1; Pichia
           stipitis|Rep: Predicted protein - Pichia stipitis
           (Yeast)
          Length = 554

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 24/64 (37%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
 Frame = +3

Query: 69  PTCTTECQICLEKI---DDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIK 239
           P  T EC ICLE I   DD G IV+   T      K +H++CI +W       P  R   
Sbjct: 7   PNDTEECTICLEPILPTDDIGTIVSCCTT---TTNKYYHDKCILQWANNSNSCPTCRRRF 63

Query: 240 YYFN 251
           Y  N
Sbjct: 64  YKIN 67


>UniRef50_Q57ZW8 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma brucei
          Length = 459

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 18/47 (38%), Positives = 21/47 (44%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRD 218
           T EC ICL+  D   G V +P          FH  C QRW  EH  +
Sbjct: 314 TDECNICLDTFDVTSGCVWLP------CGHFFHTSCAQRWLTEHVAE 354


>UniRef50_Q8H562 Cluster: C3HC4-type RING zinc finger protein-like;
           n=6; Oryza sativa|Rep: C3HC4-type RING zinc finger
           protein-like - Oryza sativa subsp. japonica (Rice)
          Length = 182

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T C +CLE   D   + A+PD G L     FH +C+  W R+    P  R
Sbjct: 114 TCCPVCLENYGDGDVLRALPDCGHL-----FHRECVDPWLRQRPTCPVCR 158


>UniRef50_A0E9M6 Cluster: Chromosome undetermined scaffold_85, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_85,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 140

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 18/52 (34%), Positives = 27/52 (51%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T++C ICL +      +  +P     N +  FH+QCIQ W +  +  PF RA
Sbjct: 87  TSQCAICLNEYQKGEIVYILP----CNSKHYFHQQCIQNWIQYQSICPFCRA 134


>UniRef50_UPI0000499FA8 Cluster: hypothetical protein 41.t00023;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 41.t00023 - Entamoeba histolytica HM-1:IMSS
          Length = 276

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +C ICL  I+D+  ++      +     +FH++CIQ W +EH   P+ R
Sbjct: 228 DCPICLCLIEDSNDVL------LTKCSHIFHKECIQMWLKEHDDCPYCR 270


>UniRef50_Q0JPN4 Cluster: Os01g0212700 protein; n=3; Oryza
           sativa|Rep: Os01g0212700 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 261

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL ++D    +  +P  G L     FH +C+  W R H+  P  RA
Sbjct: 174 DCAVCLGQVDAGEKVRQLPKCGHL-----FHAECVDAWLRAHSTCPMCRA 218


>UniRef50_A5AZN2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 126

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 4/76 (5%)
 Frame = +3

Query: 3   MFCTVCLKDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMP----DTGMLNLEKM 170
           + C V  + R +Y F  + ++W +C T     L  + D+G ++  P    DT  L     
Sbjct: 54  LHCLVHQQPRKWYSFLPWPEFWYSCPT-----LPPLTDDGALIIEPAEIIDTRWLKKLGK 108

Query: 171 FHEQCIQRWRREHTRD 218
           F E+C+ +W+     D
Sbjct: 109 FFEECLVKWKHLSVED 124


>UniRef50_Q4E1T1 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 241

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 19/52 (36%), Positives = 26/52 (50%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           ++ C ICL+ I  +G  V +     L     FH+ CI+ W REH   P  RA
Sbjct: 183 SSSCPICLDSIVGSGVPVVI-----LPCRHCFHKNCIREWLREHPECPLCRA 229


>UniRef50_A7PSE2 Cluster: Chromosome chr14 scaffold_27, whole genome
           shotgun sequence; n=4; core eudicotyledons|Rep:
           Chromosome chr14 scaffold_27, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 357

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +DN  +  +P       + +FH +CI  W   H   P  RA
Sbjct: 79  ECAVCLNEFEDNETLRLIP-----KCDHVFHPECIDAWLASHVTCPVCRA 123


>UniRef50_A7PC80 Cluster: Chromosome chr2 scaffold_11, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr2 scaffold_11, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 359

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 15/51 (29%), Positives = 24/51 (47%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL + ++   +  +P          FH QCI  W + H+  P  RA
Sbjct: 140 TDCSVCLSEFEEEESLRLLP-----KCSHAFHVQCIDTWLKSHSNCPLCRA 185


>UniRef50_A6RAV2 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 652

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 6/64 (9%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRR------EHTRDPFNRAIKYYF 248
           C +CLE++D+  G++       +  + +FH  C+Q+W+        +T+D F++   + F
Sbjct: 266 CPVCLERMDETTGLLT------IICQHVFHCTCLQKWKGSGCPVCRYTQDEFSKRAAHAF 319

Query: 249 NFPQ 260
           +F Q
Sbjct: 320 DFDQ 323


>UniRef50_Q7XP61 Cluster: OSJNBa0013K16.6 protein; n=3; Oryza sativa
           (japonica cultivar-group)|Rep: OSJNBa0013K16.6 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 192

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 22/74 (29%), Positives = 30/74 (40%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFPQ 260
           +EC ICL   +    +  +P  G       FH  CI +W R H+  P  R I      PQ
Sbjct: 106 SECAICLSDFEHGDAMRVLPQCG-----HAFHAACIDKWLRGHSSCPSCRRI-LVLQLPQ 159

Query: 261 KR*RNATRCFEKPK 302
                  RC  +P+
Sbjct: 160 G--ERCQRCGARPE 171


>UniRef50_Q2A9M7 Cluster: C3HC4 type (RING finger) Zinc finger
           containing protein; n=1; Brassica oleracea|Rep: C3HC4
           type (RING finger) Zinc finger containing protein -
           Brassica oleracea (Wild cabbage)
          Length = 185

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/53 (35%), Positives = 23/53 (43%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYY 245
           C ICLE+++  G I       M N    FH+ CI RW R     P  R    Y
Sbjct: 135 CGICLEELNPRGEIYF----DMPNCSHQFHDLCISRWLRRSKTCPLCRTFSDY 183


>UniRef50_Q1LYW2 Cluster: At4g33565; n=2; Arabidopsis thaliana|Rep:
           At4g33565 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 204

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL + ++   +  +P       +  FH  CI  W R HT  P  RA
Sbjct: 52  TDCSVCLSEFEEEETLRLLP-----KCKHAFHLYCIDTWLRSHTNCPLCRA 97


>UniRef50_Q0E2D7 Cluster: Os02g0249300 protein; n=5; Oryza
           sativa|Rep: Os02g0249300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 199

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/50 (34%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL  + D   + A+P  G       FH  C+  W R H   P  RA
Sbjct: 119 ECAVCLSGMQDGDAVRALPGCG-----HAFHAGCVDAWLRAHGTCPVCRA 163


>UniRef50_A7R0H9 Cluster: Chromosome undetermined scaffold_309,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_309, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 309

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T EC +CL + +D   +  +P       + +FH  CI  W   HT  P  RA
Sbjct: 90  TLECAVCLSEFEDEETLRLLP-----KCDHVFHPNCIDAWLAFHTTCPVCRA 136


>UniRef50_Q23ZD4 Cluster: Zinc finger protein; n=1; Tetrahymena
           thermophila SB210|Rep: Zinc finger protein - Tetrahymena
           thermophila SB210
          Length = 692

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 19/63 (30%), Positives = 30/63 (47%)
 Frame = +3

Query: 48  KLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFN 227
           K  K   P    EC ICL    ++  IV +      + + +FH+QCI+ W ++    P  
Sbjct: 631 KFVKSDNPDQVKECSICLNDYQNDETIVILN----CDSKHIFHQQCIETWVKQKDECPLC 686

Query: 228 RAI 236
           RA+
Sbjct: 687 RAV 689


>UniRef50_Q0UQS4 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 505

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC IC+++++    +  +P       +  FH QC+  W REH   P  R
Sbjct: 357 ECSICMDEVNIGEEVTVLP------CKHWFHHQCVSAWLREHDTCPHCR 399


>UniRef50_Q8H564 Cluster: Putative uncharacterized protein
           OJ1714_H10.108; n=2; Oryza sativa|Rep: Putative
           uncharacterized protein OJ1714_H10.108 - Oryza sativa
           subsp. japonica (Rice)
          Length = 187

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T  T C +CLE       + A+P+ G L     FH  CI  W R     P  RA
Sbjct: 127 TAQTSCAVCLESYGGGDVLRALPECGHL-----FHRDCIFTWLRRRPTCPVCRA 175


>UniRef50_Q2HTN3 Cluster: Zinc finger, RING-type; n=1; Medicago
           truncatula|Rep: Zinc finger, RING-type - Medicago
           truncatula (Barrel medic)
          Length = 361

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D   +  +P       + +FH +CI  W   HT  P  RA
Sbjct: 119 ECAVCLMEFEDTETLRLIP-----KCDHVFHPECIDEWLSSHTTCPVCRA 163


>UniRef50_Q0JNA3 Cluster: Os01g0311400 protein; n=6; Oryza
           sativa|Rep: Os01g0311400 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 256

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ ++ D     A+P  G       FH  C+  W R HT  P  RA
Sbjct: 183 ECAVCIAELRDGDECRALPRCG-----HRFHASCVDGWLRLHTTCPLCRA 227


>UniRef50_A7Q662 Cluster: Chromosome undetermined scaffold_55, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_55, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 379

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC +CL + +++  +  +P          FH  CI  W   HT  P  RA
Sbjct: 155 TECSVCLAEFEEDEAVRLLP-----KCNHAFHIPCIDTWLSSHTNCPMCRA 200


>UniRef50_Q8LF65 Cluster: RING-H2 finger protein ATL4G; n=1;
           Arabidopsis thaliana|Rep: RING-H2 finger protein ATL4G -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 235

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/50 (34%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL +  DN     MP     N +  FH  CI  W   H+  P  R+
Sbjct: 75  ECSVCLSEFKDNESGRVMP-----NCKHTFHVHCIDMWFHSHSSCPLCRS 119


>UniRef50_Q84W40 Cluster: RING-H2 finger protein ATL1N precursor;
           n=4; Arabidopsis thaliana|Rep: RING-H2 finger protein
           ATL1N precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 404

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D+  +  +P         +FH  CI  W R HT  P  RA
Sbjct: 143 ECSVCLNEFEDDETLRLIPKCC-----HVFHPGCIDAWLRSHTTCPLCRA 187


>UniRef50_Q94IZ7 Cluster: Ring-H2 zinc finger protein-like; n=2;
           Oryza sativa|Rep: Ring-H2 zinc finger protein-like -
           Oryza sativa subsp. japonica (Rice)
          Length = 237

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL ++ D   +  +P     N   +FH +C+  W R  T  P  RA
Sbjct: 128 DCAVCLSELADGEKVRELP-----NCRHVFHVECVDAWLRSRTTCPLCRA 172


>UniRef50_Q6K5E4 Cluster: RING-H2 zinc finger protein ATL6-like;
           n=4; Oryza sativa|Rep: RING-H2 zinc finger protein
           ATL6-like - Oryza sativa subsp. japonica (Rice)
          Length = 392

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ + DD+  +  +P         +FH+ CI  W   H   P  RA
Sbjct: 124 ECAVCISEFDDDETLRLLP-----KCSHVFHQDCIDTWLASHATCPVCRA 168


>UniRef50_Q2QYS1 Cluster: Zinc finger, C3HC4 type family protein;
           n=2; Oryza sativa (japonica cultivar-group)|Rep: Zinc
           finger, C3HC4 type family protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 105

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 14/48 (29%), Positives = 23/48 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           + EC +CL  +D+   +  +P  G      +FH++CI  W   H   P
Sbjct: 4   SVECAVCLSVVDEGEKVRQLPACG-----HVFHQECINMWLSSHASCP 46


>UniRef50_A7R0H3 Cluster: Chromosome undetermined scaffold_309,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_309, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 372

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC +CL + +++  +  +P          FH  CI  W R H   P  RA
Sbjct: 127 TECSVCLGEFEEDESLRLLP-----KCSHAFHVPCIDTWLRSHKNCPLCRA 172


>UniRef50_A5BQU5 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 371

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC +CL + +++  +  +P          FH  CI  W R H   P  RA
Sbjct: 126 TECSVCLGEFEEDESLRLLP-----KCSHAFHVPCIDTWLRSHKNCPLCRA 171


>UniRef50_A3BZR6 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 441

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ + DD+  +  +P         +FH+ CI  W   H   P  RA
Sbjct: 124 ECAVCISEFDDDETLRLLP-----KCSHVFHQDCIDTWLASHATCPVCRA 168


>UniRef50_A4VEQ2 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 117

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +C ICL   +    +V +P     N    FH++CIQRW + +   P  R
Sbjct: 46  DCSICLSMYEVGDNVVFLP----CNKNHNFHDECIQRWLKVNNSCPVCR 90


>UniRef50_A0BFU7 Cluster: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 488

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           T   +C ICLE++ +    V       L+   MFH +CI++W + HT  P
Sbjct: 433 TTDIDCLICLEQLTNKSANVVSLKCHHLH---MFHMECIKQWFQRHTTCP 479


>UniRef50_Q8SUM5 Cluster: Putative uncharacterized protein
           ECU08_1410; n=1; Encephalitozoon cuniculi|Rep: Putative
           uncharacterized protein ECU08_1410 - Encephalitozoon
           cuniculi
          Length = 252

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           C ICLE  +D GG V   D G       FH++C+ RW R++   P  R+
Sbjct: 191 CIICLEDFED-GGYVRSLDCG-----HAFHKECVDRWLRKNFVCPICRS 233


>UniRef50_Q9LF64 Cluster: Probable RING-H2 finger protein ATL5G;
           n=2; Arabidopsis thaliana|Rep: Probable RING-H2 finger
           protein ATL5G - Arabidopsis thaliana (Mouse-ear cress)
          Length = 362

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFP 257
           ++C +CL + ++N  +  +P          FH  CI  W + H+  P  RA     N P
Sbjct: 140 SDCSVCLSEFEENESLRLLP-----KCNHAFHLPCIDTWLKSHSNCPLCRAFVTGVNNP 193


>UniRef50_Q6ZHC6 Cluster: Putative ring finger protein; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: Putative ring
           finger protein - Oryza sativa subsp. japonica (Rice)
          Length = 189

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           EC ICL + +D   +  +P       +  FH  CI  W R H+  P  R +
Sbjct: 99  ECAICLVEFEDGQAVRVLPQC-----DHRFHAACIDTWLRAHSSCPSCRRV 144


>UniRef50_Q10LP6 Cluster: Zinc finger, C3HC4 type family protein;
           n=2; Oryza sativa|Rep: Zinc finger, C3HC4 type family
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 128

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL ++ D      +P  G       FH +CI RW R ++  PF RA
Sbjct: 44  ECAVCLGEVRDGERGRLLPRCG-----HRFHVECIDRWFRANSTCPFCRA 88


>UniRef50_A0EA28 Cluster: Chromosome undetermined scaffold_85, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_85,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 307

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C IC ++I++N  I+ +P     +L   FH +C  +W  +  R P  R
Sbjct: 248 CPICYQEINENDTIIQLP----CHLNHFFHSKCCMQWLLKDPRCPLCR 291


>UniRef50_Q71X52 Cluster: Conserved domain protein; n=1; Listeria
           monocytogenes str. 4b F2365|Rep: Conserved domain
           protein - Listeria monocytogenes serotype 4b (strain
           F2365)
          Length = 456

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +2

Query: 260 KTLEECNAMLRETKGFIGDHEIDCVYKRVYQRVTQEDALDIELDFRNFFKKCNHD 424
           K +++C +  R  K  +G   ID   + + Q V  ++A  +  DF N+F K NH+
Sbjct: 112 KGIDDCVSAYRNNK--VGKSNIDFAAEIINQMVNYKEAYILVGDFTNYFDKINHE 164


>UniRef50_A0FZL4 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia phymatum STM815|Rep: Putative
           uncharacterized protein - Burkholderia phymatum STM815
          Length = 516

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/47 (29%), Positives = 27/47 (57%)
 Frame = +3

Query: 327 IAFTSAFINALHKKTPWTLNSILGIFLKNAIMTNVWSATDVNLINCV 467
           +  TSA     H+K P+  + +L  F++N I+   +S TD N+++ +
Sbjct: 185 LVLTSADYGEFHRKNPYLASKLLTFFVENPIVFIGYSLTDPNILDII 231


>UniRef50_Q5Z5G0 Cluster: EL5-like; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: EL5-like - Oryza sativa subsp.
           japonica (Rice)
          Length = 348

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/54 (31%), Positives = 24/54 (44%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T   EC +CL+++ D   +  +P          FH  CI  W R H+  P  RA
Sbjct: 117 TVVVECVVCLQELADGDVVRVLPAC-----RHFFHGGCIDLWLRAHSTCPVCRA 165


>UniRef50_A7PJE0 Cluster: Chromosome chr12 scaffold_18, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr12 scaffold_18, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 254

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           TT+C +CL  +++ G I  +    + N +  FH +CI +W   H+  P  R
Sbjct: 117 TTDCAVCLSVLEE-GEIARL----LPNCKHTFHAECIDKWLGTHSTCPICR 162


>UniRef50_A0DMN6 Cluster: Chromosome undetermined scaffold_57, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_57,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 315

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 45  FKLFKDYWPTCT-TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           F+  K+  P+    +C IC ++I+++  ++ +P     + E  FH +C ++W     R P
Sbjct: 242 FRKLKEQRPSMQQNDCPICYQEINESHSVIQLP----CHQEHYFHAECCKQWLGRDPRCP 297

Query: 222 FNR 230
             R
Sbjct: 298 LCR 300


>UniRef50_A0CZE6 Cluster: Chromosome undetermined scaffold_32, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_32,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 315

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = +3

Query: 60  DYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           D W      C IC+++   N  I+ +P +G    +  FHE C++ W
Sbjct: 246 DTWVKEDKNCCICMQEYAHNESILQLPCSG----QHQFHENCVRNW 287


>UniRef50_Q9SN27 Cluster: RING-H2 finger protein ATL4F; n=2;
           Arabidopsis thaliana|Rep: RING-H2 finger protein ATL4F -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 225

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/60 (28%), Positives = 25/60 (41%)
 Frame = +3

Query: 51  LFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           ++K+ +    T+C +CL        +  MP  G       FH +CI  W   HT  P  R
Sbjct: 85  IYKESFTVNDTQCSVCLGDYQAEEKLQQMPSCG-----HTFHMECIDLWLTSHTTCPLCR 139


>UniRef50_Q8RXX9 Cluster: RING-H2 finger protein ATL3B precursor;
           n=2; Arabidopsis thaliana|Rep: RING-H2 finger protein
           ATL3B precursor - Arabidopsis thaliana (Mouse-ear cress)
          Length = 398

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC ICL + +D+  +  +P       + +FH  CI  W   H   P  RA
Sbjct: 127 ECAICLNEFEDDETLRLLP-----KCDHVFHPHCIDAWLEAHVTCPVCRA 171


>UniRef50_Q9SRQ8 Cluster: RING-H2 finger protein ATL3A; n=2;
           Arabidopsis thaliana|Rep: RING-H2 finger protein ATL3A -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 356

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/52 (26%), Positives = 24/52 (46%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +++C +CL +  +N  +  +P          FH  CI  W + H+  P  RA
Sbjct: 156 SSDCSVCLSEFQENESLRLLP-----KCNHAFHVPCIDTWLKSHSNCPLCRA 202


>UniRef50_Q8LFY8 Cluster: RING-H2 finger protein ATL1O; n=1;
           Arabidopsis thaliana|Rep: RING-H2 finger protein ATL1O -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 413

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL + +++  +  +P          FH  CI  W   HT  P  RA
Sbjct: 175 TDCPVCLNEFEEDESLRLLP-----KCNHAFHISCIDTWLSSHTNCPLCRA 220


>UniRef50_O49869 Cluster: Ring finger protein; n=1; Hordeum
           vulgare|Rep: Ring finger protein - Hordeum vulgare
           (Barley)
          Length = 295

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           +EC ICL +  D   I  +P  G       FH  C+  W R H+  P  R +
Sbjct: 207 SECAICLSEFADKEEIRVLPQCG-----HGFHVACVDAWLRAHSSCPSCRRV 253


>UniRef50_A7Q7T5 Cluster: Chromosome chr18 scaffold_61, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_61, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 221

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 17/60 (28%), Positives = 24/60 (40%)
 Frame = +3

Query: 51  LFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +FK+ +    T+C +CL        +  +P  G       FH  CI  W   HT  P  R
Sbjct: 88  VFKESFSVSDTQCSVCLADYQAEDRLQQIPACG-----HTFHMDCIDHWLATHTTCPLCR 142


>UniRef50_A7NUT1 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 381

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC +CL +  ++  +  +P          FH  CI  W   HT  P  RA
Sbjct: 158 TECSVCLSEFQEDETLRLLP-----KCNHAFHIPCIDTWLSSHTNCPLCRA 203


>UniRef50_A5ARE6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 209

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/56 (28%), Positives = 26/56 (46%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYF 248
           T+C +CL + ++   +  +P     N   +FH  CI  W   H+  P  R+  Y F
Sbjct: 58  TDCAVCLGEFEEGEFLKHLP-----NCSHVFHIPCIDTWFESHSNCPLCRSHVYDF 108


>UniRef50_A2ZCI6 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 277

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/54 (29%), Positives = 23/54 (42%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           P    EC +CL +++D      +P  G       FH +C+  W R H   P  R
Sbjct: 118 PPPPLECAVCLAEVEDGEAARFLPRCG-----HGFHAECVDLWLRSHPTCPLCR 166


>UniRef50_A2FK55 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 390

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC IC+ +I +    +  P       +  FH++C+ RW  E    P  RA
Sbjct: 340 TECSICMTEIHEGDETMTTP------CQHSFHKECLSRWMEEKLVCPMCRA 384


>UniRef50_A0D2R8 Cluster: Chromosome undetermined scaffold_35, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_35,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 533

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRRE 206
           TECQICL + D N  +V +  T  L+L   FH+ C+  WR++
Sbjct: 407 TECQICLVEFD-NQDLVKL--TYCLHL---FHQSCLDEWRKK 442


>UniRef50_Q8QLA0 Cluster: LEF-10; n=5; Nucleopolyhedrovirus|Rep:
           LEF-10 - Mamestra configurata NPV-A
          Length = 75

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 19/45 (42%), Positives = 24/45 (53%)
 Frame = +2

Query: 509 LNVFDQETDQVRPLCLGEINXXXXXXXXXXXXMLDTSSTSELQSN 643
           LNV DQ    ++P+CLGEI             + DTS  SELQS+
Sbjct: 29  LNVVDQTCGALKPVCLGEIG-SFQTDKTARYPVSDTSVASELQSD 72


>UniRef50_Q9FHU0 Cluster: Similarity to RING zinc finger protein;
           n=4; Arabidopsis thaliana|Rep: Similarity to RING zinc
           finger protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 208

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = +3

Query: 81  TECQICLEKIDDN--GGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKY 242
           T C ICLE   ++    I+ +PD   L     FH+ CI  W +     P  R + Y
Sbjct: 151 TTCSICLEDFSESHDDNIILLPDCFHL-----FHQNCIFEWLKRQRSCPLCRRVPY 201


>UniRef50_Q6Z5I2 Cluster: Zinc finger (C3HC4-type RING finger)-like
           protein; n=3; Oryza sativa|Rep: Zinc finger (C3HC4-type
           RING finger)-like protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 325

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL +  D   +  +P  G       FH  CI  W R H   P  RA
Sbjct: 107 TDCPVCLGEFRDGELLRLLPKCG-----HAFHVPCIDAWLRAHVNCPLCRA 152


>UniRef50_Q5VNT3 Cluster: Transcription factor X2-like; n=4; Oryza
           sativa|Rep: Transcription factor X2-like - Oryza sativa
           subsp. japonica (Rice)
          Length = 151

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 16/43 (37%), Positives = 17/43 (39%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           P     C IC EK    GG  A  D   L  E  FH  C+  W
Sbjct: 81  PGSDEACGICREKFGMGGGAGASSDPVNLPCEHAFHANCVLAW 123


>UniRef50_Q2QSD5 Cluster: Zinc finger, C3HC4 type family protein,
           expressed; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Zinc finger, C3HC4 type family
           protein, expressed - Oryza sativa subsp. japonica (Rice)
          Length = 185

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +C+  + D   +  +P  G       FH  C+  W R+H   P  RA
Sbjct: 122 QCAVCIAAVKDGDTVRRLPACG-----HAFHAPCVDGWLRDHATCPMCRA 166


>UniRef50_A5BL01 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 269

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 15/51 (29%), Positives = 25/51 (49%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +EC +CL +++D+  +  +P     +    FH  CI  W   HT  P  R+
Sbjct: 91  SECAVCLAELEDDDXVRLLP-----SCHHAFHITCIDEWFVGHTNCPLCRS 136


>UniRef50_Q22Z51 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 318

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 16/66 (24%), Positives = 29/66 (43%)
 Frame = +3

Query: 33  NYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHT 212
           N    + +K+       +C IC  + + +  +V MP     N    FHE+C+++W   + 
Sbjct: 245 NKLTIQCYKEIEQPVEKDCTICFMQYEPDDKLVVMP----CNKLHYFHEECVKKWLERNG 300

Query: 213 RDPFNR 230
             P  R
Sbjct: 301 NCPMCR 306


>UniRef50_A0CWZ2 Cluster: Chromosome undetermined scaffold_3, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_3,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 566

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 16/60 (26%), Positives = 31/60 (51%)
 Frame = +2

Query: 251 LSPKTLEECNAMLRETKGFIGDHEIDCVYKRVYQRVTQEDALDIELDFRNFFKKCNHDER 430
           L   T+E+ + +L E  G +GD E  C Y+ V Q + +E   ++ L    +    N++++
Sbjct: 137 LKHDTVEKPDILLVEVGGTVGDLESTCYYEAVRQMINEEGKDNVGLIMLTYILTLNNEQK 196


>UniRef50_Q59Z69 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 548

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           P+ + EC ICLE I     +  +P        K++H+QCI +W ++    P
Sbjct: 9   PSLSEECMICLESISPFDKVGKVPCCPT----KIYHDQCILQWSQKSNGCP 55


>UniRef50_UPI0000F34576 Cluster: Zinc/RING finger protein 3
           precursor (RING finger protein 203).; n=2; Eutheria|Rep:
           Zinc/RING finger protein 3 precursor (RING finger
           protein 203). - Bos Taurus
          Length = 694

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 155 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 199


>UniRef50_Q08F26 Cluster: N1R-like RING finger host range protein;
           n=7; Poxviridae|Rep: N1R-like RING finger host range
           protein - Deerpox virus W-1170-84
          Length = 245

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 21/69 (30%), Positives = 31/69 (44%)
 Frame = +3

Query: 42  MFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           ++   +DY  + T EC IC+E I D   I       + +   +F   CI  WR+  T  P
Sbjct: 167 LYDFEEDYELSKTKECNICMENIYDKEKIYNRYFGIISSCNHVFCMGCITIWRKNKTTCP 226

Query: 222 FNRAIKYYF 248
             R  K+ F
Sbjct: 227 LCRK-KFIF 234


>UniRef50_Q0JQI1 Cluster: Os01g0159300 protein; n=4; Oryza
           sativa|Rep: Os01g0159300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 501

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           +C ICLE+  DN  +      G+L     FH  C+++W +E    P
Sbjct: 455 KCAICLEEYKDNSLL------GILKCNHDFHTDCVKKWLKEKNSCP 494


>UniRef50_A7QJW3 Cluster: Chromosome undetermined scaffold_108,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_108, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 302

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T+C +CL + +D   +  +P          FH  CI  W + H+  P  R
Sbjct: 128 TDCSVCLSEFEDGENLRLLP-----KCNHAFHLPCIDTWLKSHSSCPLCR 172


>UniRef50_A7NUS9 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 409

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/50 (30%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D+  +  +P         +FH  CI  W   H   P  RA
Sbjct: 142 ECAVCLNEFEDDETLRLLP-----KCNHVFHSDCIDLWLASHVTCPVCRA 186


>UniRef50_A5Y773 Cluster: RING-H2 zinc finger; n=1; Triticum
           aestivum|Rep: RING-H2 zinc finger - Triticum aestivum
           (Wheat)
          Length = 475

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/49 (32%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CLE +   GG +            +FH +CI+RW R     P  R
Sbjct: 422 ECPVCLEPLSVGGGDMKAAHV----CGHVFHSRCIERWLRHRNSCPVCR 466


>UniRef50_A5AMA9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 131

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 23/51 (45%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           EC ICL +      +  MP  G       FH +CI+RW R  +  P  R I
Sbjct: 79  ECAICLTEFMKGDEMSVMPQCG-----HGFHVKCIERWMRRSSSCPXCRQI 124


>UniRef50_Q5CY07 Cluster: Ring domain protein, possible 4
           transmembrane domains; n=2; Cryptosporidium|Rep: Ring
           domain protein, possible 4 transmembrane domains -
           Cryptosporidium parvum Iowa II
          Length = 368

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T +  C IC+++I+D+  I  +P     +   +FH +CI  W +++   P  R+
Sbjct: 307 TISKSCPICVQEIEDDATIRVLP----CDSRHIFHLECIDGWFKQNCVCPICRS 356


>UniRef50_A2G637 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 458

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +EC IC+  I+D         T M      FH QC++RW +E    P  RA
Sbjct: 408 SECAICMCNIEDG------EPTMMTPCGHPFHSQCLERWMQEQLVCPICRA 452


>UniRef50_A0DGD2 Cluster: Chromosome undetermined scaffold_5, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_5,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 344

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C IC+   +DN  IV +P     +++  FH+ C+Q+W
Sbjct: 297 QCNICMCDYEDNDLIVQLP----CSVKHHFHDHCLQQW 330


>UniRef50_A0C261 Cluster: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 190

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%)
 Frame = +3

Query: 87  CQICLEKI---DDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C ICL+ I   D    +  +P   + + +  FHE+C+++W  E    PF+R
Sbjct: 129 CAICLDSIAIADMEDRLQLLPVI-LTSCKHKFHEKCLRKWLHEKKECPFSR 178


>UniRef50_Q5SSZ7 Cluster: Zinc/RING finger protein 3 precursor;
           n=20; Eumetazoa|Rep: Zinc/RING finger protein 3
           precursor - Mus musculus (Mouse)
          Length = 913

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 287 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 331


>UniRef50_Q9ULT6 Cluster: Zinc/RING finger protein 3 precursor;
           n=13; Euteleostomi|Rep: Zinc/RING finger protein 3
           precursor - Homo sapiens (Human)
          Length = 936

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T++C ICLEK  D   +  +P T        FH +C+  W  +H   P  R
Sbjct: 290 TSDCAICLEKYIDGEELRVIPCT------HRFHRKCVDPWLLQHHTCPHCR 334


>UniRef50_Q12483 Cluster: Vacuolar-sorting protein SNF8; n=5;
           Saccharomycetales|Rep: Vacuolar-sorting protein SNF8 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 233

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 13/50 (26%), Positives = 27/50 (54%)
 Frame = +3

Query: 21  LKDRNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKM 170
           L DR+ ++F +   Y+  C    +IC +  D NGG+++  +   ++  K+
Sbjct: 78  LFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKL 127


>UniRef50_Q7Z569 Cluster: BRCA1-associated protein; n=31;
           Eumetazoa|Rep: BRCA1-associated protein - Homo sapiens
           (Human)
          Length = 592

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 84  ECQICLEKIDDN-GGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C +CLE++D++  GI+    T + N    FH QC+QRW
Sbjct: 263 KCTVCLERMDESVNGIL----TTLCN--HSFHSQCLQRW 295


>UniRef50_Q8L9W3 Cluster: RING-H2 finger protein ATL5J; n=2;
           Arabidopsis thaliana|Rep: RING-H2 finger protein ATL5J -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 163

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 20/61 (32%), Positives = 26/61 (42%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFP 257
           +TEC +CLE I+       +P          FH+ C   W   HT  P  RA +   N P
Sbjct: 101 STECAVCLEDIESGQSTRLVP-----GCNHGFHQLCADTWLSNHTVCPVCRA-ELAPNLP 154

Query: 258 Q 260
           Q
Sbjct: 155 Q 155


>UniRef50_Q9LX93 Cluster: RING-H2 finger protein ATL5F; n=1;
           Arabidopsis thaliana|Rep: RING-H2 finger protein ATL5F -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 301

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/51 (29%), Positives = 22/51 (43%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TEC +CL + +++  +  +P          FH  CI  W   H   P  RA
Sbjct: 133 TECSVCLNEFEEDESLRLLP-----KCSHAFHLNCIDTWLLSHKNCPLCRA 178


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 667,694,435
Number of Sequences: 1657284
Number of extensions: 13030848
Number of successful extensions: 32396
Number of sequences better than 10.0: 100
Number of HSP's better than 10.0 without gapping: 31201
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32256
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -