SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P19109 Cluster: ATP-dependent RNA helicase p62; n=9; Eu...   163   5e-39
UniRef50_Q16XX4 Cluster: DEAD box ATP-dependent RNA helicase; n=...   161   1e-38
UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila melanogaster|...   157   2e-37
UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=...   157   2e-37
UniRef50_Q17KA8 Cluster: DEAD box ATP-dependent RNA helicase; n=...   155   1e-36
UniRef50_Q4IF76 Cluster: ATP-dependent RNA helicase DBP2; n=4; F...   148   1e-34
UniRef50_Q17II7 Cluster: DEAD box ATP-dependent RNA helicase; n=...   144   2e-33
UniRef50_Q8IL14 Cluster: Helicase, truncated, putative; n=3; Euk...   130   3e-29
UniRef50_Q5CNJ7 Cluster: Similar to RNA-dependent helicase p68; ...   130   3e-29
UniRef50_Q9SWV9 Cluster: Ethylene-responsive RNA helicase; n=5; ...   127   3e-28
UniRef50_A2WLP5 Cluster: Putative uncharacterized protein; n=3; ...   126   4e-28
UniRef50_Q4N215 Cluster: RNA helicase, putative; n=3; Aconoidasi...   126   5e-28
UniRef50_Q5N7W4 Cluster: DEAD-box ATP-dependent RNA helicase 30;...   126   5e-28
UniRef50_Q4TEE5 Cluster: Chromosome undetermined SCAF5464, whole...   126   7e-28
UniRef50_Q26696 Cluster: Putative DEAD-box RNA helicase HEL64; n...   121   1e-26
UniRef50_UPI00006CD03A Cluster: P68-like protein, putative; n=1;...   119   8e-26
UniRef50_Q24I45 Cluster: DEAD/DEAH box helicase family protein; ...   118   1e-25
UniRef50_Q4MYL1 Cluster: ATP-dependent RNA helicase, putative; n...   118   1e-25
UniRef50_Q4QIQ9 Cluster: ATP-dependent DEAD/H RNA helicase, puta...   117   2e-25
UniRef50_Q8SRB2 Cluster: ATP-dependent RNA helicase DBP2; n=103;...   117   2e-25
UniRef50_A0CUL6 Cluster: Chromosome undetermined scaffold_28, wh...   116   5e-25
UniRef50_UPI00004988F8 Cluster: DEAD/DEAH box helicase; n=1; Ent...   116   7e-25
UniRef50_Q5VQL1-2 Cluster: Isoform 2 of Q5VQL1 ; n=2; Magnolioph...   114   2e-24
UniRef50_Q7QA96 Cluster: ENSANGP00000013118; n=5; Eumetazoa|Rep:...   114   2e-24
UniRef50_Q7K4L8 Cluster: LD33749p; n=1; Drosophila melanogaster|...   110   3e-23
UniRef50_Q5JKF2 Cluster: DEAD-box ATP-dependent RNA helicase 40;...   110   3e-23
UniRef50_A2ED04 Cluster: DEAD/DEAH box helicase family protein; ...   109   5e-23
UniRef50_A2EVI2 Cluster: DEAD/DEAH box helicase family protein; ...   109   6e-23
UniRef50_Q16T16 Cluster: DEAD box ATP-dependent RNA helicase; n=...   108   1e-22
UniRef50_Q9SQV1 Cluster: Probable DEAD-box ATP-dependent RNA hel...   107   2e-22
UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Duge...   106   6e-22
UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;...   105   8e-22
UniRef50_Q86XP3 Cluster: ATP-dependent RNA helicase DDX42; n=47;...   104   2e-21
UniRef50_A7RY08 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...   103   4e-21
UniRef50_Q54CB8 Cluster: Putative uncharacterized protein; n=1; ...   103   5e-21
UniRef50_Q9NXZ2 Cluster: Probable ATP-dependent RNA helicase DDX...   103   5e-21
UniRef50_Q66WQ1 Cluster: DEAD box DNA helicase; n=2; Plasmodium ...   102   7e-21
UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;...   102   7e-21
UniRef50_A0EA02 Cluster: Chromosome undetermined scaffold_85, wh...   101   1e-20
UniRef50_A4S3A0 Cluster: Predicted protein; n=2; Ostreococcus|Re...   100   4e-20
UniRef50_A0C015 Cluster: Chromosome undetermined scaffold_14, wh...   100   4e-20
UniRef50_Q17BQ3 Cluster: Putative uncharacterized protein; n=1; ...    99   5e-20
UniRef50_O00571 Cluster: ATP-dependent RNA helicase DDX3X; n=74;...    99   5e-20
UniRef50_Q9P7C7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...   100   7e-20
UniRef50_Q54T87 Cluster: Putative uncharacterized protein; n=1; ...    99   9e-20
UniRef50_Q9SF41 Cluster: DEAD-box ATP-dependent RNA helicase 45;...    99   9e-20
UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5; Viridiplanta...    99   1e-19
UniRef50_A4S294 Cluster: Predicted protein; n=1; Ostreococcus lu...    99   1e-19
UniRef50_UPI00006CDDA3 Cluster: CLN3 protein; n=1; Tetrahymena t...    98   2e-19
UniRef50_UPI00015609AE Cluster: PREDICTED: similar to DEAD (Asp-...    97   3e-19
UniRef50_Q012E3 Cluster: DEAD-box protein abstrakt; n=1; Ostreoc...    97   3e-19
UniRef50_Q9VXW2 Cluster: CG6227-PA; n=11; Coelomata|Rep: CG6227-...    97   3e-19
UniRef50_A0BDD2 Cluster: Chromosome undetermined scaffold_100, w...    97   3e-19
UniRef50_Q6BML1 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    97   3e-19
UniRef50_Q6BG49 Cluster: RNA helicase, putative; n=1; Paramecium...    97   5e-19
UniRef50_A5K071 Cluster: ATP-dependent RNA helicase, putative; n...    97   5e-19
UniRef50_A0BDT5 Cluster: Chromosome undetermined scaffold_101, w...    97   5e-19
UniRef50_Q93382 Cluster: Putative uncharacterized protein; n=2; ...    96   6e-19
UniRef50_Q8H0U8 Cluster: DEAD-box ATP-dependent RNA helicase 42;...    96   6e-19
UniRef50_Q65XX1 Cluster: Vasa-and belle-like helicase protein 1,...    96   8e-19
UniRef50_O97031 Cluster: DjVLGA; n=1; Dugesia japonica|Rep: DjVL...    96   8e-19
UniRef50_Q9M2F9 Cluster: DEAD-box ATP-dependent RNA helicase 52;...    96   8e-19
UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4; Pr...    96   8e-19
UniRef50_Q4JF01 Cluster: Vasa homlogue; n=2; Eukaryota|Rep: Vasa...    94   2e-18
UniRef50_Q4PFD9 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    94   2e-18
UniRef50_A0D315 Cluster: Chromosome undetermined scaffold_36, wh...    94   3e-18
UniRef50_A5E058 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    94   3e-18
UniRef50_Q4IP34 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    94   3e-18
UniRef50_Q965K2 Cluster: Putative uncharacterized protein; n=2; ...    93   4e-18
UniRef50_P24784 Cluster: ATP-dependent RNA helicase DBP1; n=103;...    93   4e-18
UniRef50_UPI00004992E6 Cluster: DEAD/DEAH box helicase; n=3; Ent...    93   6e-18
UniRef50_UPI000065DC0B Cluster: Probable ATP-dependent RNA helic...    92   1e-17
UniRef50_Q013X8 Cluster: DEAD/DEAH box RNA helicase; n=1; Ostreo...    91   2e-17
UniRef50_A4S107 Cluster: Predicted protein; n=1; Ostreococcus lu...    91   2e-17
UniRef50_Q7QDB7 Cluster: ENSANGP00000017541; n=1; Anopheles gamb...    91   2e-17
UniRef50_Q61JF4 Cluster: Putative uncharacterized protein CBG098...    91   2e-17
UniRef50_Q9XVZ6 Cluster: Putative uncharacterized protein; n=2; ...    91   2e-17
UniRef50_Q869K2 Cluster: Similar to Dictyostelium discoideum (Sl...    91   2e-17
UniRef50_Q1AG34 Cluster: Ded1-like DEAD-box RNA helicase; n=1; C...    91   2e-17
UniRef50_P20447 Cluster: ATP-dependent RNA helicase DBP3; n=20; ...    91   2e-17
UniRef50_A6RW79 Cluster: Putative uncharacterized protein; n=1; ...    91   3e-17
UniRef50_Q4W7T8 Cluster: VASA RNA helicase; n=1; Artemia francis...    90   4e-17
UniRef50_Q5CP59 Cluster: DEAD box polypeptide, Y chromosome-rela...    90   5e-17
UniRef50_A2DES1 Cluster: DEAD/DEAH box helicase family protein; ...    90   5e-17
UniRef50_Q4UBP8 Cluster: RNA helicase, putative; n=4; Eukaryota|...    89   7e-17
UniRef50_UPI00004994C0 Cluster: DEAD/DEAH box helicase; n=2; Ent...    89   9e-17
UniRef50_A7P8T9 Cluster: Chromosome chr3 scaffold_8, whole genom...    89   9e-17
UniRef50_Q5KME7 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    89   9e-17
UniRef50_Q6CCZ1 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    89   1e-16
UniRef50_A7RGX3 Cluster: Predicted protein; n=3; Eukaryota|Rep: ...    88   2e-16
UniRef50_A0D361 Cluster: Chromosome undetermined scaffold_36, wh...    88   2e-16
UniRef50_Q0UN57 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    88   2e-16
UniRef50_UPI00006CF9CE Cluster: DEAD/DEAH box helicase family pr...    87   3e-16
UniRef50_A3AD37 Cluster: Putative uncharacterized protein; n=2; ...    87   3e-16
UniRef50_Q5KHB7 Cluster: ATP-dependent RNA helicase DBP3; n=2; F...    87   3e-16
UniRef50_A5KB15 Cluster: ATP-dependent RNA helicase, putative; n...    87   4e-16
UniRef50_Q4PDT1 Cluster: ATP-dependent RNA helicase DBP3; n=1; U...    86   9e-16
UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=...    85   1e-15
UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3; Eumet...    85   1e-15
UniRef50_A7AWZ5 Cluster: DEAD/DEAH box helicase and helicase con...    85   2e-15
UniRef50_A1XCP2 Cluster: Vasa-like protein; n=2; Coelomata|Rep: ...    85   2e-15
UniRef50_Q2PZC2 Cluster: Vasa protein; n=3; Apidae|Rep: Vasa pro...    85   2e-15
UniRef50_Q00T47 Cluster: Putative RNA helicase, DRH1; n=1; Ostre...    84   3e-15
UniRef50_Q9GV12 Cluster: Vasa-related protein CnVAS2; n=14; Eume...    84   3e-15
UniRef50_Q012T2 Cluster: DEAD-box protein abstrakt; n=3; Ostreoc...    84   3e-15
UniRef50_Q10202 Cluster: ATP-dependent RNA helicase dbp3; n=1; S...    83   5e-15
UniRef50_Q9N5K1 Cluster: Putative uncharacterized protein; n=2; ...    83   8e-15
UniRef50_Q9GNP1 Cluster: Vasa homolog; n=18; Eumetazoa|Rep: Vasa...    83   8e-15
UniRef50_P09052 Cluster: ATP-dependent RNA helicase vasa; n=5; E...    83   8e-15
UniRef50_UPI0000F3242A Cluster: Probable ATP-dependent RNA helic...    82   1e-14
UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein; ...    82   1e-14
UniRef50_A7CUH7 Cluster: DEAD/DEAH box helicase domain protein; ...    82   1e-14
UniRef50_Q7S5R1 Cluster: ATP-dependent RNA helicase dbp-3; n=10;...    82   1e-14
UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3; Sphingomonad...    82   1e-14
UniRef50_Q54CD6 Cluster: Putative uncharacterized protein; n=1; ...    82   1e-14
UniRef50_Q0E3X4 Cluster: DEAD-box ATP-dependent RNA helicase 35A...    82   1e-14
UniRef50_UPI00015B61D8 Cluster: PREDICTED: similar to vasa-like ...    81   2e-14
UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59; ...    81   2e-14
UniRef50_Q9C551 Cluster: DEAD-box ATP-dependent RNA helicase 5; ...    81   2e-14
UniRef50_Q3ZDP1 Cluster: Vasa-like protein; n=7; Neoptera|Rep: V...    81   2e-14
UniRef50_A2G6R5 Cluster: DEAD/DEAH box helicase family protein; ...    81   2e-14
UniRef50_Q9V3C0 Cluster: ATP-dependent RNA helicase abstrakt; n=...    81   2e-14
UniRef50_Q58083 Cluster: Probable ATP-dependent RNA helicase MJ0...    81   3e-14
UniRef50_A5BHG9 Cluster: Putative uncharacterized protein; n=1; ...    80   4e-14
UniRef50_Q95QN2 Cluster: Putative uncharacterized protein; n=2; ...    80   4e-14
UniRef50_Q23WN3 Cluster: Helicase conserved C-terminal domain co...    80   6e-14
UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE; ...    79   7e-14
UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    79   7e-14
UniRef50_Q11UI8 Cluster: DEAD box-related helicase; n=3; Sphingo...    79   7e-14
UniRef50_Q4JG17 Cluster: Vasa-like protein; n=1; Litopenaeus van...    79   7e-14
UniRef50_Q9NQI0 Cluster: Probable ATP-dependent RNA helicase DDX...    79   7e-14
UniRef50_UPI00015B4D1B Cluster: PREDICTED: similar to DEAD box A...    79   1e-13
UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    79   1e-13
UniRef50_A3FQ46 Cluster: U5 snRNP 100 kD protein, putative; n=2;...    79   1e-13
UniRef50_P21372 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    79   1e-13
UniRef50_Q754U8 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    79   1e-13
UniRef50_A7HG33 Cluster: DEAD/DEAH box helicase domain protein; ...    79   1e-13
UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein; ...    79   1e-13
UniRef50_Q8I416 Cluster: ATP-dependent RNA helicase, putative; n...    79   1e-13
UniRef50_A2DH37 Cluster: DEAD/DEAH box helicase family protein; ...    79   1e-13
UniRef50_A7TJK8 Cluster: Putative uncharacterized protein; n=1; ...    79   1e-13
UniRef50_P93008 Cluster: DEAD-box ATP-dependent RNA helicase 21;...    79   1e-13
UniRef50_P42305 Cluster: ATP-dependent RNA helicase dbpA; n=9; F...    79   1e-13
UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12; Clost...    78   2e-13
UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5; Firmic...    77   3e-13
UniRef50_A2EPC6 Cluster: Type III restriction enzyme, res subuni...    77   3e-13
UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1; Syntro...    77   4e-13
UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=...    77   4e-13
UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein; ...    77   4e-13
UniRef50_A0C369 Cluster: Chromosome undetermined scaffold_146, w...    77   4e-13
UniRef50_Q9BUQ8 Cluster: Probable ATP-dependent RNA helicase DDX...    77   4e-13
UniRef50_Q8YH70 Cluster: ATP-DEPENDENT RNA HELICASE RHLE; n=10; ...    77   5e-13
UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    77   5e-13
UniRef50_Q0M1B5 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    77   5e-13
UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific fo...    77   5e-13
UniRef50_Q4Z5Q6 Cluster: ATP-dependent RNA helicase, putative; n...    77   5e-13
UniRef50_Q388E8 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    77   5e-13
UniRef50_A4V6K8 Cluster: Putative RNA helicase protein; n=1; Dug...    76   7e-13
UniRef50_Q9LU46 Cluster: DEAD-box ATP-dependent RNA helicase 35;...    76   7e-13
UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellu...    76   9e-13
UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellu...    76   9e-13
UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=...    76   9e-13
UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein; ...    76   9e-13
UniRef50_Q54Y81 Cluster: Putative RNA helicase; n=2; Dictyosteli...    76   9e-13
UniRef50_Q384E1 Cluster: Mitochondrial DEAD box protein; n=5; Tr...    76   9e-13
UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3; Methanosarc...    76   9e-13
UniRef50_Q88NB7 Cluster: ATP-dependent RNA helicase rhlB; n=18; ...    76   9e-13
UniRef50_Q87HW1 Cluster: ATP-dependent RNA helicase, DEAD box fa...    75   1e-12
UniRef50_Q4AEL1 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    75   1e-12
UniRef50_Q6T442 Cluster: Hel61; n=4; Leishmania|Rep: Hel61 - Lei...    75   1e-12
UniRef50_Q6FML5 Cluster: Pre-mRNA-processing ATP-dependent RNA h...    75   1e-12
UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2; Planct...    75   2e-12
UniRef50_A6QC93 Cluster: ATP-independent RNA helicase DbpA; n=1;...    75   2e-12
UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=...    75   2e-12
UniRef50_A4EAF2 Cluster: Putative uncharacterized protein; n=1; ...    75   2e-12
UniRef50_Q7QTB0 Cluster: GLP_15_15676_17025; n=1; Giardia lambli...    75   2e-12
UniRef50_A7SE71 Cluster: Predicted protein; n=1; Nematostella ve...    75   2e-12
UniRef50_Q9W3Y5 Cluster: Putative ATP-dependent RNA helicase CG1...    75   2e-12
UniRef50_Q8D7D0 Cluster: Superfamily II DNA and RNA helicase; n=...    75   2e-12
UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=...    75   2e-12
UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1; Blasto...    75   2e-12
UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein; ...    75   2e-12
UniRef50_Q9HXE5 Cluster: ATP-dependent RNA helicase rhlB; n=22; ...    75   2e-12
UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=19...    75   2e-12
UniRef50_Q44NG9 Cluster: Helicase, C-terminal:DEAD/DEAH box heli...    74   3e-12
UniRef50_Q54DV7 Cluster: Putative uncharacterized protein; n=1; ...    74   3e-12
UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein; ...    74   3e-12
UniRef50_Q480Z7 Cluster: ATP-dependent RNA helicase, DEAD box fa...    74   4e-12
UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2; Alphaproteob...    74   4e-12
UniRef50_A1KUM8 Cluster: Putative ATP-dependent RNA helicase; n=...    74   4e-12
UniRef50_A2ZD51 Cluster: Putative uncharacterized protein; n=7; ...    74   4e-12
UniRef50_Q1DMX8 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    74   4e-12
UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1; Idioma...    73   5e-12
UniRef50_Q2BMZ1 Cluster: ATP-dependent RNA helicase; n=1; Neptun...    73   5e-12
UniRef50_Q12B10 Cluster: DEAD/DEAH box helicase-like; n=13; Prot...    73   5e-12
UniRef50_A6DHU9 Cluster: DEAD/DEAH box helicase-like protein; n=...    73   5e-12
UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein; ...    73   5e-12
UniRef50_A3ZXX1 Cluster: ATP-dependent RNA helicase; n=2; Planct...    73   5e-12
UniRef50_Q8I0W7 Cluster: Snrnp protein, putative; n=6; Plasmodiu...    73   5e-12
UniRef50_Q7R3F3 Cluster: GLP_158_79919_77949; n=1; Giardia lambl...    73   5e-12
UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10; ...    73   6e-12
UniRef50_Q6APU7 Cluster: Related to ATP-dependent RNA helicase; ...    73   6e-12
UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15; Cyan...    73   6e-12
UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1; Clost...    73   6e-12
UniRef50_Q8L7S8 Cluster: DEAD-box ATP-dependent RNA helicase 3; ...    73   6e-12
UniRef50_Q89M45 Cluster: ATP-dependent RNA helicase; n=29; cellu...    73   9e-12
UniRef50_Q5FS73 Cluster: ATP-dependent RNA helicase; n=2; Glucon...    73   9e-12
UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2; Synec...    73   9e-12
UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|R...    73   9e-12
UniRef50_Q015I7 Cluster: ATP-dependent RNA helicase; n=2; Ostreo...    73   9e-12
UniRef50_Q4W7T7 Cluster: VASA RNA helicase; n=3; Daphniidae|Rep:...    73   9e-12
UniRef50_Q9Y7T7 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    73   9e-12
UniRef50_Q8F0Q7 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    72   1e-11
UniRef50_Q6KI10 Cluster: DEAD-box ATP-dependent RNA helicase; n=...    72   1e-11
UniRef50_Q31AC4 Cluster: DEAD/DEAH box helicase-like protein; n=...    72   1e-11
UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1; Acido...    72   1e-11
UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellu...    72   1e-11
UniRef50_A3WBM2 Cluster: Cold-shock dead-box protein A; n=1; Ery...    72   1e-11
UniRef50_Q4QIG1 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    72   1e-11
UniRef50_Q6YPL1 Cluster: Superfamily II DNA and RNA helicase; n=...    72   2e-11
UniRef50_O54116 Cluster: Probable DEAD-box RNA helicase; n=10; S...    72   2e-11
UniRef50_Q0HKH0 Cluster: DEAD/DEAH box helicase domain protein; ...    72   2e-11
UniRef50_Q0G0P8 Cluster: Superfamily II DNA and RNA helicase; n=...    72   2e-11
UniRef50_A6CFZ8 Cluster: ATP-dependent RNA helicase; n=1; Planct...    72   2e-11
UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=...    72   2e-11
UniRef50_A0KXT6 Cluster: DEAD/DEAH box helicase domain protein; ...    72   2e-11
UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog; ...    72   2e-11
UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11; Cyano...    71   2e-11
UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1; ...    71   2e-11
UniRef50_Q0BSI7 Cluster: ATP-dependent RNA helicase; n=12; Alpha...    71   2e-11
UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein; ...    71   2e-11
UniRef50_Q978T9 Cluster: ATP-dependent RNA helicase; n=3; Thermo...    71   2e-11
UniRef50_UPI0000E87E35 Cluster: putative ATP-dependent RNA helic...    71   3e-11
UniRef50_Q1VL45 Cluster: DEAD/DEAH box helicase-like protein; n=...    71   3e-11
UniRef50_Q4UA43 Cluster: DEAD-family helicase, putative; n=3; Pi...    71   3e-11
UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2; Trepon...    71   3e-11
UniRef50_Q1J0S9 Cluster: DEAD/DEAH box helicase-like protein; n=...    71   3e-11
UniRef50_Q12QV2 Cluster: DEAD/DEAH box helicase-like protein; n=...    71   3e-11
UniRef50_Q0S0C5 Cluster: Possible ATP-dependent RNA helicase; n=...    71   3e-11
UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein; ...    71   3e-11
UniRef50_A1USG3 Cluster: DEAD/DEAH box helicase domain/helicase ...    71   3e-11
UniRef50_A5K9H3 Cluster: Pre-mRNA splicing factor RNA helicase P...    71   3e-11
UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular organ...    71   3e-11
UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3; Thermopro...    71   3e-11
UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n...    70   5e-11
UniRef50_Q1I3W1 Cluster: ATP-dependent RNA helicase RhlE, DEAD b...    70   5e-11
UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA h...    70   5e-11
UniRef50_Q0HYG8 Cluster: DEAD/DEAH box helicase domain protein; ...    70   5e-11
UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1; ...    70   5e-11
UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein; ...    70   5e-11
UniRef50_A3EUK2 Cluster: Superfamily II DNA and RNA helicase; n=...    70   5e-11
UniRef50_A0LLL9 Cluster: DEAD/DEAH box helicase domain protein; ...    70   5e-11
UniRef50_Q5ENJ0 Cluster: Chloroplast RNA helicase; n=1; Heteroca...    70   5e-11
UniRef50_Q9LUW5 Cluster: DEAD-box ATP-dependent RNA helicase 53;...    70   5e-11
UniRef50_Q9FZ92 Cluster: Putative DEAD-box ATP-dependent RNA hel...    70   5e-11
UniRef50_Q6AMK6 Cluster: Probable ATP-dependent RNA helicase; n=...    70   6e-11
UniRef50_Q4PNH7 Cluster: Putative cold-shock dead-box protein A;...    70   6e-11
UniRef50_A3PFY9 Cluster: DEAD/DEAH box helicase domain protein; ...    70   6e-11
UniRef50_A3JG19 Cluster: ATP-dependent RNA helicase; n=1; Marino...    70   6e-11
UniRef50_Q7R388 Cluster: GLP_111_80478_82724; n=1; Giardia lambl...    70   6e-11
UniRef50_A2D755 Cluster: DEAD/DEAH box helicase family protein; ...    70   6e-11
UniRef50_A1IIT5 Cluster: RNA helicase; n=1; Neobenedenia girella...    70   6e-11
UniRef50_Q5L3G9 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    70   6e-11
UniRef50_Q64VR8 Cluster: ATP-dependent RNA helicase DeaD; n=14; ...    69   8e-11
UniRef50_Q3SF48 Cluster: DEAD/DEAH box helicase; n=6; cellular o...    69   8e-11
UniRef50_A6PQ62 Cluster: DEAD/DEAH box helicase domain protein; ...    69   8e-11
UniRef50_A1IIT4 Cluster: RNA helicase; n=1; Neobenedenia girella...    69   8e-11
UniRef50_P25888 Cluster: Putative ATP-dependent RNA helicase rhl...    69   8e-11
UniRef50_UPI0000499D6F Cluster: DEAD/DEAH box helicase; n=1; Ent...    69   1e-10
UniRef50_Q0LVA0 Cluster: Helicase-like:DEAD/DEAH box helicase-li...    69   1e-10
UniRef50_Q8A2K2 Cluster: ATP-dependent RNA helicase; n=10; cellu...    69   1e-10
UniRef50_Q81QF0 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    69   1e-10
UniRef50_Q4FSS4 Cluster: Possible ATP-dependent DEAD/DEAH box RN...    69   1e-10
UniRef50_Q30YG9 Cluster: DEAD/DEAH box helicase-like; n=3; Delta...    69   1e-10
UniRef50_Q2S6I0 Cluster: ATP-dependent RNA helicase; n=1; Salini...    69   1e-10
UniRef50_Q0BUS0 Cluster: ATP-dependent RNA helicase; n=3; Rhodos...    69   1e-10
UniRef50_A7CSF3 Cluster: DEAD/DEAH box helicase domain protein; ...    69   1e-10
UniRef50_A4BHZ9 Cluster: ATP-dependent RNA helicase; n=1; Reinek...    69   1e-10
UniRef50_A0KTC9 Cluster: DEAD/DEAH box helicase domain protein; ...    69   1e-10
UniRef50_Q5CWD0 Cluster: Prp5p C terminal KH. eIF4A-1-family RNA...    69   1e-10
UniRef50_Q6FM43 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    69   1e-10
UniRef50_Q5NML9 Cluster: DNA and RNA helicase; n=28; Alphaproteo...    68   2e-10
UniRef50_Q2J919 Cluster: Helicase-like; n=3; Frankia|Rep: Helica...    68   2e-10
UniRef50_Q11QF9 Cluster: Inducible ATP-independent RNA helicase;...    68   2e-10
UniRef50_A2TP65 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    68   2e-10
UniRef50_A0RP33 Cluster: Putative ATP-dependent RNA helicase Rhl...    68   2e-10
UniRef50_Q32LU9 Cluster: LOC562123 protein; n=3; Danio rerio|Rep...    68   2e-10
UniRef50_Q5GZA1 Cluster: ATP-dependent RNA helicase; n=6; Xantho...    68   2e-10
UniRef50_Q1N6E2 Cluster: ATP-dependent RNA helicase; n=1; Oceano...    68   2e-10
UniRef50_Q1MY97 Cluster: DEAD/DEAH box helicase-like protein; n=...    68   2e-10
UniRef50_Q185X0 Cluster: ATP-dependent RNA helicase; n=3; Clostr...    68   2e-10
UniRef50_A4B5L7 Cluster: ATP-dependent RNA helicase DbpA; n=3; P...    68   2e-10
UniRef50_Q581A3 Cluster: ATP-dependent DEAD/H RNA helicase, puta...    68   2e-10
UniRef50_P96614 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    68   2e-10
UniRef50_Q5NZY2 Cluster: ATP-dependent RNA helicase DeaD; n=18; ...    67   3e-10
UniRef50_Q1QYG3 Cluster: DEAD/DEAH box helicase-like protein; n=...    67   3e-10
UniRef50_A1UCR5 Cluster: DEAD/DEAH box helicase domain protein; ...    67   3e-10
UniRef50_Q5KNF8 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    67   3e-10
UniRef50_A6VTY7 Cluster: DEAD/DEAH box helicase domain protein; ...    67   4e-10
UniRef50_O26305 Cluster: ATP-dependent RNA helicase, eIF-4A fami...    67   4e-10
UniRef50_A2SQE1 Cluster: DEAD/DEAH box helicase domain protein; ...    67   4e-10
UniRef50_P44586 Cluster: Cold-shock DEAD box protein A homolog; ...    67   4e-10
UniRef50_Q9H0S4 Cluster: Probable ATP-dependent RNA helicase DDX...    67   4e-10
UniRef50_UPI0000F1E5FF Cluster: PREDICTED: similar to Pl10, part...    66   6e-10
UniRef50_Q9RKJ0 Cluster: ATP-dependent RNA helicase; n=2; Strept...    66   6e-10
UniRef50_Q5GRS8 Cluster: Superfamily II DNA/RNA helicase; n=4; W...    66   6e-10
UniRef50_Q1GJ43 Cluster: DEAD/DEAH box helicase-like protein; n=...    66   6e-10
UniRef50_Q11WD3 Cluster: Possible ATP-dependent RNA helicase; n=...    66   6e-10
UniRef50_A6VX62 Cluster: DEAD/DEAH box helicase domain protein; ...    66   6e-10
UniRef50_A4BBH5 Cluster: Probable ATP-dependent RNA helicase; n=...    66   6e-10
UniRef50_A2U1Q9 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    66   6e-10
UniRef50_A1U3D6 Cluster: DEAD/DEAH box helicase domain protein; ...    66   6e-10
UniRef50_Q54TJ4 Cluster: Putative uncharacterized protein; n=1; ...    66   6e-10
UniRef50_A7U5X1 Cluster: DEAD-box helicase 11; n=11; Plasmodium|...    66   6e-10
UniRef50_P0A9P8 Cluster: Cold-shock DEAD box protein A; n=54; Ga...    66   6e-10
UniRef50_UPI00015BD198 Cluster: UPI00015BD198 related cluster; n...    66   7e-10
UniRef50_Q6D2K3 Cluster: ATP-independent RNA helicase; n=6; Prot...    66   7e-10
UniRef50_Q18W60 Cluster: DEAD/DEAH box helicase-like; n=2; Desul...    66   7e-10
UniRef50_A7JLA3 Cluster: ATP-dependent RNA helicase; n=20; Franc...    66   7e-10
UniRef50_A6NQG8 Cluster: Putative uncharacterized protein; n=2; ...    66   7e-10
UniRef50_P38712 Cluster: ATP-dependent rRNA helicase RRP3; n=6; ...    66   7e-10
UniRef50_UPI00003C8469 Cluster: hypothetical protein Faci_030017...    66   1e-09
UniRef50_Q4SWK6 Cluster: Chromosome 12 SCAF13614, whole genome s...    66   1e-09
UniRef50_Q5ZT20 Cluster: ATP-dependent RNA helicase; n=4; Legion...    66   1e-09
UniRef50_Q0C4R1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH b...    66   1e-09
UniRef50_A6Q8Y9 Cluster: ATP-dependent RNA helicase, DEAD-box fa...    66   1e-09
UniRef50_A3TJG3 Cluster: ATP-dependent RNA helicase; n=5; Actino...    66   1e-09
UniRef50_A1SQH8 Cluster: DEAD/DEAH box helicase domain protein p...    66   1e-09
UniRef50_Q011U7 Cluster: Myc-regulated DEAD/H box 18 RNA helicas...    66   1e-09
UniRef50_A7AM30 Cluster: RNA helicase family protein; n=1; Babes...    66   1e-09
UniRef50_Q4P7Y2 Cluster: Putative uncharacterized protein; n=1; ...    66   1e-09
UniRef50_Q6C024 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    66   1e-09
UniRef50_Q966L9 Cluster: ATP-dependent RNA helicase glh-2; n=4; ...    66   1e-09
UniRef50_Q6MQY6 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    65   1e-09
UniRef50_Q28T45 Cluster: DEAD/DEAH box helicase-like protein; n=...    65   1e-09
UniRef50_Q08Q14 Cluster: HeliCase, c-terminal:dead/deah box heli...    65   1e-09
UniRef50_A4AFV6 Cluster: ATP-dependent RNA helicase; n=3; Actino...    65   1e-09
UniRef50_A4RW46 Cluster: Predicted protein; n=2; Ostreococcus|Re...    65   1e-09
UniRef50_A4RK80 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    65   1e-09
UniRef50_UPI0000498E70 Cluster: DEAD/DEAH box helicase; n=1; Ent...    65   2e-09
UniRef50_Q6MN67 Cluster: ATP-dependent RNA helicase; n=3; Deltap...    65   2e-09
UniRef50_Q087U7 Cluster: DEAD/DEAH box helicase domain protein; ...    65   2e-09
UniRef50_A6W6A7 Cluster: DEAD/DEAH box helicase domain protein; ...    65   2e-09
UniRef50_A1G315 Cluster: DEAD/DEAH box helicase-like; n=2; Salin...    65   2e-09
UniRef50_Q4UE18 Cluster: RNA helicase, putative; n=2; Theileria|...    65   2e-09
UniRef50_A7U5W8 Cluster: DEAD-box helicase 5; n=6; Plasmodium|Re...    65   2e-09
UniRef50_UPI0000E48294 Cluster: PREDICTED: similar to DEAD (Asp-...    64   2e-09
UniRef50_UPI00006CB2CD Cluster: DEAD/DEAH box helicase family pr...    64   2e-09
UniRef50_Q1Q4V2 Cluster: Similar to ATP-independent RNA helicase...    64   2e-09
UniRef50_Q0S0C7 Cluster: ATP-dependent RNA helicase; n=5; Actino...    64   2e-09
UniRef50_A6Q863 Cluster: ATP-dependent RNA helicase; n=1; Sulfur...    64   2e-09
UniRef50_A5CVQ6 Cluster: ATP-dependent RNA helicase DeaD; n=2; s...    64   2e-09
UniRef50_A7S2R2 Cluster: Predicted protein; n=5; Eumetazoa|Rep: ...    64   2e-09
UniRef50_Q2FKY7 Cluster: DEAD/DEAH box helicase-like; n=1; Metha...    64   2e-09
UniRef50_Q81VG0 Cluster: DEAD-box ATP-dependent RNA helicase ydb...    64   2e-09
UniRef50_UPI00015B617E Cluster: PREDICTED: hypothetical protein;...    64   3e-09
UniRef50_Q9KKW0 Cluster: ATP-dependent RNA helicase, DEAD box fa...    64   3e-09
UniRef50_Q6MBR0 Cluster: Putative ATP-dependent RNA helicase; n=...    64   3e-09
UniRef50_Q11UP8 Cluster: ATP-dependent RNA helicase; n=1; Cytoph...    64   3e-09
UniRef50_A6GSW1 Cluster: Putative ATP-dependent RNA helicase; n=...    64   3e-09
UniRef50_Q8D563 Cluster: Superfamily II DNA and RNA helicase; n=...    64   4e-09
UniRef50_Q6F0U0 Cluster: ATP-dependent RNA helicase; n=1; Mesopl...    64   4e-09
UniRef50_Q62J95 Cluster: ATP-dependent RNA helicase RhlE, putati...    64   4e-09
UniRef50_A6H0L1 Cluster: Probable ATP-dependent RNA helicase, DE...    64   4e-09
UniRef50_Q9VX34 Cluster: CG5800-PA; n=2; Sophophora|Rep: CG5800-...    64   4e-09
UniRef50_Q9PA24 Cluster: ATP-dependent RNA helicase rhlB; n=87; ...    64   4e-09
UniRef50_Q6K7R9 Cluster: DEAD-box ATP-dependent RNA helicase 48;...    64   4e-09
UniRef50_Q5QY63 Cluster: ATP-dependent RNA helicase; n=3; Altero...    63   5e-09
UniRef50_Q2J6D3 Cluster: DEAD/DEAH box helicase-like; n=2; Frank...    63   5e-09
UniRef50_Q9S531 Cluster: DEAD-box protein; n=4; Cystobacterineae...    63   5e-09
UniRef50_A6NSW7 Cluster: Putative uncharacterized protein; n=1; ...    63   5e-09
UniRef50_Q9N478 Cluster: Putative uncharacterized protein; n=2; ...    63   5e-09
UniRef50_Q4QJI9 Cluster: Nucleolar RNA helicase II, putative; n=...    63   5e-09
UniRef50_A2E5C2 Cluster: DEAD/DEAH box helicase family protein; ...    63   5e-09
UniRef50_A0C321 Cluster: Chromosome undetermined scaffold_146, w...    63   5e-09
UniRef50_Q53FI9 Cluster: Nucleolar protein GU2 variant; n=3; Eut...    63   5e-09
UniRef50_Q5FNK0 Cluster: ATP-dependent RNA helicase; n=1; Glucon...    63   7e-09
UniRef50_Q30P62 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    63   7e-09
UniRef50_Q14NT1 Cluster: Putative atp-dependent rna helicase pro...    63   7e-09
UniRef50_Q0HLM7 Cluster: DEAD/DEAH box helicase domain protein; ...    63   7e-09
UniRef50_A0Z0M4 Cluster: ATP-dependent RNA helicase; n=1; marine...    63   7e-09
UniRef50_Q240I5 Cluster: DEAD/DEAH box helicase family protein; ...    63   7e-09
UniRef50_Q238V7 Cluster: Type III restriction enzyme, res subuni...    63   7e-09
UniRef50_Q5T1V6 Cluster: Probable ATP-dependent RNA helicase DDX...    63   7e-09
UniRef50_Q8EZ11 Cluster: ATP-dependent RNA helicase; n=4; Leptos...    62   9e-09
UniRef50_Q15T34 Cluster: DEAD/DEAH box helicase-like; n=1; Pseud...    62   9e-09
UniRef50_A6DML6 Cluster: ATP-dependent RNA helicase; n=1; Lentis...    62   9e-09
UniRef50_A2U4F0 Cluster: Putative ATP-dependent RNA helicase; n=...    62   9e-09
UniRef50_A7PDS5 Cluster: Chromosome chr11 scaffold_13, whole gen...    62   9e-09
UniRef50_Q5CWJ1 Cluster: Nucleolar protein GU2. eIF4A-1-family. ...    62   9e-09
UniRef50_UPI00003937F7 Cluster: COG0513: Superfamily II DNA and ...    62   1e-08
UniRef50_Q4V836 Cluster: MGC114699 protein; n=9; Deuterostomia|R...    62   1e-08
UniRef50_Q4SJI2 Cluster: Chromosome 4 SCAF14575, whole genome sh...    62   1e-08
UniRef50_Q8G5U3 Cluster: Possible ATP-dependent RNA helicase; n=...    62   1e-08
UniRef50_Q5QVE4 Cluster: ATP-dependent RNA helicase; n=2; Idioma...    62   1e-08
UniRef50_Q22T03 Cluster: DEAD/DEAH box helicase family protein; ...    62   1e-08
UniRef50_A4RBW7 Cluster: Putative uncharacterized protein; n=4; ...    62   1e-08
UniRef50_Q6KZC2 Cluster: ATP-dependent RNA helicase; n=1; Picrop...    62   1e-08
UniRef50_Q5KJI2 Cluster: ATP-dependent RNA helicase DHH1; n=4; D...    62   1e-08
UniRef50_Q89IS2 Cluster: Cold-shock dead-box protein A; n=28; Al...    62   2e-08
UniRef50_A4RXX8 Cluster: Predicted protein; n=1; Ostreococcus lu...    62   2e-08
UniRef50_A5E6W6 Cluster: ATP-dependent rRNA helicase RRP3; n=4; ...    62   2e-08
UniRef50_A5DIX5 Cluster: ATP-dependent RNA helicase ROK1; n=2; P...    62   2e-08
UniRef50_Q8EJQ5 Cluster: ATP-dependent RNA helicase rhlB; n=62; ...    62   2e-08
UniRef50_UPI00015B6038 Cluster: PREDICTED: similar to DEAD box A...    61   2e-08
UniRef50_Q0AR94 Cluster: DEAD/DEAH box helicase domain protein; ...    61   2e-08
UniRef50_A7HDE9 Cluster: DEAD/DEAH box helicase domain protein; ...    61   2e-08
UniRef50_A4C6L9 Cluster: ATP-dependent RNA helicase, DEAD box fa...    61   2e-08
UniRef50_A0KZD5 Cluster: DEAD/DEAH box helicase domain protein; ...    61   2e-08
UniRef50_A0K1H7 Cluster: DEAD/DEAH box helicase domain protein; ...    61   2e-08
UniRef50_Q019E9 Cluster: ATP-dependent RNA helicase; n=2; Ostreo...    61   2e-08
UniRef50_Q013Q9 Cluster: DEAD/DEAH box helicase, putative; n=7; ...    61   2e-08
UniRef50_A7QKJ8 Cluster: Chromosome chr2 scaffold_112, whole gen...    61   2e-08
UniRef50_A2D7F9 Cluster: DEAD/DEAH box helicase family protein; ...    61   2e-08
UniRef50_A7TRT2 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_P23394 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    61   2e-08
UniRef50_Q96GQ7 Cluster: Probable ATP-dependent RNA helicase DDX...    61   2e-08
UniRef50_UPI0000DAE40A Cluster: hypothetical protein Rgryl_01000...    61   3e-08
UniRef50_Q8D6Y8 Cluster: Superfamily II DNA and RNA helicase; n=...    61   3e-08
UniRef50_Q3AFI3 Cluster: ATP-dependent RNA helicase, DEAD box fa...    61   3e-08
UniRef50_Q2BIX8 Cluster: Probable ATP-dependent RNA helicase; n=...    61   3e-08
UniRef50_Q86B47 Cluster: CG8611-PB, isoform B; n=2; Drosophila m...    61   3e-08
UniRef50_Q16JA8 Cluster: DEAD box ATP-dependent RNA helicase; n=...    61   3e-08
UniRef50_A7RHS2 Cluster: Predicted protein; n=1; Nematostella ve...    61   3e-08
UniRef50_A2E9Y0 Cluster: DEAD/DEAH box helicase family protein; ...    61   3e-08
UniRef50_Q96XQ7 Cluster: 337aa long hypothetical ATP-dependent R...    61   3e-08
UniRef50_Q9FFT9 Cluster: Probable DEAD-box ATP-dependent RNA hel...    61   3e-08
UniRef50_Q7XJN0 Cluster: DEAD-box ATP-dependent RNA helicase 17;...    61   3e-08
UniRef50_P39517 Cluster: ATP-dependent RNA helicase DHH1; n=103;...    61   3e-08
UniRef50_Q80Y44 Cluster: Probable ATP-dependent RNA helicase DDX...    61   3e-08
UniRef50_O66866 Cluster: ATP-dependent RNA helicase DeaD; n=1; A...    60   4e-08
UniRef50_A4S507 Cluster: Predicted protein; n=2; Ostreococcus|Re...    60   4e-08
UniRef50_A7U5W7 Cluster: DEAD-box helicase 2; n=6; Plasmodium|Re...    60   4e-08
UniRef50_A4V6M8 Cluster: Nucleolar RNA helicase II/Gu protein; n...    60   4e-08
UniRef50_A4IBK1 Cluster: ATP-dependent RNA helicase, putative; n...    60   4e-08
UniRef50_Q752X1 Cluster: AFR452Cp; n=1; Eremothecium gossypii|Re...    60   4e-08
UniRef50_A6RSH5 Cluster: Putative uncharacterized protein; n=2; ...    60   4e-08
UniRef50_A5DU73 Cluster: Pre-mRNA-splicing ATP-dependent RNA hel...    60   4e-08
UniRef50_Q4SDX4 Cluster: Chromosome undetermined SCAF14628, whol...    60   5e-08
UniRef50_Q8D3Y6 Cluster: ATP-dependent RNA helicase, DEAD box fa...    60   5e-08
UniRef50_Q6MR64 Cluster: ATP-dependent RNA helicase; n=5; cellul...    60   5e-08
UniRef50_Q6A841 Cluster: Putative ATP-dependent RNA helicase; n=...    60   5e-08
UniRef50_Q8NJW1 Cluster: CYT-19 DEAD-box protein precursor; n=1;...    60   5e-08
UniRef50_Q8SR49 Cluster: ATP-dependent rRNA helicase SPB4; n=1; ...    60   5e-08
UniRef50_Q4P3U9 Cluster: ATP-dependent rRNA helicase RRP3; n=20;...    60   5e-08
UniRef50_Q39189 Cluster: DEAD-box ATP-dependent RNA helicase 7; ...    60   5e-08
UniRef50_P20448 Cluster: ATP-dependent RNA helicase DBP4; n=13; ...    60   5e-08
UniRef50_UPI0000499ECF Cluster: DEAD/DEAH box helicase; n=1; Ent...    60   6e-08
UniRef50_Q6MHS8 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    60   6e-08
UniRef50_Q484Q1 Cluster: RNA helicase DeaD; n=1; Colwellia psych...    60   6e-08
UniRef50_Q11TW3 Cluster: Possible ATP-dependent RNA helicase; n=...    60   6e-08
UniRef50_A5EYB1 Cluster: ATP-dependent rna helicase Rhl; n=2; Ga...    60   6e-08
UniRef50_A4LYS0 Cluster: DEAD/DEAH box helicase domain protein; ...    60   6e-08
UniRef50_Q234J0 Cluster: DEAD/DEAH box helicase family protein; ...    60   6e-08
UniRef50_Q8SSG7 Cluster: PUTATIVE ATP-DEPENDENT RNA HELICASE; n=...    60   6e-08
UniRef50_Q5VRY0 Cluster: DEAD-box ATP-dependent RNA helicase 39;...    60   6e-08
UniRef50_Q9H8H2 Cluster: Probable ATP-dependent RNA helicase DDX...    60   6e-08
UniRef50_P36120 Cluster: ATP-dependent RNA helicase DBP7; n=5; S...    60   6e-08
UniRef50_Q9KNA4 Cluster: ATP-dependent RNA helicase, DEAD box fa...    59   9e-08
UniRef50_Q725W5 Cluster: ATP-dependent RNA helicase, DEAD/DEAH f...    59   9e-08
UniRef50_Q39MK8 Cluster: DEAD/DEAH box helicase; n=10; Proteobac...    59   9e-08
UniRef50_A2YDM1 Cluster: Putative uncharacterized protein; n=2; ...    59   9e-08
UniRef50_Q61AN8 Cluster: Putative uncharacterized protein CBG136...    59   9e-08
UniRef50_Q0W8H7 Cluster: ATP-dependent RNA helicase; n=1; uncult...    59   9e-08
UniRef50_Q6A6U7 Cluster: ATP-dependent RNA helicase; n=3; Actino...    59   1e-07
UniRef50_Q30SZ2 Cluster: DEAD/DEAH box helicase-like; n=1; Thiom...    59   1e-07
UniRef50_Q4IZ16 Cluster: DEAD/DEAH box helicase:Helicase, C-term...    59   1e-07
UniRef50_A7QRK7 Cluster: Chromosome undetermined scaffold_151, w...    59   1e-07
UniRef50_Q4UBV5 Cluster: DEAD-box family (RNA) helicase, putativ...    59   1e-07
UniRef50_Q2GWX0 Cluster: Putative uncharacterized protein; n=4; ...    59   1e-07
UniRef50_Q7VFA9 Cluster: ATP-dependent RNA helicase DeaD; n=6; H...    58   1e-07
UniRef50_Q6MN50 Cluster: ATP-dependent RNA helicase; n=1; Bdello...    58   1e-07
UniRef50_Q26CN9 Cluster: ATP-dependent RNA helicase; n=1; Flavob...    58   1e-07
UniRef50_A6G2A2 Cluster: DEAD/DEAH box helicase-like protein; n=...    58   1e-07
UniRef50_A0JYP4 Cluster: DEAD/DEAH box helicase domain protein; ...    58   1e-07
UniRef50_A7P0R7 Cluster: Chromosome chr19 scaffold_4, whole geno...    58   1e-07
UniRef50_A7SJ72 Cluster: Predicted protein; n=1; Nematostella ve...    58   1e-07
UniRef50_Q9C8S9 Cluster: Probable DEAD-box ATP-dependent RNA hel...    58   1e-07
UniRef50_Q56X76 Cluster: DEAD-box ATP-dependent RNA helicase 39;...    58   1e-07
UniRef50_Q8GY84 Cluster: DEAD-box ATP-dependent RNA helicase 10;...    58   1e-07
UniRef50_Q9NR30 Cluster: Nucleolar RNA helicase 2; n=51; Euteleo...    58   1e-07
UniRef50_Q13206 Cluster: Probable ATP-dependent RNA helicase DDX...    58   1e-07
UniRef50_O60173 Cluster: ATP-dependent RNA helicase dbp7; n=1; S...    58   1e-07
UniRef50_Q2H2J1 Cluster: ATP-dependent RNA helicase DBP4; n=14; ...    58   1e-07
UniRef50_Q11U28 Cluster: ATP-dependent RNA helicase protein; n=4...    58   2e-07
UniRef50_A6DL95 Cluster: Probable ATP-dependent RNA helicase; n=...    58   2e-07
UniRef50_Q5CWY8 Cluster: Rok1p, eIF4A-1-family RNA SFII helicase...    58   2e-07
UniRef50_Q5BYH3 Cluster: SJCHGC05414 protein; n=1; Schistosoma j...    58   2e-07
UniRef50_A0D232 Cluster: Chromosome undetermined scaffold_35, wh...    58   2e-07
UniRef50_A4RHM4 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q9FNM7 Cluster: DEAD-box ATP-dependent RNA helicase 26;...    58   2e-07
UniRef50_Q03532 Cluster: ATP-dependent RNA helicase HAS1; n=70; ...    58   2e-07
UniRef50_A4R5B8 Cluster: ATP-dependent RNA helicase DBP10; n=2; ...    58   2e-07
UniRef50_A2AAP7 Cluster: DEAD (Asp-Glu-Ala-Asp) box polypeptide ...    58   3e-07
UniRef50_Q6NHC6 Cluster: Putative RNA helicase; n=2; Corynebacte...    58   3e-07
UniRef50_A4SWL3 Cluster: DEAD/DEAH box helicase domain protein; ...    58   3e-07
UniRef50_A3I1F5 Cluster: DEAD/DEAH box helicase-like protein; n=...    58   3e-07
UniRef50_Q4N7J8 Cluster: DEAD box RNA helicase, putative; n=2; T...    58   3e-07
UniRef50_A2EQ41 Cluster: DEAD/DEAH box helicase family protein; ...    58   3e-07
UniRef50_Q3EBD3 Cluster: DEAD-box ATP-dependent RNA helicase 41;...    58   3e-07

>UniRef50_P19109 Cluster: ATP-dependent RNA helicase p62; n=9;
           Eukaryota|Rep: ATP-dependent RNA helicase p62 -
           Drosophila melanogaster (Fruit fly)
          Length = 719

 Score =  163 bits (395), Expect = 5e-39
 Identities = 74/84 (88%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL  G+TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLMWSATWPKE
Sbjct: 413 GRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 472

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           VK+LAED+LG+YIQINIGSL+LSA
Sbjct: 473 VKQLAEDFLGNYIQINIGSLELSA 496



 Score =  150 bits (363), Expect = 4e-35
 Identities = 71/84 (84%), Positives = 76/84 (90%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL YILPAIVHINNQ P++RGDGPIALVLAPTRELAQQIQQVA +FG +SYVRNTC
Sbjct: 328 GSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTC 387

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDL+RG EIVIAT
Sbjct: 388 VFGGAPKGGQMRDLQRGCEIVIAT 411



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 26/47 (55%), Positives = 32/47 (68%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI Q+VD+C E  KE KL  LL +I  + E   K IIFVETKR++
Sbjct: 497 NHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRV 543


>UniRef50_Q16XX4 Cluster: DEAD box ATP-dependent RNA helicase; n=5;
           Neoptera|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 911

 Score =  161 bits (391), Expect = 1e-38
 Identities = 75/84 (89%), Positives = 79/84 (94%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE+G TNL+RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQ LMWSATWPKE
Sbjct: 363 GRLIDFLERGITNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKE 422

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LAED+L DYIQINIGSL LSA
Sbjct: 423 VQALAEDFLHDYIQINIGSLNLSA 446



 Score =  122 bits (295), Expect = 6e-27
 Identities = 60/86 (69%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS--YVRN 176
           GSGKTLAY+LP IVHI +Q P++RG+GP+ LVLAPTRELAQQIQ V  DFG  S   +R 
Sbjct: 276 GSGKTLAYMLPGIVHIAHQKPLQRGEGPVVLVLAPTRELAQQIQTVVRDFGTHSKPLIRY 335

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
           TC+FGGA K  Q RDLERGVE+VIAT
Sbjct: 336 TCIFGGALKGPQVRDLERGVEVVIAT 361



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/47 (61%), Positives = 36/47 (76%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNI QIVD+C+E EKE KL  LL+EI  S +  +K IIFVETK+K+
Sbjct: 447 NHNIHQIVDVCEEGEKEGKLLSLLKEI--SSDVNSKIIIFVETKKKV 491


>UniRef50_Q8MZI3 Cluster: GH10652p; n=2; Drosophila
           melanogaster|Rep: GH10652p - Drosophila melanogaster
           (Fruit fly)
          Length = 818

 Score =  157 bits (381), Expect = 2e-37
 Identities = 70/84 (83%), Positives = 81/84 (96%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE+GTT+L+RCTYLVLDEADRMLDMGFEPQIRKI++QIRPDRQ LMWSATWPKE
Sbjct: 289 GRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKE 348

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LAE++L +YIQ+NIGSL LSA
Sbjct: 349 VRQLAEEFLNNYIQVNIGSLSLSA 372



 Score =  152 bits (369), Expect = 7e-36
 Identities = 70/84 (83%), Positives = 78/84 (92%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LPA+VHINNQP + RGDGPIALVLAPTRELAQQIQQVA +FG  ++VRNTC
Sbjct: 204 GSGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRNTC 263

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGGAPK +QARDLERGVEIVIAT
Sbjct: 264 IFGGAPKGQQARDLERGVEIVIAT 287



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 29/47 (61%), Positives = 35/47 (74%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQIVD+C E+EK  KL  LL +I  S E   KTIIFVETK+++
Sbjct: 373 NHNILQIVDVCDENEKLMKLIKLLTDI--SAENETKTIIFVETKKRV 417


>UniRef50_Q17JB5 Cluster: DEAD box ATP-dependent RNA helicase; n=4;
           Eukaryota|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 699

 Score =  157 bits (381), Expect = 2e-37
 Identities = 72/84 (85%), Positives = 78/84 (92%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE+G TNL+RCTYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQ LMWSATWPKE
Sbjct: 254 GRLIDFLERGITNLRRCTYLVLDEADRMLDMGFEPQIRKIMGQIRPDRQVLMWSATWPKE 313

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LAE++L DYIQINIGSL LSA
Sbjct: 314 VRNLAEEFLNDYIQINIGSLNLSA 337



 Score =  136 bits (329), Expect = 5e-31
 Identities = 66/84 (78%), Positives = 69/84 (82%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAYI PA+VHI +Q  +RRGDGPIALVLAPTRELAQQIQQVA DFG      NTC
Sbjct: 169 GSGKTLAYIAPALVHITHQDQLRRGDGPIALVLAPTRELAQQIQQVATDFGQRINANNTC 228

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAPK  Q RDLERG EIVIAT
Sbjct: 229 VFGGAPKGPQIRDLERGAEIVIAT 252



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 30/47 (63%), Positives = 37/47 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQIVD+C+++EK+ KL  LL EI  S E   KTIIFVETKR++
Sbjct: 338 NHNILQIVDVCEDYEKDQKLMKLLTEI--SAENETKTIIFVETKRRV 382


>UniRef50_Q17KA8 Cluster: DEAD box ATP-dependent RNA helicase; n=1;
           Aedes aegypti|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 718

 Score =  155 bits (375), Expect = 1e-36
 Identities = 71/84 (84%), Positives = 78/84 (92%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE GTTNL+R TYLVLDEADRMLDMGFEPQIRKII QIRPDRQ LMWSATWPKE
Sbjct: 233 GRLIDFLESGTTNLRRTTYLVLDEADRMLDMGFEPQIRKIISQIRPDRQVLMWSATWPKE 292

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           ++KLAE++L +YIQINIGSL L+A
Sbjct: 293 IRKLAEEFLREYIQINIGSLNLAA 316



 Score =  135 bits (326), Expect = 1e-30
 Identities = 64/84 (76%), Positives = 70/84 (83%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAYILPA++HI+NQP + RGDGPIALVLAPTRELAQQIQQV  DFG    + NTC
Sbjct: 148 GSGKTLAYILPALIHISNQPRLLRGDGPIALVLAPTRELAQQIQQVCNDFGRRMSIMNTC 207

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGGA K  QA DL RGVEIVIAT
Sbjct: 208 IFGGASKHPQADDLRRGVEIVIAT 231



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/47 (55%), Positives = 37/47 (78%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           N NI+QI++ C+E+EKE +L  LL E+  SQ+  +K+IIFVETKRK+
Sbjct: 317 NENIMQIIECCEEYEKETRLFKLLTEL--SQQGDSKSIIFVETKRKV 361


>UniRef50_Q4IF76 Cluster: ATP-dependent RNA helicase DBP2; n=4;
           Fungi/Metazoa group|Rep: ATP-dependent RNA helicase DBP2
           - Gibberella zeae (Fusarium graminearum)
          Length = 555

 Score =  148 bits (358), Expect = 1e-34
 Identities = 68/84 (80%), Positives = 76/84 (90%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE G TNL+R TYLVLDEADRMLDMGFEPQIRKII QIRPDRQTLMWSATWPKE
Sbjct: 266 GRLIDMLEAGKTNLRRVTYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQTLMWSATWPKE 325

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LA D+L D+IQ+NIGS++L+A
Sbjct: 326 VRALASDFLQDFIQVNIGSMELAA 349



 Score =  120 bits (289), Expect = 3e-26
 Identities = 57/84 (67%), Positives = 64/84 (76%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y LP+IVHIN QP +  GDGPI LVLAPTRELA QIQ+    FG +S +RNTC
Sbjct: 181 GSGKTLTYCLPSIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQEEMKKFGRSSRIRNTC 240

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG PK  Q RDL RGVE+ IAT
Sbjct: 241 VYGGVPKGPQIRDLSRGVEVCIAT 264



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           NH I QIV++  E EK +++   ++++ +++E   K +IFV TKR
Sbjct: 350 NHRITQIVEVVTEMEKRDRMIKHMEKVMENKE--NKILIFVGTKR 392


>UniRef50_Q17II7 Cluster: DEAD box ATP-dependent RNA helicase; n=1;
           Aedes aegypti|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 639

 Score =  144 bits (348), Expect = 2e-33
 Identities = 66/84 (78%), Positives = 73/84 (86%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL    TNL+RC+YLVLDEADRMLDMGFEPQIR IIEQIRPD QTLMWSATWP  
Sbjct: 219 GRLIDFLSSEHTNLRRCSYLVLDEADRMLDMGFEPQIRAIIEQIRPDHQTLMWSATWPDA 278

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V +L +DYL DYIQIN+GSL+L+A
Sbjct: 279 VSRLVKDYLKDYIQINVGSLKLAA 302



 Score =  126 bits (303), Expect = 7e-28
 Identities = 57/84 (67%), Positives = 70/84 (83%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPA++HI+ Q  +RRGDGPIAL+LAPTRELAQQI+QV  DFG    ++NTC
Sbjct: 134 GSGKTLSYLLPALMHIDQQSRLRRGDGPIALILAPTRELAQQIKQVTDDFGRAMKIKNTC 193

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGG  KR+Q  DL+ GVEIVIAT
Sbjct: 194 LFGGGAKRQQGDDLKYGVEIVIAT 217



 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/47 (63%), Positives = 40/47 (85%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKL 648
           NHNILQI+D+CQEHEKE KL++LL+EI   +E   KTIIF+ETK+++
Sbjct: 303 NHNILQIIDVCQEHEKEAKLSILLREIMAEKE--CKTIIFIETKKRV 347


>UniRef50_Q8IL14 Cluster: Helicase, truncated, putative; n=3;
           Eukaryota|Rep: Helicase, truncated, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 352

 Score =  130 bits (314), Expect = 3e-29
 Identities = 62/85 (72%), Positives = 72/85 (84%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE+  TNL R TYLVLDEAD+MLDMGFE QIRKI++QIRPDRQTLMWSATWPKE
Sbjct: 245 GRLIDLLEQNVTNLMRVTYLVLDEADKMLDMGFELQIRKIVDQIRPDRQTLMWSATWPKE 304

Query: 437 VKKLAEDYLGDY-IQINIGSLQLSA 508
           V+ LA+D   +  IQ+N+GSL L+A
Sbjct: 305 VQALAKDLCKEQPIQVNVGSLTLTA 329



 Score =  105 bits (253), Expect = 8e-22
 Identities = 51/83 (61%), Positives = 61/83 (73%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ILPA VHI  QP ++ GDGPI LVLAPTRELA+QI+Q    F   S +RNTC
Sbjct: 160 GSGKTLAFILPAFVHILAQPNLKYGDGPIVLVLAPTRELAEQIRQECIKFSTESKIRNTC 219

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
            +GG PK  Q   L++GV I+IA
Sbjct: 220 AYGGVPKSGQIYALKQGVHILIA 242


>UniRef50_Q5CNJ7 Cluster: Similar to RNA-dependent helicase p68;
           n=2; Cryptosporidium|Rep: Similar to RNA-dependent
           helicase p68 - Cryptosporidium hominis
          Length = 406

 Score =  130 bits (314), Expect = 3e-29
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE+G TNL R TYLVLDEADRMLDMGFEPQIRK++ QIRPDRQTL+WSATWPKE
Sbjct: 120 GRLIDLLEEGYTNLSRVTYLVLDEADRMLDMGFEPQIRKLVSQIRPDRQTLLWSATWPKE 179

Query: 437 VKKLAEDYLGDY-IQINIGSL 496
           V+KLA D   +  I IN+GS+
Sbjct: 180 VQKLARDLCKEIPIHINVGSV 200



 Score =  105 bits (251), Expect = 1e-21
 Identities = 48/83 (57%), Positives = 60/83 (72%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL ++LPA++HI  QP +R GDGPI LVLAPTREL +QI++ A  FG    +RNT 
Sbjct: 35  GSGKTLGFLLPAMIHIRAQPLLRYGDGPICLVLAPTRELVEQIREQANQFGSIFKLRNTA 94

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           ++GG PKR Q   +  GVEI IA
Sbjct: 95  IYGGVPKRPQQASIRNGVEICIA 117


>UniRef50_Q9SWV9 Cluster: Ethylene-responsive RNA helicase; n=5;
           Eukaryota|Rep: Ethylene-responsive RNA helicase -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 474

 Score =  127 bits (306), Expect = 3e-28
 Identities = 58/84 (69%), Positives = 69/84 (82%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+AY+LPAIVH+N QP +  GDGPI LVLAPTRELA QIQQ A  FG +S ++NTC
Sbjct: 143 GSGKTIAYLLPAIVHVNAQPILDHGDGPIVLVLAPTRELAVQIQQEATKFGASSRIKNTC 202

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG PK  Q RDL++GVEIVIAT
Sbjct: 203 IYGGVPKGPQVRDLQKGVEIVIAT 226



 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 46/65 (70%), Positives = 50/65 (76%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE   TNL+R T +VLDEADRMLDMGFEPQIRK I    PDRQTL WSATWPK 
Sbjct: 228 GRLIDMLESNHTNLRRVT-IVLDEADRMLDMGFEPQIRKCISD-TPDRQTLYWSATWPKN 285

Query: 437 VKKLA 451
           V  ++
Sbjct: 286 VNHVS 290


>UniRef50_A2WLP5 Cluster: Putative uncharacterized protein; n=3;
           Magnoliophyta|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 523

 Score =  126 bits (305), Expect = 4e-28
 Identities = 59/84 (70%), Positives = 70/84 (83%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID +E   TNL+R TYLVLDEADRMLDMGFEPQI+KI+ QIRPDRQTL WSATWPKE
Sbjct: 199 GRLIDMIESHHTNLRRITYLVLDEADRMLDMGFEPQIKKIVSQIRPDRQTLYWSATWPKE 258

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LA ++L D  ++ IGS +L A
Sbjct: 259 VEQLARNFLFDPYKVIIGSEELKA 282



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 39/51 (76%), Positives = 42/51 (82%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           GSGKTLAY+LPAIVH+N QP +  GDGPI LVLAPTRELA QIQQ A  FG
Sbjct: 140 GSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEATKFG 190



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           NH I Q V+I  E +K NKL  LL++I      G++ +IF++TK+
Sbjct: 283 NHAISQHVEILSESQKYNKLVNLLEDI----MDGSRILIFMDTKK 323


>UniRef50_Q4N215 Cluster: RNA helicase, putative; n=3;
           Aconoidasida|Rep: RNA helicase, putative - Theileria
           parva
          Length = 635

 Score =  126 bits (304), Expect = 5e-28
 Identities = 61/84 (72%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE   TNL+R TYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTLM+SATWPKE
Sbjct: 342 GRLIDFLESSVTNLRRVTYLVLDEADRMLDMGFEPQIRKIVGQIRPDRQTLMFSATWPKE 401

Query: 437 VKKLAEDYLG-DYIQINIGSLQLS 505
           V  L+   L  + + +NIGSL L+
Sbjct: 402 VIALSRSLLSHEVVHVNIGSLDLT 425



 Score =  107 bits (257), Expect = 2e-22
 Identities = 52/83 (62%), Positives = 64/83 (77%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LPAIVHIN Q  +R GDGPI LVLAPTRELA+QI++ A  FG +S ++ + 
Sbjct: 257 GSGKTLAFLLPAIVHINAQALLRPGDGPIVLVLAPTRELAEQIKETALVFGRSSKLKTSV 316

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
            +GG PKR Q   L RGVEI+IA
Sbjct: 317 AYGGVPKRFQTIALRRGVEILIA 339



 Score = 32.7 bits (71), Expect = 8.5
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 511 HNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           HNI Q V I +E EK  KL  LL+++      G K +IF ETK+
Sbjct: 428 HNIEQNVFILEEREKRVKLKELLKKLMD----GGKILIFSETKK 467


>UniRef50_Q5N7W4 Cluster: DEAD-box ATP-dependent RNA helicase 30;
           n=11; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           30 - Oryza sativa subsp. japonica (Rice)
          Length = 666

 Score =  126 bits (304), Expect = 5e-28
 Identities = 60/84 (71%), Positives = 68/84 (80%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE G TNL+R TYLVLDEADRMLDMGFEPQIRKI+ QIRPDRQTL WSATWP+E
Sbjct: 383 GRLIDMLEGGHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVAQIRPDRQTLYWSATWPRE 442

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LA  +L +  ++ IGS  L A
Sbjct: 443 VESLARQFLQNPYKVIIGSPDLKA 466



 Score =  120 bits (290), Expect = 2e-26
 Identities = 55/84 (65%), Positives = 66/84 (78%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LP +VH+  QP + +GDGPI L+LAPTRELA QIQQ +  FG  S  R+TC
Sbjct: 298 GSGKTLSYLLPGLVHVGAQPRLEQGDGPIVLILAPTRELAVQIQQESGKFGSYSRTRSTC 357

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDL RGVEIVIAT
Sbjct: 358 IYGGAPKGPQIRDLRRGVEIVIAT 381



 Score = 37.1 bits (82), Expect = 0.40
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           NH+I QI+++  EHEK  +L+ LL ++      G++ +IF +TK+
Sbjct: 467 NHSIQQIIEVISEHEKYPRLSKLLSDL----MDGSRILIFFQTKK 507


>UniRef50_Q4TEE5 Cluster: Chromosome undetermined SCAF5464, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF5464,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 307

 Score =  126 bits (303), Expect = 7e-28
 Identities = 66/136 (48%), Positives = 84/136 (61%), Gaps = 1/136 (0%)
 Frame = +2

Query: 32  ASHCAHKQPTAYSER*WSDCFGLGAYQRVSTTNSASCCRFWTHILCS*HVCVWWCS*KRA 211
           A +CAH+         W+  FG G ++ +    SA   R    +    H+ V  C+   +
Sbjct: 173 ACYCAHQPSALLGAWRWTHMFGFGPHEGIGPAGSAGSIRLRKVLTHQKHLRVRRCAEGTS 232

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTN-LQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           +PG GE   + H ++ R    L  G  + L+RCTYLVLDEADRMLDMGFEPQIRKI++QI
Sbjct: 233 NPGSGERCGDLHRHA-RASHRLPGGREDQLRRCTYLVLDEADRMLDMGFEPQIRKIVDQI 291

Query: 389 RPDRQTLMWSATWPKE 436
           RPDRQTLMWSATWPKE
Sbjct: 292 RPDRQTLMWSATWPKE 307


>UniRef50_Q26696 Cluster: Putative DEAD-box RNA helicase HEL64; n=6;
           Trypanosomatidae|Rep: Putative DEAD-box RNA helicase
           HEL64 - Trypanosoma brucei brucei
          Length = 568

 Score =  121 bits (292), Expect = 1e-26
 Identities = 55/84 (65%), Positives = 70/84 (83%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL+    NL R TYLVLDEADRMLDMGFEPQ+RKI  QIRPDRQT+M+SATWP+E
Sbjct: 233 GRLIDFLDIKRINLHRVTYLVLDEADRMLDMGFEPQVRKICGQIRPDRQTVMFSATWPRE 292

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           +++LA ++   +I+I++GS +L A
Sbjct: 293 IQRLAAEFQKQWIRISVGSTELQA 316



 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 45/84 (53%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL +++PA+ HI  Q P+R GDGP+ +VLAPTRELAQQI++          V   C
Sbjct: 149 GSGKTLGFMVPALAHIAVQEPLRSGDGPMVVVLAPTRELAQQIEEETKKV-IPGDVYCGC 207

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGAPK  Q   L RGV I++AT
Sbjct: 208 VYGGAPKGPQLGLLRRGVHILVAT 231


>UniRef50_UPI00006CD03A Cluster: P68-like protein, putative; n=1;
           Tetrahymena thermophila SB210|Rep: P68-like protein,
           putative - Tetrahymena thermophila SB210
          Length = 699

 Score =  119 bits (286), Expect = 8e-26
 Identities = 57/82 (69%), Positives = 67/82 (81%), Gaps = 1/82 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE    +L+R TYLVLDEADRMLDMGFEP IRKI+ QIRPDRQTLM+SATWP+ 
Sbjct: 345 GRLIDFLESNVIDLKRVTYLVLDEADRMLDMGFEPSIRKIVGQIRPDRQTLMFSATWPQT 404

Query: 437 VKKLAEDYL-GDYIQINIGSLQ 499
           V++LA D+  GD I I IG ++
Sbjct: 405 VRRLALDFCHGDPIHIQIGDME 426



 Score =  109 bits (261), Expect = 8e-23
 Identities = 50/84 (59%), Positives = 64/84 (76%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+++LPA+VHIN Q P++ G+GPIALVLAPTRELA QIQ+    FG    + + C
Sbjct: 260 GSGKTLSFMLPALVHINAQDPVKPGEGPIALVLAPTRELANQIQEQCFKFGSKCKISSVC 319

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGAPK  Q ++L  G +IVIAT
Sbjct: 320 VYGGAPKIYQEKELRNGCDIVIAT 343


>UniRef50_Q24I45 Cluster: DEAD/DEAH box helicase family protein;
           n=2; Tetrahymena thermophila|Rep: DEAD/DEAH box helicase
           family protein - Tetrahymena thermophila SB210
          Length = 713

 Score =  118 bits (285), Expect = 1e-25
 Identities = 62/96 (64%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFLE  TT L+R TYLVLDEADRMLDMGFE QIRKI+ QIRPDRQTLM+SATWPK 
Sbjct: 233 GRLIDFLESETTTLRRVTYLVLDEADRMLDMGFEIQIRKILGQIRPDRQTLMFSATWPKN 292

Query: 437 VKKLAEDYLGDY-IQINIGSLQLSAITTFFKL*IFV 541
           V+ LA+DY  +  + + IG  +L AI    K  ++V
Sbjct: 293 VQNLAQDYCKNTPVYVQIGKHEL-AINERIKQIVYV 327



 Score =  107 bits (258), Expect = 2e-22
 Identities = 48/84 (57%), Positives = 67/84 (79%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+++LP+IVHIN QP +++GDGPI LVLAPTRELA QI++ +  FG +S ++  C
Sbjct: 148 GSGKTLSFLLPSIVHINAQPTVKKGDGPIVLVLAPTRELAMQIERESERFGKSSKLKCAC 207

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGA K  Q   L++GV++VIAT
Sbjct: 208 IYGGADKYSQRALLQQGVDVVIAT 231


>UniRef50_Q4MYL1 Cluster: ATP-dependent RNA helicase, putative; n=3;
           Piroplasmida|Rep: ATP-dependent RNA helicase, putative -
           Theileria parva
          Length = 707

 Score =  118 bits (284), Expect = 1e-25
 Identities = 54/85 (63%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL++FL  GT  L R +Y V+DEADRMLDMGFEPQIRKI+ QIRPDRQTLM+SATWP E
Sbjct: 450 GRLLEFLSNGTIKLNRVSYFVMDEADRMLDMGFEPQIRKIVGQIRPDRQTLMFSATWPSE 509

Query: 437 VKKLAEDYL-GDYIQINIGSLQLSA 508
           +K+LA ++   + I I +G L+L+A
Sbjct: 510 IKRLASEFCKANSIYIQVGDLELTA 534



 Score = 83.0 bits (196), Expect = 6e-15
 Identities = 39/84 (46%), Positives = 56/84 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL ++LP ++H+  QPP+  G GPI L+L+PTREL  QI + A  +     +R   
Sbjct: 366 GSGKTLTFLLPGLLHLLAQPPVGTG-GPIMLILSPTRELCLQIAEEARPYSRLLNLRLVP 424

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGA K  Q R+L+ G EI++AT
Sbjct: 425 IYGGASKFAQVRELQNGAEIMVAT 448


>UniRef50_Q4QIQ9 Cluster: ATP-dependent DEAD/H RNA helicase,
           putative; n=6; Trypanosomatidae|Rep: ATP-dependent
           DEAD/H RNA helicase, putative - Leishmania major
          Length = 502

 Score =  117 bits (282), Expect = 2e-25
 Identities = 55/84 (65%), Positives = 66/84 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE   TNL R TYL LDEADRMLDMGFE QIRKI  QIR DRQTLM+SATWP+E
Sbjct: 278 GRLIDLLETNCTNLLRVTYLTLDEADRMLDMGFEDQIRKICSQIRTDRQTLMFSATWPRE 337

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           ++ LA  +  D+++++IGS +L A
Sbjct: 338 IRNLAASFQKDFVRVHIGSEELVA 361



 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQ-QVAADFGHTSYVRNT 179
           GSGKT+A+++PA +HI  QPP++ GDGPIALVLAPTRELA QI+ +          +  T
Sbjct: 192 GSGKTMAFMIPAALHIMAQPPLQPGDGPIALVLAPTRELAVQIETETRKALTRVPSIMTT 251

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG PK  Q R L  GV + IAT
Sbjct: 252 CVYGGTPKGPQQRALRAGVHVCIAT 276


>UniRef50_Q8SRB2 Cluster: ATP-dependent RNA helicase DBP2; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DBP2 -
           Encephalitozoon cuniculi
          Length = 495

 Score =  117 bits (282), Expect = 2e-25
 Identities = 55/94 (58%), Positives = 70/94 (74%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+       GRLID  ++G   L R T+LVLDEADRMLDMGFEPQ+RKII +   +R
Sbjct: 207 LHEGAEVVIATPGRLIDLHDQGHAPLSRVTFLVLDEADRMLDMGFEPQLRKIIPKTNANR 266

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQL 502
           QTLMWSATWP+EV+ LAE Y+ +YIQ+ +G+ +L
Sbjct: 267 QTLMWSATWPREVRGLAESYMNEYIQVVVGNEEL 300



 Score =  103 bits (248), Expect = 3e-21
 Identities = 49/84 (58%), Positives = 62/84 (73%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL++ILPA+VH  +Q P+RRGDGPI LVLAPTREL  QI++V  +F     +R+T 
Sbjct: 134 GSGKTLSFILPALVHAKDQQPLRRGDGPIVLVLAPTRELVMQIKKVVDEFCGMFNLRSTA 193

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGA  + Q R L  G E+VIAT
Sbjct: 194 VYGGASSQPQIRALHEGAEVVIAT 217


>UniRef50_A0CUL6 Cluster: Chromosome undetermined scaffold_28, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_28,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 604

 Score =  116 bits (279), Expect = 5e-25
 Identities = 53/85 (62%), Positives = 73/85 (85%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L++G T L++ ++LVLDEADRMLDMGFEPQIRKI++QIRP RQT+++SATWPKE
Sbjct: 263 GRLIDLLDQGCTTLKQVSFLVLDEADRMLDMGFEPQIRKIVDQIRPQRQTMLFSATWPKE 322

Query: 437 VKKLAEDYL-GDYIQINIGSLQLSA 508
           V+KLA D+   + + I IG+++L++
Sbjct: 323 VQKLALDFCKQEPVHIQIGNVELTS 347



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 38/83 (45%), Positives = 48/83 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LPAIVHI  Q    R   P  L+LAPTREL  QI      F   S +   C
Sbjct: 181 GSGKTLAFLLPAIVHILAQA---RSHDPKCLILAPTRELTLQIYDQFQKFSVGSQLYAAC 237

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           ++GG  +  Q   L +G +I+IA
Sbjct: 238 LYGGQDRYIQKSQLRKGPQILIA 260


>UniRef50_UPI00004988F8 Cluster: DEAD/DEAH box helicase; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 535

 Score =  116 bits (278), Expect = 7e-25
 Identities = 50/84 (59%), Positives = 69/84 (82%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDF+++G T+L RCT+L+LDEADRML+MGFE Q++ II QIRPDRQT+MW+ATWP+ 
Sbjct: 285 GRLIDFIKRGVTSLSRCTFLILDEADRMLEMGFEVQVQDIIGQIRPDRQTVMWTATWPQA 344

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           +++ A  ++   +QINIG+  L A
Sbjct: 345 IQQFALGFMFHPLQINIGNPDLHA 368



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 35/84 (41%), Positives = 53/84 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+++++PAI+HI + P  +  +GP  L+LAPTREL  QI   A  F   + ++   
Sbjct: 200 GSGKTISFLIPAIIHILDTPLAQYREGPRVLILAPTRELVCQIADEAIKFTKGTAIKTVR 259

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            FGG P+  Q +D + G +I +AT
Sbjct: 260 CFGGVPQSSQMKDFQSGCDICVAT 283



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 17/45 (37%), Positives = 33/45 (73%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N ++ QI+++CQE ++++K+N +++ IG  +    K +IFV+TKR
Sbjct: 369 NESVKQIIEVCQERDRDSKMNEIVKRIGSEK----KVLIFVKTKR 409


>UniRef50_Q5VQL1-2 Cluster: Isoform 2 of Q5VQL1 ; n=2;
           Magnoliophyta|Rep: Isoform 2 of Q5VQL1 - Oryza sativa
           subsp. japonica (Rice)
          Length = 759

 Score =  114 bits (275), Expect = 2e-24
 Identities = 51/79 (64%), Positives = 66/79 (83%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L + +YLVLDEADRMLDMGFEPQIRKI++Q++P RQTLM++ATWPKE
Sbjct: 362 GRLNDILEMRRVSLHQVSYLVLDEADRMLDMGFEPQIRKIVKQVQPKRQTLMFTATWPKE 421

Query: 437 VKKLAEDYLGDYIQINIGS 493
           V+K+A D L + +Q+NIG+
Sbjct: 422 VRKIASDLLSNPVQVNIGN 440



 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 45/84 (53%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  + +       R DGP  LVL+PTRELA QIQ  A  FG +S + + C
Sbjct: 278 GSGKTLGYLIPGFILLKRLQHNSR-DGPTVLVLSPTRELATQIQDEAKKFGRSSRISSVC 336

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERG +IV+AT
Sbjct: 337 LYGGAPKGPQLRDLERGADIVVAT 360



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q VD+    EK  +L+ +L+    SQEPG+K IIF  TKR
Sbjct: 447 NKSITQYVDVITPPEKSRRLDQILR----SQEPGSKIIIFCSTKR 487


>UniRef50_Q7QA96 Cluster: ENSANGP00000013118; n=5; Eumetazoa|Rep:
           ENSANGP00000013118 - Anopheles gambiae str. PEST
          Length = 512

 Score =  114 bits (274), Expect = 2e-24
 Identities = 51/87 (58%), Positives = 68/87 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +++G  ++   TYL+LDEADRMLDMGFEPQIRK++  +RPDRQT+M SATWP  
Sbjct: 238 GRLNDLVQEGVVDVSTITYLILDEADRMLDMGFEPQIRKVLLDVRPDRQTVMTSATWPDG 297

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V++LA+ Y+ D IQ+ IG+L L+A  T
Sbjct: 298 VRRLAQSYMHDPIQVYIGTLDLAATHT 324



 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G+GKTLA++LPA++HI  Q PI RG+  GP  LVLAPTRELA QI++  A +     ++ 
Sbjct: 153 GTGKTLAFLLPALIHIEGQ-PIPRGERGGPNVLVLAPTRELALQIEKEVAKYQFRG-IKA 210

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
            C++GG  +R Q   +  GVEI+IAT
Sbjct: 211 VCLYGGGDRRAQINVVRNGVEILIAT 236


>UniRef50_Q7K4L8 Cluster: LD33749p; n=1; Drosophila
           melanogaster|Rep: LD33749p - Drosophila melanogaster
           (Fruit fly)
          Length = 703

 Score =  110 bits (265), Expect = 3e-23
 Identities = 53/96 (55%), Positives = 68/96 (70%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L  G+    C  GRL D +     ++   TYLVLDEADRMLDMGFEPQIRK++  IRPDR
Sbjct: 403 LERGAEIIICTPGRLNDLIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDR 462

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           QT+M SATWP  V++LA+ Y+ + IQ+ +GSL L+A
Sbjct: 463 QTIMTSATWPPGVRRLAQSYMKNPIQVCVGSLDLAA 498



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 40/86 (46%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR--RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G+GKTLA++LP ++H   Q   R  RG G   LVLAPTRELA QI+     +     ++ 
Sbjct: 330 GTGKTLAFLLPGMIHTEYQSTPRGTRG-GANVLVLAPTRELALQIEMEVKKYSFRG-MKA 387

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
            CV+GG  +  Q  DLERG EI+I T
Sbjct: 388 VCVYGGGNRNMQISDLERGAEIIICT 413


>UniRef50_Q5JKF2 Cluster: DEAD-box ATP-dependent RNA helicase 40;
           n=8; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 40 - Oryza sativa subsp. japonica (Rice)
          Length = 792

 Score =  110 bits (265), Expect = 3e-23
 Identities = 51/80 (63%), Positives = 66/80 (82%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L++ +YLVLDEADRMLDMGFEPQIRKI+++I P RQTLM++ATWPKE
Sbjct: 281 GRLNDILEMRRISLKQVSYLVLDEADRMLDMGFEPQIRKIVKEIPPRRQTLMYTATWPKE 340

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+++AED L   +Q+ IGS+
Sbjct: 341 VRRIAEDLLVHPVQVTIGSV 360



 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 47/84 (55%), Positives = 59/84 (70%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y+LP  +HI       R  GP  LVLAPTRELA QI + A  FG +S + +TC
Sbjct: 197 GSGKTLGYLLPGFMHIKRLQNNPRS-GPTVLVLAPTRELATQILEEAVKFGRSSRISSTC 255

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDL+RGV++V+AT
Sbjct: 256 LYGGAPKGPQLRDLDRGVDVVVAT 279


>UniRef50_A2ED04 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 521

 Score =  109 bits (263), Expect = 5e-23
 Identities = 49/83 (59%), Positives = 64/83 (77%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL+ G  N  R  +LVLDEADRMLDMGFEPQIR II  +  DR+T M+SATWPKE
Sbjct: 217 GRLIDFLQSGVFNPNRANFLVLDEADRMLDMGFEPQIRAIIASLTKDRETFMFSATWPKE 276

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           +++LA D+L + I +++G  +L+
Sbjct: 277 IRQLASDFLSNPIHMHVGGEELA 299



 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 39/84 (46%), Positives = 53/84 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT ++++PA++HI+ Q  I   DGPI LVL+PTRELA Q  +VAA F      ++ C
Sbjct: 132 GSGKTASFLIPALMHISAQRKISENDGPIVLVLSPTRELALQTDEVAAQFCVKMGYKHVC 191

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG  +  Q   L    EIV AT
Sbjct: 192 IYGGEDRHRQINKLRFHPEIVTAT 215


>UniRef50_A2EVI2 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 598

 Score =  109 bits (262), Expect = 6e-23
 Identities = 51/83 (61%), Positives = 65/83 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDF+E G   + R  +LVLDEAD+MLDMGFEPQIRKII  I  DRQT+M+SATWPKE
Sbjct: 257 GRLIDFIEGGQCPMNRVNFLVLDEADQMLDMGFEPQIRKIIGHISKDRQTMMFSATWPKE 316

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           +++LA D+L D + + IG+  L+
Sbjct: 317 IQQLAADFLVDPVHMIIGNKDLT 339



 Score =  101 bits (241), Expect = 2e-20
 Identities = 48/84 (57%), Positives = 60/84 (71%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++PA+VHI  Q P+ RGDGPI LVL+PTRELAQQI +VA  F     +R TC
Sbjct: 172 GSGKTAAFLIPAMVHIGLQEPMYRGDGPIVLVLSPTRELAQQIAEVAKGFCDNLMIRQTC 231

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGGA +  QA DL     +V+AT
Sbjct: 232 LFGGAGRGPQANDLRHLPSLVVAT 255


>UniRef50_Q16T16 Cluster: DEAD box ATP-dependent RNA helicase; n=7;
           Bilateria|Rep: DEAD box ATP-dependent RNA helicase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 741

 Score =  108 bits (259), Expect = 1e-22
 Identities = 49/87 (56%), Positives = 65/87 (74%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +     ++   TYLVLDEADRMLDMGFEPQIRK++  IRPDRQT+M SATWP  
Sbjct: 456 GRLNDLVAANVIDITSITYLVLDEADRMLDMGFEPQIRKLLLDIRPDRQTIMTSATWPPG 515

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V++LA+ Y+ + +Q+ +G+L L+A  T
Sbjct: 516 VRRLAQSYMSNPVQVYVGTLDLAATHT 542



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 40/87 (45%), Positives = 58/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD---GPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKTLA++LPA +HI  Q P+ RG+   GP  LV+APTRELA QI++    +     ++
Sbjct: 370 GTGKTLAFLLPAFIHIEGQ-PVPRGEARGGPNVLVMAPTRELALQIEKEVFKYQFRD-IK 427

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
             C++GG  +R Q   ++ GVEI+IAT
Sbjct: 428 AICLYGGGDRRTQINKVKGGVEIIIAT 454


>UniRef50_Q9SQV1 Cluster: Probable DEAD-box ATP-dependent RNA
           helicase 40; n=2; core eudicotyledons|Rep: Probable
           DEAD-box ATP-dependent RNA helicase 40 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 1088

 Score =  107 bits (257), Expect = 2e-22
 Identities = 50/78 (64%), Positives = 62/78 (79%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    + Q+ + LVLDEADRMLDMGFEPQIRKI+ +I P RQTLM++ATWPKE
Sbjct: 566 GRLNDILEMKMIDFQQVSLLVLDEADRMLDMGFEPQIRKIVNEIPPRRQTLMYTATWPKE 625

Query: 437 VKKLAEDYLGDYIQINIG 490
           V+K+A D L + +Q+NIG
Sbjct: 626 VRKIASDLLVNPVQVNIG 643



 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 44/84 (52%), Positives = 59/84 (70%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++PA + + +     R +GP  L+LAPTRELA QIQ  A  FG +S +  TC
Sbjct: 482 GSGKTLGYLIPAFILLRHCRNDSR-NGPTVLILAPTRELATQIQDEALRFGRSSRISCTC 540

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q ++LERG +IV+AT
Sbjct: 541 LYGGAPKGPQLKELERGADIVVAT 564



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N  I Q V++  + EKE +L  +L+    SQE G+K IIF  TKR
Sbjct: 651 NKAITQYVEVVPQMEKERRLEQILR----SQERGSKVIIFCSTKR 691


>UniRef50_O97032 Cluster: DjVLGB; n=2; Dugesia|Rep: DjVLGB - Dugesia
           japonica (Planarian)
          Length = 781

 Score =  106 bits (254), Expect = 6e-22
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP----DRQTLMWSAT 424
           GRL+DF+EK   +L+ C Y+VLDEADRMLDMGFEPQIRKIIE+       +RQTLM+SAT
Sbjct: 320 GRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSAT 379

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++KLA D+L +YI + +G
Sbjct: 380 FPKEIQKLAADFLYNYIFMTVG 401



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN----NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+++P I H+     NQ    +   P  L+LAPTRELA QI   +  F   + +
Sbjct: 231 GSGKTAAFLIPIINHLVCQDLNQQRYSKTAYPKCLILAPTRELAIQILSESQKFSLNTPL 290

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R+  V+GGA    Q R+++ G  +++AT
Sbjct: 291 RSCVVYGGADTHSQIREVQMGCHLLVAT 318


>UniRef50_Q9LYJ9 Cluster: DEAD-box ATP-dependent RNA helicase 46;
           n=16; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           46 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 645

 Score =  105 bits (253), Expect = 8e-22
 Identities = 49/80 (61%), Positives = 63/80 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L + +YLVLDEADRMLDMGFEPQIRKI+ ++   RQTLM++ATWPKE
Sbjct: 292 GRLNDILEMKRISLHQVSYLVLDEADRMLDMGFEPQIRKIVNEVPTKRQTLMYTATWPKE 351

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+K+A D L +  Q+NIG++
Sbjct: 352 VRKIAADLLVNPAQVNIGNV 371



 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 43/84 (51%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  +H+       R  GP  LVL+PTRELA QIQ  A  FG +S +   C
Sbjct: 208 GSGKTLGYLIPGFMHLQRIHNDSRM-GPTILVLSPTRELATQIQVEALKFGKSSKISCAC 266

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q +++ERGV+IV+AT
Sbjct: 267 LYGGAPKGPQLKEIERGVDIVVAT 290



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q +++    EK ++L  +L+    SQEPG+K IIF  TKR
Sbjct: 377 NKSITQTIEVLAPMEKHSRLEQILR----SQEPGSKIIIFCSTKR 417


>UniRef50_Q86XP3 Cluster: ATP-dependent RNA helicase DDX42; n=47;
           Coelomata|Rep: ATP-dependent RNA helicase DDX42 - Homo
           sapiens (Human)
          Length = 938

 Score =  104 bits (249), Expect = 2e-21
 Identities = 51/92 (55%), Positives = 66/92 (71%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+    C  GRLID ++K  TNLQR +YLV DEADRM DMGFE Q+R I   +RPDR
Sbjct: 373 LQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDR 432

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           QTL++SAT+ K+++KLA D L D I++  G +
Sbjct: 433 QTLLFSATFRKKIEKLARDILIDPIRVVQGDI 464



 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 40/84 (47%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+I P ++HI +Q  +  GDGPIA+++ PTREL QQI      FG    +R+  
Sbjct: 300 GSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVA 359

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQA+ L+ G EIV+ T
Sbjct: 360 VYGGGSMWEQAKALQEGAEIVVCT 383


>UniRef50_A7RY08 Cluster: Predicted protein; n=2; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 518

 Score =  103 bits (247), Expect = 4e-21
 Identities = 51/95 (53%), Positives = 64/95 (67%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           S  L EG+       GRLID ++   TNL R TYLV DEADRM DMGFEPQ+R I   +R
Sbjct: 223 SKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRMFDMGFEPQVRSIANNVR 282

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           PDRQTL++SAT+ K+V+ L  D L D +++ IG L
Sbjct: 283 PDRQTLLFSATFKKKVEHLCRDILVDPVRVVIGEL 317



 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 45/84 (53%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI   A  FG    +    
Sbjct: 153 GSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVA 212

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGG  K EQ++ L+ G EIV+AT
Sbjct: 213 VFGGGNKYEQSKALQEGAEIVVAT 236


>UniRef50_Q54CB8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 573

 Score =  103 bits (246), Expect = 5e-21
 Identities = 46/84 (54%), Positives = 62/84 (73%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+IDF+E G  +L+  ++LV+DEADR+++MGFE QI  I   IRPDRQ L WSATWPK+
Sbjct: 271 GRIIDFMESGDLSLKNISFLVVDEADRLMEMGFEQQIDGIFNSIRPDRQVLYWSATWPKK 330

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V   AE ++   I++ IGS QL+A
Sbjct: 331 VSSFAEKHIRTPIRLQIGSSQLTA 354



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 41/84 (48%), Positives = 51/84 (60%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL++ILPAI HI  QP      GP  LV+APTRELA QI Q A  +     +    
Sbjct: 186 GSGKTLSFILPAIEHILAQPRQSYYPGPSVLVVAPTRELANQINQEAEQYLRLVNIEIAT 245

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAP+R Q   L R  +IV+ T
Sbjct: 246 IYGGAPRRSQQLQLSRRPKIVVGT 269


>UniRef50_Q9NXZ2 Cluster: Probable ATP-dependent RNA helicase DDX43;
           n=24; Coelomata|Rep: Probable ATP-dependent RNA helicase
           DDX43 - Homo sapiens (Human)
          Length = 648

 Score =  103 bits (246), Expect = 5e-21
 Identities = 48/87 (55%), Positives = 63/87 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D       NL+  TYLVLDEAD+MLDMGFEPQI KI+  +RPDRQT+M SATWP  
Sbjct: 374 GRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHS 433

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V +LA+ YL + + + +G+L L A+++
Sbjct: 434 VHRLAQSYLKEPMIVYVGTLDLVAVSS 460



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL Y++P  +H+  QP ++ + + P  LVL PTRELA Q++     + +   +R+ 
Sbjct: 289 GTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKG-LRSV 347

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG  + EQ  +L++GV+I+IAT
Sbjct: 348 CVYGGGNRDEQIEELKKGVDIIIAT 372


>UniRef50_Q66WQ1 Cluster: DEAD box DNA helicase; n=2; Plasmodium
           falciparum|Rep: DEAD box DNA helicase - Plasmodium
           falciparum
          Length = 516

 Score =  102 bits (245), Expect = 7e-21
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+DFLE G  NL +C Y+V+DEADR+LDMGFE Q+RKI+ Q+  ++Q L  +ATWP++
Sbjct: 260 GRLLDFLENGNINLLKCIYVVIDEADRLLDMGFEKQLRKIMTQVNKNKQLLFLTATWPEQ 319

Query: 437 VKKLAEDYLG-DYIQINIGSLQLSA 508
           V+KLA D+   D ++I IG  +L+A
Sbjct: 320 VRKLAYDFCAYDPVKIQIGKNELTA 344



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 72  RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIA 251
           R      L+L PTREL  Q+      F     +++  V+GG PK  Q  +L++G +I++A
Sbjct: 198 RASDTYGLILLPTRELCLQVLDEIKSFEKNLPIKSVAVYGGVPKYYQINNLKKGADIIVA 257

Query: 252 T 254
           T
Sbjct: 258 T 258


>UniRef50_O22907 Cluster: DEAD-box ATP-dependent RNA helicase 24;
           n=7; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 24 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 760

 Score =  102 bits (245), Expect = 7e-21
 Identities = 46/83 (55%), Positives = 63/83 (75%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L+     + R +YLVLDEADRM D+GFEPQ+R I+ QIRPDRQTL++SAT P +
Sbjct: 360 GRLIDMLKMKALTMMRASYLVLDEADRMFDLGFEPQVRSIVGQIRPDRQTLLFSATMPWK 419

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           V+KLA + L D I++ +G + ++
Sbjct: 420 VEKLAREILSDPIRVTVGEVGMA 442



 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 43/84 (51%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP IVHI +QP ++R +GPI ++ APTRELA QI   A  F     +R + 
Sbjct: 275 GSGKTAAFVLPMIVHIMDQPELQRDEGPIGVICAPTRELAHQIFLEAKKFSKAYGLRVSA 334

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG  K EQ ++L+ G EIV+AT
Sbjct: 335 VYGGMSKHEQFKELKAGCEIVVAT 358


>UniRef50_A0EA02 Cluster: Chromosome undetermined scaffold_85, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_85,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 957

 Score =  101 bits (243), Expect = 1e-20
 Identities = 44/78 (56%), Positives = 61/78 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLI+ +++G  NL + T L+LDEADRMLDMGFEPQ+R I+  IR DRQT++ SATWP E
Sbjct: 208 GRLIELIDEGMVNLNKITMLILDEADRMLDMGFEPQVRDIVSTIREDRQTILLSATWPNE 267

Query: 437 VKKLAEDYLGDYIQINIG 490
           V++L++++  D I + IG
Sbjct: 268 VQQLSKEFCYDPILVKIG 285



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 17/101 (16%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI-----QQVAADFGHTSY 167
           GSGKTLAY+LPA+VH+     I     P  L+L PTREL  QI     Q +   +G+   
Sbjct: 106 GSGKTLAYLLPALVHLEQHAMIMESPQPKLLILVPTRELGVQIYDQLLQLIEFYYGNKKQ 165

Query: 168 -----------VRNTCVFGGAP-KREQARDLERGVEIVIAT 254
                      ++  C++GG P K++Q   +++G+ +++AT
Sbjct: 166 NEKENSPNLTNLKIVCIYGGNPNKKQQVELIQKGIHVIVAT 206


>UniRef50_A4S3A0 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 440

 Score =  100 bits (239), Expect = 4e-20
 Identities = 50/102 (49%), Positives = 68/102 (66%)
 Frame = +2

Query: 203 KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE 382
           ++A    G G+       GRL DF+E+G   L R T LVLDEADRMLD+GFEP+IR I  
Sbjct: 142 QKAQMKAGGGAAVIVATPGRLRDFMEEGVIKLDRVTMLVLDEADRMLDLGFEPEIRAIAG 201

Query: 383 QIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
             R DRQT+M+SATWP+ V+ LA +++ + I++ IG+  L A
Sbjct: 202 ATRADRQTVMFSATWPQSVQSLASEFMCNPIKVRIGAEGLKA 243



 Score = 89.4 bits (212), Expect = 7e-17
 Identities = 46/86 (53%), Positives = 59/86 (68%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ +PA+  I++QPP + G  PI LVLAPTRELAQQ  +V  D G  S VR  C
Sbjct: 74  GSGKTLAFGMPALTQIHSQPPCKPGQ-PICLVLAPTRELAQQTAKVFDDAGEASGVRCVC 132

Query: 183 VFGGAPKREQARDLER--GVEIVIAT 254
           V+GGAPK EQ   ++   G  +++AT
Sbjct: 133 VYGGAPKYEQKAQMKAGGGAAVIVAT 158


>UniRef50_A0C015 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 532

 Score =  100 bits (239), Expect = 4e-20
 Identities = 51/84 (60%), Positives = 61/84 (72%), Gaps = 1/84 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLIDFL+   TNL   TYLVLDEADRMLDMGFE Q+RKI   IR DRQT+ +SATWPK 
Sbjct: 200 GRLIDFLDAQVTNLHNVTYLVLDEADRMLDMGFEQQVRKIDSYIREDRQTVFFSATWPKT 259

Query: 437 VKKLAEDYL-GDYIQINIGSLQLS 505
           V+ LA D    + I + IGS +++
Sbjct: 260 VQNLACDLCHNEPINLYIGSQEVT 283



 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/84 (48%), Positives = 56/84 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+AY+LP +VHI +Q   R+  GP+ L+L PTRELA QIQ+  + F     + + C
Sbjct: 118 GSGKTIAYLLPGLVHIESQ---RKKGGPMMLILVPTRELAMQIQEHISYFSEAYNMNSAC 174

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGA KR Q   L R  +IV+AT
Sbjct: 175 IYGGADKRPQEMALARDPDIVVAT 198


>UniRef50_Q17BQ3 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 154

 Score =   99 bits (238), Expect = 5e-20
 Identities = 44/71 (61%), Positives = 57/71 (80%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LPA++ I+ Q  +RRGDGPIAL+LAPTRELAQQI+QV  DFG    ++N C
Sbjct: 45  GSGKTLSYLLPALMPIDEQSRLRRGDGPIALILAPTRELAQQIKQVTDDFGRAIKIKNIC 104

Query: 183 VFGGAPKREQA 215
           +FGG+ KR  +
Sbjct: 105 LFGGSAKRRSS 115


>UniRef50_O00571 Cluster: ATP-dependent RNA helicase DDX3X; n=74;
           Metazoa|Rep: ATP-dependent RNA helicase DDX3X - Homo
           sapiens (Human)
          Length = 662

 Score =   99 bits (238), Expect = 5e-20
 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRPD--RQTLMWSAT 424
           GRL+D +E+G   L  C YLVLDEADRMLDMGFEPQIR+I+EQ  + P   R T+M+SAT
Sbjct: 325 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 384

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++ LA D+L +YI + +G
Sbjct: 385 FPKEIQMLARDFLDEYIFLAVG 406



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-------------IRRGDGPIALVLAPTRELAQQIQQVA 143
           GSGKT A++LP +  I +  P              RR   PI+LVLAPTRELA QI + A
Sbjct: 227 GSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 286

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
             F + S VR   V+GGA   +Q RDLERG  +++AT
Sbjct: 287 RKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVAT 323


>UniRef50_Q9P7C7 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase prp11; n=1; Schizosaccharomyces pombe|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase prp11 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 1014

 Score = 99.5 bits (237), Expect = 7e-20
 Identities = 49/99 (49%), Positives = 65/99 (65%), Gaps = 3/99 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L       TNL RCTYLVLDEADRM D+GFEPQ+ +II  IR
Sbjct: 538 LKRGAEIVVCTPGRMIDVLSANAGRVTNLHRCTYLVLDEADRMFDLGFEPQVMRIINNIR 597

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           PDRQT+++SAT+P+ ++ LA   L   ++I +G   + A
Sbjct: 598 PDRQTVLFSATFPRAMEALARKVLKKPVEITVGGRSVVA 636



 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q P++ G+GPIA+++ PTRELA QI +    F     +R  C
Sbjct: 465 GSGKTIAFLLPMFRHIKDQRPLKTGEGPIAIIMTPTRELAVQIFRECKPFLKLLNIRACC 524

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GGAP ++Q  DL+RG EIV+ T
Sbjct: 525 AYGGAPIKDQIADLKRGAEIVVCT 548


>UniRef50_Q54T87 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 586

 Score = 99.1 bits (236), Expect = 9e-20
 Identities = 51/83 (61%), Positives = 61/83 (73%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   +L    YLVLDEADRMLDMGF PQI  +I+QI  +RQTLM+SATWPKE
Sbjct: 243 GRLNDLLRKH--HLSSVQYLVLDEADRMLDMGFMPQIESLIDQIPKERQTLMFSATWPKE 300

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           VK LA  +L D I+I +GS +L+
Sbjct: 301 VKLLASKFLKDPIKITVGSQELT 323



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 41/85 (48%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR-GDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKTLA++LPA++ I + P     G  P+ LV+APTRELAQQI++V       + +R  
Sbjct: 157 GSGKTLAFLLPALLKIISLPKRPSYGATPLVLVMAPTRELAQQIEEVCKTSIRGTSIRQL 216

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C +GG  K +Q+R L  GV+IVI T
Sbjct: 217 CAYGGLGKIDQSRILRNGVDIVIGT 241


>UniRef50_Q9SF41 Cluster: DEAD-box ATP-dependent RNA helicase 45;
           n=15; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           45 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 989

 Score = 99.1 bits (236), Expect = 9e-20
 Identities = 48/93 (51%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TYLV+DEADRM DMGFEPQI +I++ IR
Sbjct: 516 LKRGTEIVVCTPGRMIDILCTSSGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIR 575

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+++SAT+P++V+ LA   L   ++I +G
Sbjct: 576 PDRQTVLFSATFPRQVETLARKVLNKPVEIQVG 608



 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 41/84 (48%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL ++LP + HI +QPP+  GDGPI LV+APTREL QQI      F     +    
Sbjct: 443 GSGKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIYSDIRKFSKALGIICVP 502

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+   +Q  +L+RG EIV+ T
Sbjct: 503 VYGGSGVAQQISELKRGTEIVVCT 526


>UniRef50_Q9LKL6 Cluster: DEAD box protein P68; n=5;
           Viridiplantae|Rep: DEAD box protein P68 - Pisum sativum
           (Garden pea)
          Length = 622

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 43/80 (53%), Positives = 62/80 (77%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR ID L++G T+L R +Y+VLDEADRMLDMGFEPQIR+I+  +    QTL++SAT P E
Sbjct: 251 GRFIDHLQQGNTSLSRISYVVLDEADRMLDMGFEPQIREIMRSLPEKHQTLLFSATMPVE 310

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           ++ LA++YL + +Q+ +G +
Sbjct: 311 IEALAKEYLANPVQVKVGKV 330



 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 45/85 (52%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYVRNT 179
           GSGKT A+ +P + H   QPPIRRGDGP+ALVLAPTRELAQQI++    F  +   ++N 
Sbjct: 165 GSGKTAAFTIPMLQHCLVQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESLKNC 224

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V GG    +Q  +L  GVEI +AT
Sbjct: 225 IVVGGTNIEKQRSELRAGVEIAVAT 249


>UniRef50_A4S294 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 723

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 50/93 (53%), Positives = 65/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L  G+   TNL+R TY+VLDEADRM DMGFEPQI +I+  +R
Sbjct: 237 LKRGAEIVACTPGRMIDLLTTGSGKITNLRRVTYMVLDEADRMFDMGFEPQITRILANLR 296

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P  ++ LA   L + I+I IG
Sbjct: 297 PDRQTVMFSATFPHTMEALARAALDNPIEIQIG 329



 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 41/84 (48%), Positives = 51/84 (60%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAYILP + HIN Q P+  GDGPI +++ PTREL  QI +    +G         
Sbjct: 164 GSGKTLAYILPMLRHINAQEPLASGDGPIGMIMGPTRELVTQIGKDCKRYGKAMGFSAVS 223

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+    Q  DL+RG EIV  T
Sbjct: 224 VYGGSGIAAQIGDLKRGAEIVACT 247


>UniRef50_UPI00006CDDA3 Cluster: CLN3 protein; n=1; Tetrahymena
           thermophila SB210|Rep: CLN3 protein - Tetrahymena
           thermophila SB210
          Length = 1138

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 43/78 (55%), Positives = 61/78 (78%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL++ ++K  TNL+RCTY+V+DEAD+M  MGFE QIR I++QIRPDRQTL+++AT  K+
Sbjct: 194 GRLMEMIQKKATNLRRCTYVVIDEADKMFSMGFEKQIRSIMQQIRPDRQTLLFTATLKKK 253

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++ L  D L + + I IG
Sbjct: 254 IQNLVMDVLRNPVTIKIG 271



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 36/84 (42%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT++Y+ P ++HI +Q  + + +GPI L+LAPTREL QQ+   +  +     +    
Sbjct: 109 GSGKTVSYLWPLLIHILDQRELEKNEGPIGLILAPTRELCQQVYTESKRYAKIYNISVGA 168

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG  K EQ + L+ GVEI+IAT
Sbjct: 169 LLGGENKHEQWKMLKAGVEILIAT 192


>UniRef50_UPI00015609AE Cluster: PREDICTED: similar to DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 53; n=2; Equus
           caballus|Rep: PREDICTED: similar to DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 53 - Equus caballus
          Length = 711

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 46/87 (52%), Positives = 61/87 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D       NL+  TYLVLDEAD+MLD+GFE QI KI+  +RPDRQT+M SATWP  
Sbjct: 437 GRLNDLQMNKCVNLRSITYLVLDEADKMLDLGFEGQITKILLDVRPDRQTVMTSATWPHT 496

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           +++LA  YL + + + +G+L L A+ T
Sbjct: 497 IRQLARSYLKEPMIVYVGTLDLVAVHT 523



 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 35/85 (41%), Positives = 60/85 (70%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL+Y++P  +H+++QP  R   +GP  LVL PTRELA Q++   + + +   +++ 
Sbjct: 352 GTGKTLSYLIPGFIHLDSQPISREERNGPGMLVLTPTRELALQVEAECSKYSYKG-LKSV 410

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG  ++EQ + + +GV+I+IAT
Sbjct: 411 CVYGGGNRKEQIQHITKGVDIIIAT 435


>UniRef50_Q012E3 Cluster: DEAD-box protein abstrakt; n=1;
           Ostreococcus tauri|Rep: DEAD-box protein abstrakt -
           Ostreococcus tauri
          Length = 1030

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 49/93 (52%), Positives = 64/93 (68%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L  G    TNL+R TY+VLDEADRM DMGFEPQI +I+  +R
Sbjct: 450 LKRGAEIVACTPGRMIDILTTGGGKITNLRRVTYIVLDEADRMFDMGFEPQITRILANLR 509

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P  ++ LA   L + ++I IG
Sbjct: 510 PDRQTVMFSATFPHTMEALARAALENPVEIQIG 542



 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 41/84 (48%), Positives = 53/84 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAYILP + HIN Q P++ GDGPI +++ PTREL  QI + A  +G         
Sbjct: 377 GSGKTLAYILPMLRHINAQEPLKNGDGPIGMIMGPTRELVTQIGKEAKRYGKALGFNAVS 436

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+    Q  +L+RG EIV  T
Sbjct: 437 VYGGSGIAAQIGELKRGAEIVACT 460


>UniRef50_Q9VXW2 Cluster: CG6227-PA; n=11; Coelomata|Rep: CG6227-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 1224

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TY+VLDEADRM DMGFEPQ+ +II+ +R
Sbjct: 630 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVR 689

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+M+SAT+P++++ LA   L   I++ +G
Sbjct: 690 PDRQTVMFSATFPRQMEALARRILKKPIEVIVG 722



 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 41/84 (48%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ILP   HI +QP +  GDG IA+++APTREL  QI +    F  +  +R  C
Sbjct: 557 GSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVC 616

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ  +L+RG EI++ T
Sbjct: 617 VYGGTGISEQIAELKRGAEIIVCT 640


>UniRef50_A0BDD2 Cluster: Chromosome undetermined scaffold_100,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_100,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 737

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 46/78 (58%), Positives = 60/78 (76%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLI+ ++K  TNLQRCTY+VLDEAD+M  +GFE QIR II QIRPD+Q L+++AT  K+
Sbjct: 320 GRLIEMVKKKATNLQRCTYIVLDEADQMFSLGFEYQIRSIIGQIRPDKQILLFTATMKKK 379

Query: 437 VKKLAEDYLGDYIQINIG 490
           +++L  D L D I I IG
Sbjct: 380 IRQLCVDMLIDPIVITIG 397



 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 34/84 (40%), Positives = 52/84 (61%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+AY+ P +VH++ Q  + + +GPI LV+ PTREL QQ+      +     +  + 
Sbjct: 235 GSGKTIAYVWPMLVHVSAQRAVEKKEGPIGLVVVPTRELGQQVYLETKKYAQLFQISVSA 294

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG  K  Q ++L  GV+I+IAT
Sbjct: 295 LLGGENKHHQWKELRAGVDIIIAT 318


>UniRef50_Q6BML1 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=4; Saccharomycetales|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 913

 Score = 97.1 bits (231), Expect = 3e-19
 Identities = 47/97 (48%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GR+ID L   +   TNLQR TYLVLDEADRM DMGFEPQ+ K+  ++RPDRQT+++SAT+
Sbjct: 449 GRIIDLLAANSGRVTNLQRVTYLVLDEADRMFDMGFEPQVTKVFTRVRPDRQTVLFSATF 508

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSAITTFFKL*IF 538
           P++++ LA+  L + ++I +G + + A     K+ +F
Sbjct: 509 PRKMELLAKKILDNPMEIVVGGISVVASEITQKVELF 545



 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 39/84 (46%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+++LP + HI +QPP+RRGDGPI L++ PTRELA QI +    F     + + C
Sbjct: 364 GSGKTLSFVLPLLRHIQDQPPLRRGDGPIGLIMTPTRELALQIHKELNHFTKKLNISSCC 423

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            FGG+    Q  +L++G +I++ T
Sbjct: 424 CFGGSSIESQIAELKKGAQIIVGT 447


>UniRef50_Q6BG49 Cluster: RNA helicase, putative; n=1; Paramecium
           tetraurelia|Rep: RNA helicase, putative - Paramecium
           tetraurelia
          Length = 1157

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 57/120 (47%), Positives = 74/120 (61%), Gaps = 4/120 (3%)
 Frame = +2

Query: 143 CRFWTHILCS*HVC-VWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGT---TNLQRCT 310
           CR++T IL    VC V           L  G+    C  GR+ID L       TNL+R T
Sbjct: 597 CRWFTSILNLNVVCCVGGAGIAGQLSDLKRGTEIVVCTPGRMIDVLTTSNGKITNLRRVT 656

Query: 311 YLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           Y+V+DEADRM D+GFEPQI KII+ IRPDRQ +M+SAT+PK V++LA+  L   I+  +G
Sbjct: 657 YVVIDEADRMFDLGFEPQICKIIQNIRPDRQLVMFSATFPKNVEQLAKRVLRKPIECIVG 716



 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 42/84 (50%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY+LP + H+ +QP ++ GDGPIA+++APTRELA QI      F     +   C
Sbjct: 551 GSGKTLAYLLPLLRHVLDQPALKDGDGPIAIIMAPTRELAHQIYVNCRWFTSILNLNVVC 610

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GGA    Q  DL+RG EIV+ T
Sbjct: 611 CVGGAGIAGQLSDLKRGTEIVVCT 634


>UniRef50_A5K071 Cluster: ATP-dependent RNA helicase, putative; n=6;
           Plasmodium|Rep: ATP-dependent RNA helicase, putative -
           Plasmodium vivax
          Length = 717

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 43/85 (50%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D LE G  +L RC Y+V+DEADR+LDMGFE Q++KI+ Q+  ++Q L ++ATWP++
Sbjct: 460 GRLLDLLESGVIHLLRCIYVVIDEADRLLDMGFEKQLKKIMTQVNRNKQLLFFTATWPEQ 519

Query: 437 VKKLAEDYLG-DYIQINIGSLQLSA 508
           V+KLA  +   D ++I IG  +L+A
Sbjct: 520 VRKLAYQFSSFDPVKIQIGKSELTA 544



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +3

Query: 93  LVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           L+L PTREL  Q+      F    ++R+  V+GG PK  Q  +L++G +IV+AT
Sbjct: 405 LILLPTRELCMQVVDEIKAFEKELHIRSVAVYGGVPKYTQISNLKKGADIVVAT 458


>UniRef50_A0BDT5 Cluster: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_101,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1238

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 47/86 (54%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+DFL +G T L   +YLV+DEADR+L++GFE  IR+I++QIR DRQT+ +SATWPK 
Sbjct: 232 GRLLDFLREGATTLANVSYLVIDEADRLLELGFEDTIREIVQQIRFDRQTVFFSATWPKA 291

Query: 437 VKKLAED---YLGDYIQINIGSLQLS 505
           VK LA D   Y   Y+QI   +L ++
Sbjct: 292 VKDLAFDFCQYSPIYVQIGKSNLTIN 317



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP-----IRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT+AY+LP ++ I +Q        ++ +GP  L+L PTRELA QI+     F     
Sbjct: 141 GSGKTIAYLLPGLIQITSQKTEELNNTKKQNGPQMLILVPTRELAMQIESEIQLFTQNYR 200

Query: 168 VRNTCVFGGAPKRE-QARDLERGVEIVIAT 254
           ++  C++GG   R+ Q  +L R   I++AT
Sbjct: 201 LKTLCIYGGINNRKNQFYNLGRFPNILVAT 230


>UniRef50_Q93382 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 811

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 45/90 (50%), Positives = 63/90 (70%)
 Frame = +2

Query: 227 EGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQT 406
           EG+    C  GR+ID ++ G TN  R T+LV DEADRM DMGFE Q++ I + +RPDRQ 
Sbjct: 388 EGAEMVVCTPGRIIDLVKMGATNFLRTTFLVFDEADRMFDMGFEAQVKSISDHVRPDRQC 447

Query: 407 LMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           LM+SAT+ ++V++LA D L D ++I  G +
Sbjct: 448 LMFSATFKQKVERLARDALVDPVRIVQGEV 477



 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT AY+ PAIVHI +QP ++ G+GP+A+++ PTRELA Q+ Q A  F     +   C
Sbjct: 312 GSGKTAAYLWPAIVHIMDQPDLKAGEGPVAVIVVPTRELAIQVFQEAKKFCKVYNINPIC 371

Query: 183 VFGGAPKREQARDLE-RGVEIVIAT 254
            +GG  K EQ+ +L+  G E+V+ T
Sbjct: 372 AYGGGSKWEQSNELQNEGAEMVVCT 396


>UniRef50_Q8H0U8 Cluster: DEAD-box ATP-dependent RNA helicase 42;
           n=2; Arabidopsis thaliana|Rep: DEAD-box ATP-dependent
           RNA helicase 42 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1166

 Score = 96.3 bits (229), Expect = 6e-19
 Identities = 47/93 (50%), Positives = 66/93 (70%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R T+LV+DEADRM DMGFEPQI +II+ IR
Sbjct: 649 LKRGTEIVVCTPGRMIDILCTSSGKITNLRRVTFLVMDEADRMFDMGFEPQITRIIQNIR 708

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           P+RQT+++SAT+P++V+ LA   L   ++I +G
Sbjct: 709 PERQTVLFSATFPRQVETLARKVLNKPVEIQVG 741



 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 42/84 (50%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL ++LP + HI +QPP+  GDGPI LV+APTREL QQI      F     +R   
Sbjct: 576 GSGKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIHSDIRKFSKPLGIRCVP 635

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+   +Q  +L+RG EIV+ T
Sbjct: 636 VYGGSGVAQQISELKRGTEIVVCT 659


>UniRef50_Q65XX1 Cluster: Vasa-and belle-like helicase protein 1,
           isoform c; n=4; Caenorhabditis|Rep: Vasa-and belle-like
           helicase protein 1, isoform c - Caenorhabditis elegans
          Length = 660

 Score = 95.9 bits (228), Expect = 8e-19
 Identities = 50/82 (60%), Positives = 61/82 (74%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD---RQTLMWSATW 427
           GRLID +E+G   L  C YLVLDEADRMLDMGFEPQIRKI+ Q  P    R T M+SAT+
Sbjct: 282 GRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTARTTAMFSATF 341

Query: 428 PKEVKKLAEDYLGD-YIQINIG 490
           PKE++ LA+D+L D YI + +G
Sbjct: 342 PKEIQVLAKDFLKDNYIFLAVG 363



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 11/95 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN------QPPI----RRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A++LP I HI        +PP     RR   P ALVL+PTRELA QI + A  F
Sbjct: 186 GSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKF 245

Query: 153 GHTSYVRNTCVFGGAPK-REQARDLERGVEIVIAT 254
            + S ++   ++GG    R+Q   L  G  I+IAT
Sbjct: 246 SYKSNIQTAILYGGRENYRDQVNRLRAGTHILIAT 280


>UniRef50_O97031 Cluster: DjVLGA; n=1; Dugesia japonica|Rep: DjVLGA
           - Dugesia japonica (Planarian)
          Length = 726

 Score = 95.9 bits (228), Expect = 8e-19
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 4/84 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL D LE+    L    YLVLDEADRMLDMGFEPQIRKI+EQ        RQTLM+SAT
Sbjct: 350 GRLSDMLERCKIGLDCIRYLVLDEADRMLDMGFEPQIRKIVEQTNMPPPGQRQTLMFSAT 409

Query: 425 WPKEVKKLAEDYLGDYIQINIGSL 496
           +P+E++ LA D+L DY+ + +G +
Sbjct: 410 FPREIQMLASDFLKDYLFLRVGKV 433



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-------RGDGPIALVLAPTRELAQQIQQVAADFGHT 161
           GSGKT A+++P +  +    P         + + P+AL+LAPTRELA QI   A  F + 
Sbjct: 258 GSGKTAAFLIPLLSMMYQDGPGNSLSHSGYKKEYPVALILAPTRELAVQIYDEARKFSYR 317

Query: 162 SYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           S VR   V+GG   R Q +D+ +G  +++AT
Sbjct: 318 SLVRPCVVYGGRDIRGQLQDISQGCNMLVAT 348


>UniRef50_Q9M2F9 Cluster: DEAD-box ATP-dependent RNA helicase 52;
           n=22; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           52 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 646

 Score = 95.9 bits (228), Expect = 8e-19
 Identities = 46/82 (56%), Positives = 64/82 (78%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPD---RQTLMWSAT 424
           GRL D LE+G  +LQ   +L LDEADRMLDMGFEPQIRKI++Q+  P    RQT+++SAT
Sbjct: 283 GRLNDLLERGRVSLQMVRFLALDEADRMLDMGFEPQIRKIVQQMDMPPPGVRQTMLFSAT 342

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P+E+++LA D+L +YI + +G
Sbjct: 343 FPREIQRLASDFLSNYIFLAVG 364



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 39/89 (43%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-----PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I     I R  G     P+A++L+PTRELA QI   A  F + + 
Sbjct: 193 GSGKTAAFCFPIISGIMKDQHIERPRGVRGVYPLAVILSPTRELACQIHDEARKFSYQTG 252

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           V+    +GG P  +Q R+LERGV+I++AT
Sbjct: 253 VKVVVAYGGTPVNQQIRELERGVDILVAT 281


>UniRef50_Q9VHP0 Cluster: ATP-dependent RNA helicase bel; n=4;
           Protostomia|Rep: ATP-dependent RNA helicase bel -
           Drosophila melanogaster (Fruit fly)
          Length = 798

 Score = 95.9 bits (228), Expect = 8e-19
 Identities = 45/82 (54%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL D + +G   L+   +LVLDEADRMLDMGFEPQIR+I+EQ+       RQTLM+SAT
Sbjct: 437 GRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSAT 496

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PK++++LA D+L +YI + +G
Sbjct: 497 FPKQIQELASDFLSNYIFLAVG 518



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAI---VHINNQPP-------IRRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A+++P +     + + PP        RR   P+ LVLAPTRELA QI + A  F
Sbjct: 342 GSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKF 401

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            + S +R   ++GG    EQ R+L+RG  +++AT
Sbjct: 402 AYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVAT 435


>UniRef50_Q4JF01 Cluster: Vasa homlogue; n=2; Eukaryota|Rep: Vasa
           homlogue - Platynereis dumerilii (Dumeril's clam worm)
          Length = 712

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 42/82 (51%), Positives = 62/82 (75%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL+DF+ KG  NL +  YL+LDEADRMLDMGFEP+IRK++       +  RQTLM+SAT
Sbjct: 408 GRLLDFIGKGKINLSKVKYLILDEADRMLDMGFEPEIRKLVTTFDMPEKGQRQTLMFSAT 467

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +  E+++LA+++L +Y+ + +G
Sbjct: 468 FAAEIQQLAKEFLSEYVFVTVG 489



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG------PIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKT A++LP +  I     I  G G      P A+++ PTREL  QI   A  F  ++
Sbjct: 317 GSGKTAAFLLPVLTGIIKNDLIEGGSGFGGPQYPAAIIVGPTRELVNQIYLEARKFASST 376

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            VR   V+GG     QAR+LE+G  +V+ T
Sbjct: 377 CVRPVVVYGGTSVGYQARELEKGAHVVVGT 406


>UniRef50_Q4PFD9 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Ustilago maydis|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Ustilago maydis (Smut fungus)
          Length = 1156

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 48/88 (54%), Positives = 63/88 (71%), Gaps = 4/88 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRLID L   +   TNL R TYLVLDEADRM DMGFEPQ+ KI+  IRPDRQT+++SAT+
Sbjct: 608 GRLIDLLTANSGRVTNLYRVTYLVLDEADRMFDMGFEPQVMKILNNIRPDRQTVLFSATF 667

Query: 428 PKEVKKLAEDYLGDY-IQINIGSLQLSA 508
           PK+++ LA   L +  ++I +G   + A
Sbjct: 668 PKQMESLARKVLKNKPLEITVGGRSVVA 695



 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 36/84 (42%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q P+   +GP+ +++ PTRELA QI +    F     +R  C
Sbjct: 523 GSGKTMAFLLPMFRHIKDQRPVEPSEGPVGIIMTPTRELAVQIYREMRPFIKALGLRAAC 582

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGAP  EQ  ++++  +IV+AT
Sbjct: 583 VYGGAPISEQIAEMKKTADIVVAT 606


>UniRef50_A0D315 Cluster: Chromosome undetermined scaffold_36, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_36,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1127

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 43/84 (51%), Positives = 61/84 (72%), Gaps = 1/84 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL DFL++G  +L + TYLV+DEADR+LDMGFE  +R I+++ R DRQT+ +SATWPK 
Sbjct: 236 GRLKDFLQEGILDLSKVTYLVIDEADRLLDMGFEDDVRFIVQRTRQDRQTVFFSATWPKA 295

Query: 437 VKKLAEDYLG-DYIQINIGSLQLS 505
           V+ L+ D+   D I + +G   L+
Sbjct: 296 VRNLSLDFCAEDPIYVQVGRSNLT 319



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 4/87 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ---PPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT  Y+LP ++ I  Q      R R +GP  L+LAPTREL  QI Q  + F   + +
Sbjct: 147 GSGKTFGYLLPGLIQIKCQNYGSNFRNRINGPEILILAPTRELVMQIAQQVSLFMKPNNL 206

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIA 251
                +GG  + +QA+ ++R  +I++A
Sbjct: 207 TVATAYGGQNRDQQAQQIKRNPDILVA 233


>UniRef50_A5E058 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Lodderomyces elongisporus NRRL
           YB-4239|Rep: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5 - Lodderomyces elongisporus (Yeast)
           (Saccharomyces elongisporus)
          Length = 994

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 46/87 (52%), Positives = 66/87 (75%), Gaps = 3/87 (3%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRLID L       T L+R T++VLDEADRM DMGFEPQI+KI  QIRPD+QT+++SAT+
Sbjct: 520 GRLIDLLAANGGRITTLRRTTFVVLDEADRMFDMGFEPQIQKIFTQIRPDKQTVLFSATF 579

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P+++++LA+  L + I+I +G + + A
Sbjct: 580 PRKLEQLAKKVLHNPIEIIVGGVSVVA 606



 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 39/84 (46%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LP + HI +Q   + G+GPI LVL+PTRELA QI++    F  T  ++  C
Sbjct: 435 GSGKTLSYVLPMVRHIQDQLFPKPGEGPIGLVLSPTRELALQIEKEILKFSSTMDLKVCC 494

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG+    Q  +L+RGV +++AT
Sbjct: 495 CYGGSNIENQISELKRGVNVIVAT 518


>UniRef50_Q4IP34 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=15; Pezizomycotina|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Gibberella zeae (Fusarium graminearum)
          Length = 1227

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 42/84 (50%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +QPP++  DGPI L++ PTRELA QI +    F     +R  C
Sbjct: 644 GSGKTVAFLLPMFRHIKDQPPLKDTDGPIGLIMTPTRELAVQIHKDCKPFLKMMGLRAVC 703

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GGAP REQ  +L+RG EI++ T
Sbjct: 704 AYGGAPIREQIAELKRGAEIIVCT 727



 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 46/99 (46%), Positives = 63/99 (63%), Gaps = 3/99 (3%)
 Frame = +2

Query: 221  LGEGSRNSHCYSGRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
            L  G+    C  GR+ID L       TNL+R TY+VLDEADRM DMGFEPQ+ KI   +R
Sbjct: 717  LKRGAEIIVCTPGRMIDLLAANQGRVTNLKRVTYVVLDEADRMFDMGFEPQVMKIFANMR 776

Query: 392  PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
            PDRQT+++SAT P+ +  L +  L + I++ +G   + A
Sbjct: 777  PDRQTILFSATMPRIIDSLTKKVLKNPIEVTVGGRSVVA 815


>UniRef50_Q965K2 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 970

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 46/93 (49%), Positives = 63/93 (67%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R TYLVLDEADRM D GFEPQI K++  IR
Sbjct: 424 LKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIR 483

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PD+QT+++SAT+P+ ++ LA   L   ++I +G
Sbjct: 484 PDKQTVLFSATFPRHMEALARKVLDKPVEILVG 516



 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 43/84 (51%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP   HI +QP +  GDGPIA++LAPTRELA Q  + A  F     ++  C
Sbjct: 351 GSGKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVAC 410

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG    EQ  DL+RG EIV+ T
Sbjct: 411 TYGGVGISEQIADLKRGAEIVVCT 434


>UniRef50_P24784 Cluster: ATP-dependent RNA helicase DBP1; n=103;
           Eukaryota|Rep: ATP-dependent RNA helicase DBP1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 617

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL D LE+G  +L    YLVLDEADRMLDMGFEPQIR I+E+       +RQTLM+SAT
Sbjct: 296 GRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSAT 355

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P +++ LA D+L +YI +++G
Sbjct: 356 FPVDIQHLARDFLDNYIFLSVG 377



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP----------IRRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT  ++ P    +    P            R   P ALVLAPTRELA QI + A  F
Sbjct: 201 GSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKF 260

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            + S+VR   V+GGAP   Q R+++RG ++++AT
Sbjct: 261 TYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVAT 294


>UniRef50_UPI00004992E6 Cluster: DEAD/DEAH box helicase; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 578

 Score = 93.1 bits (221), Expect = 6e-18
 Identities = 48/94 (51%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE--QIRP 394
           +G+G        GRL+ F EK   +L    YL+ DEADRMLDMGFEPQIR+I E  ++ P
Sbjct: 259 MGKGCDILVATPGRLLYFTEKKIVSLSSVRYLIFDEADRMLDMGFEPQIREICEDNEMPP 318

Query: 395 --DRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
              RQTLM+SAT+PK++++LA D+L DY+ I +G
Sbjct: 319 VGKRQTLMFSATFPKQIQRLAADFLDDYVFITVG 352



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 8/92 (8%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG--------PIALVLAPTRELAQQIQQVAADFGH 158
           GSGKT A++ P I  I   PP+ R           P+AL+LAPTREL QQI + A  F  
Sbjct: 178 GSGKTAAFLFPIISDILKNPPMPRQSNFSHRVTVFPVALILAPTRELGQQIYEEAVRFTE 237

Query: 159 TSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            + +R+ CV+GG+    Q +++ +G +I++AT
Sbjct: 238 DTPIRSVCVYGGSDSYTQIQEMGKGCDILVAT 269



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 478 DQYRIITTFRNHNILQ-IVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           D Y  IT  R  + ++ I  I    E+E K   +L  +G+    G KT+IFVETKR
Sbjct: 344 DDYVFITVGRAGSTVESIQQIILWVEEEIKQEAILDVLGEFAGKGQKTVIFVETKR 399


>UniRef50_UPI000065DC0B Cluster: Probable ATP-dependent RNA helicase
           DDX43 (EC 3.6.1.-) (DEAD box protein 43) (DEAD box
           protein HAGE) (Helical antigen).; n=1; Takifugu
           rubripes|Rep: Probable ATP-dependent RNA helicase DDX43
           (EC 3.6.1.-) (DEAD box protein 43) (DEAD box protein
           HAGE) (Helical antigen). - Takifugu rubripes
          Length = 510

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 40/67 (59%), Positives = 54/67 (80%)
 Frame = +2

Query: 317 VLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
           VLDEADRMLD+GFEPQI KI+  +RPDRQT+M SATWP  V+++A  YL D + + +GSL
Sbjct: 253 VLDEADRMLDLGFEPQIMKILLDVRPDRQTVMTSATWPASVRRMATSYLKDPMMVYVGSL 312

Query: 497 QLSAITT 517
            L+A+++
Sbjct: 313 DLTAVSS 319



 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 41/85 (48%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP-PIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTLAY+LP  +H+N QP P    +GP  LVL PTRELA Q+      + +  Y ++ 
Sbjct: 122 GTGKTLAYLLPGFIHMNGQPVPKCERNGPGMLVLTPTRELALQVDAECKKYSYKDY-KSV 180

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG  ++ Q   +ERGV+IVIAT
Sbjct: 181 CVYGGGDRKAQIHKVERGVDIVIAT 205


>UniRef50_Q013X8 Cluster: DEAD/DEAH box RNA helicase; n=1;
           Ostreococcus tauri|Rep: DEAD/DEAH box RNA helicase -
           Ostreococcus tauri
          Length = 507

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 46/85 (54%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LPA   I+ Q P+R+ +GP+ALVLAPTRELA QI   A  F         C
Sbjct: 150 GSGKTLAFLLPAYAQISRQRPLRKKEGPMALVLAPTRELATQIANEANAFNRAGVPARCC 209

Query: 183 -VFGGAPKREQARDLERGVEIVIAT 254
            +FGGA K EQ + L  G EIV+AT
Sbjct: 210 AIFGGASKHEQLKRLRAGAEIVVAT 234



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 23/33 (69%), Positives = 26/33 (78%), Gaps = 1/33 (3%)
 Frame = +2

Query: 257 GRLIDFLE-KGTTNLQRCTYLVLDEADRMLDMG 352
           GRLID L  K + +L+R TYL LDEADRMLDMG
Sbjct: 236 GRLIDVLHVKNSIDLRRVTYLALDEADRMLDMG 268


>UniRef50_A4S107 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 478

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 45/82 (54%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +2

Query: 257 GRLIDFL-EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+D L  K +TNL+R TYL LDEADRMLDMGFE  +R I + +RPDRQ +M+SAT P 
Sbjct: 189 GRLVDVLCMKNSTNLRRVTYLALDEADRMLDMGFEKIVRSICQAVRPDRQCVMFSATMPA 248

Query: 434 EVKKLAEDYLG-DYIQINIGSL 496
            +++LA D L  D + ++IG++
Sbjct: 249 AMQRLARDVLARDAVTVSIGNV 270



 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH--TSYVRN 176
           GSGKTLA++LPA   I+ Q P+ + +GPIALVLAPTRELA QI   A  F     S  R 
Sbjct: 102 GSGKTLAFLLPAYAQISRQRPLTKREGPIALVLAPTRELASQIANEAHKFTKFGVSGARC 161

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             +FGG  KR+Q + L  G EIV+AT
Sbjct: 162 CAIFGGVSKRDQFKKLRAGAEIVVAT 187


>UniRef50_Q7QDB7 Cluster: ENSANGP00000017541; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017541 - Anopheles gambiae
           str. PEST
          Length = 771

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 45/89 (50%), Positives = 64/89 (71%), Gaps = 4/89 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL D + +G   L    +LVLDEADRMLDMGFEPQIR+I+E+ R     +RQTLM+SAT
Sbjct: 442 GRLEDMIGRGKVGLDNIRFLVLDEADRMLDMGFEPQIRRIVEESRMPVTGERQTLMFSAT 501

Query: 425 WPKEVKKLAEDYLGDYIQINIGSLQLSAI 511
           +PK +++LA D+L  YI + +G +  +++
Sbjct: 502 FPKAIQELASDFLYRYIFLAVGRVGSTSV 530



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 16/50 (32%), Positives = 28/50 (56%)
 Frame = +3

Query: 105 PTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           P  +    I + +  F + S +R   ++GG   ++Q RDLERG  +++AT
Sbjct: 391 PGADPEPDIFEESKKFCYRSRMRPAVLYGGNNTQDQMRDLERGCHLIVAT 440


>UniRef50_Q61JF4 Cluster: Putative uncharacterized protein CBG09816;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG09816 - Caenorhabditis
           briggsae
          Length = 628

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 45/83 (54%), Positives = 63/83 (75%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR----PDRQTLMWSAT 424
           GRL+D +E+G   L+ C YLVLDEADRMLDMGFEPQIR+++E  R     +R T M+SAT
Sbjct: 303 GRLLDVMEQGLIGLEGCRYLVLDEADRMLDMGFEPQIRQVVEFNRMPPKEERVTAMFSAT 362

Query: 425 WPKEVKKLAEDYL-GDYIQINIG 490
           +PKE++ LA+D+L  +Y+ + +G
Sbjct: 363 FPKEIQLLAQDFLKQNYVFLAVG 385


>UniRef50_Q9XVZ6 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 504

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 46/93 (49%), Positives = 61/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D    G  +L   TY+VLDEADRMLDMGFE  IR+I+ +IRPDR   + SATWP+ 
Sbjct: 221 GRLTDLSNDGVISLASVTYVVLDEADRMLDMGFEVAIRRILFEIRPDRLVALTSATWPEG 280

Query: 437 VKKLAEDYLGDYIQINIGSLQLS---AITTFFK 526
           V+KL + Y  + +    GSL L+   ++T FF+
Sbjct: 281 VRKLTDKYTKEAVMAVNGSLDLTSCKSVTQFFE 313



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 41/90 (45%), Positives = 56/90 (62%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ-PPIRRGD-----GPIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKTLA++LPA++HI+ Q     + D      P  LVL+PTRELAQQI+     + +  
Sbjct: 131 GSGKTLAFLLPALLHIDAQLAQYEKNDEEQKPSPFVLVLSPTRELAQQIEGEVKKYSYNG 190

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           Y ++ C++GG  + EQ      GVEIVIAT
Sbjct: 191 Y-KSVCLYGGGSRPEQVEACRGGVEIVIAT 219


>UniRef50_Q869K2 Cluster: Similar to Dictyostelium discoideum (Slime
           mold). Putative RNA helicase; n=3; Dictyostelium
           discoideum|Rep: Similar to Dictyostelium discoideum
           (Slime mold). Putative RNA helicase - Dictyostelium
           discoideum (Slime mold)
          Length = 1151

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 45/84 (53%), Positives = 60/84 (71%), Gaps = 3/84 (3%)
 Frame = +2

Query: 248 CYSGRLIDFL---EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWS 418
           C  GR+ID L    +  TNL+R T+LVLDEADRM DMGF PQI  I++ IRPDRQT+M+S
Sbjct: 638 CTPGRMIDILCANNRRITNLRRVTFLVLDEADRMFDMGFGPQINCIVDSIRPDRQTIMFS 697

Query: 419 ATWPKEVKKLAEDYLGDYIQINIG 490
           AT+P +V+ +A+  L   ++I  G
Sbjct: 698 ATFPPKVENVAKKILNKPLEIIAG 721



 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 41/84 (48%), Positives = 53/84 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP   HI  QP    G+G IAL+++PTRELA QI      F     +R  C
Sbjct: 556 GSGKTLAFLLPMFRHILAQPKSAPGEGMIALIMSPTRELALQIHVECKKFSKVLGLRTAC 615

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGA   EQ  +L+RG +IV+ T
Sbjct: 616 VYGGASISEQIAELKRGADIVVCT 639


>UniRef50_Q1AG34 Cluster: Ded1-like DEAD-box RNA helicase; n=1;
           Chironomus tentans|Rep: Ded1-like DEAD-box RNA helicase
           - Chironomus tentans (Midge)
          Length = 776

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE--QIRP--DRQTLMWSAT 424
           GRL D + +G   L+   +LVLDEADRMLDMGFEPQIR IIE   + P   RQTLM+SAT
Sbjct: 409 GRLDDIINRGKIGLENLRFLVLDEADRMLDMGFEPQIRHIIENRDMPPTGQRQTLMFSAT 468

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PK +++LA D+L +YI + +G
Sbjct: 469 FPKNIQELASDFLSNYIFLAVG 490



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 38/94 (40%), Positives = 56/94 (59%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI----------NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A+++P +  +          +N+P  RR   P+ LVLAPTRELA QI + A  F
Sbjct: 314 GSGKTAAFLVPILNRMLEQGASMNPASNRPYQRRKQYPLGLVLAPTRELATQIYEEAKKF 373

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            + S +R   ++GG    EQ R+L+RG  +++AT
Sbjct: 374 SYRSRMRPAVLYGGNNTSEQMRELDRGCHLIVAT 407


>UniRef50_P20447 Cluster: ATP-dependent RNA helicase DBP3; n=20;
           Ascomycota|Rep: ATP-dependent RNA helicase DBP3 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 523

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 45/86 (52%), Positives = 65/86 (75%), Gaps = 2/86 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRPDRQTLMWSATWPK 433
           GRL+D L++G+ +L +  YLVLDEADRML+ GFE  I+ II E     RQTLM++ATWPK
Sbjct: 240 GRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPK 299

Query: 434 EVKKLAEDYLGDYIQINIGSL-QLSA 508
           EV++LA  ++ + I+++IG+  QL+A
Sbjct: 300 EVRELASTFMNNPIKVSIGNTDQLTA 325



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 35/84 (41%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ +PAI H+ N    R   G   LV++PTRELA QI            ++  C
Sbjct: 159 GSGKTFAFGVPAISHLMNDQKKR---GIQVLVISPTRELASQIYDNLIVLTDKVGMQCCC 215

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG PK EQ   L++  ++V+AT
Sbjct: 216 VYGGVPKDEQRIQLKKS-QVVVAT 238


>UniRef50_A6RW79 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1151

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 46/99 (46%), Positives = 64/99 (64%), Gaps = 3/99 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+I+ L   +   TNLQR TY+VLDEADRM DMGFEPQ+ K+   IR
Sbjct: 674 LKRGAEIIVCTPGRMIELLAANSGRVTNLQRVTYVVLDEADRMFDMGFEPQVMKVFNNIR 733

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P+RQT+++SAT P+ +  LA+  L   ++I +G   + A
Sbjct: 734 PNRQTILFSATMPRIMDALAKKTLQSPVEIVVGGRSVVA 772



 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 39/84 (46%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP   HI +Q P++  DGPI L++ PTRELA QI +    F     +R  C
Sbjct: 601 GSGKTIAFLLPMFRHIRDQRPLKGSDGPIGLIMTPTRELATQIHKECKPFLKAMGLRAVC 660

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GGA  ++Q  DL+RG EI++ T
Sbjct: 661 AYGGAIIKDQIADLKRGAEIIVCT 684


>UniRef50_Q4W7T8 Cluster: VASA RNA helicase; n=1; Artemia
           franciscana|Rep: VASA RNA helicase - Artemia
           sanfranciscana (Brine shrimp) (Artemia franciscana)
          Length = 726

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 40/84 (47%), Positives = 62/84 (73%), Gaps = 4/84 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ----IRPDRQTLMWSAT 424
           GRLIDF+ +G  N   C +LVLDEADRMLDMGF  +++K++      ++ +R TLM+SAT
Sbjct: 440 GRLIDFMNRGVFNFSACKFLVLDEADRMLDMGFMGEVKKVVYHGTMPVKVERNTLMFSAT 499

Query: 425 WPKEVKKLAEDYLGDYIQINIGSL 496
           +P EV++LA ++L +YI + +G++
Sbjct: 500 FPNEVQELAAEFLENYIFVTVGTV 523



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT AY++P I  +  +            P A+V+ PTRELA QI + A  F + + +
Sbjct: 351 GSGKTGAYLIPIINRLIEEGCAASSYDETQTPEAVVMCPTRELAIQIFKEAVKFSYDTII 410

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   V+GG   R Q+  ++ G  I++ T
Sbjct: 411 KPVVVYGGVAPRYQSDKVKSGCNILVGT 438


>UniRef50_Q5CP59 Cluster: DEAD box polypeptide, Y
           chromosome-related; n=3; Apicomplexa|Rep: DEAD box
           polypeptide, Y chromosome-related - Cryptosporidium
           hominis
          Length = 702

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 42/83 (50%), Positives = 62/83 (74%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR-----PDRQTLMWSA 421
           GRL D +++G  NL+   +L+LDEADRMLDMGF PQIR+I+E          RQT+M+SA
Sbjct: 343 GRLRDLIDRGKVNLKLIKFLILDEADRMLDMGFAPQIREIVEDSEMPHSLDGRQTVMFSA 402

Query: 422 TWPKEVKKLAEDYLGDYIQINIG 490
           T+P+E+++LA+D+L +YI + +G
Sbjct: 403 TFPREIQQLAKDFLHNYIFLTVG 425



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVH-INNQPP---------IRRGDGPIALVLAPTRELAQQIQQVAADF 152
           GSGKT A++ P ++  +N+ PP         I+R   P+ALVL+PTRELA Q  + +  F
Sbjct: 248 GSGKTAAFLFPIVMKMLNDGPPPTPQQSSLRIKRMAYPVALVLSPTRELAIQTYEESRKF 307

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
              + +R   ++GG+  R Q  DL+RG +I++AT
Sbjct: 308 CFGTGIRTNVLYGGSEVRSQIMDLDRGSDIIVAT 341


>UniRef50_A2DES1 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 640

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 40/78 (51%), Positives = 58/78 (74%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR ID L     N+++ +YLV+DEADRM D+GFEPQ+ +I E++R DRQTLM+SAT+P  
Sbjct: 232 GRFIDLLSSSAFNIKKVSYLVIDEADRMFDLGFEPQVIRIAERMRKDRQTLMFSATFPHT 291

Query: 437 VKKLAEDYLGDYIQINIG 490
           V+++A   L + I+I +G
Sbjct: 292 VERIARKLLQNSIEIVVG 309



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/84 (36%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+I+P ++H+  QPP  + +   A++L+PTRELA Q              ++ C
Sbjct: 148 GSGKTLAFIIPCLLHVLAQPPTGQYEA-AAVILSPTRELAYQTHIECQKIFSLMDKKSAC 206

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q R ++ G  ++IAT
Sbjct: 207 LVGGNDIENQLRAIKNGSNVIIAT 230


>UniRef50_Q4UBP8 Cluster: RNA helicase, putative; n=4;
           Eukaryota|Rep: RNA helicase, putative - Theileria
           annulata
          Length = 976

 Score = 89.4 bits (212), Expect = 7e-17
 Identities = 49/87 (56%), Positives = 60/87 (68%), Gaps = 3/87 (3%)
 Frame = +2

Query: 257 GRLIDFL--EKG-TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRLID L   KG  TNL+R T+LVLDEADRM DMGF PQI  I+  IRPDRQT ++SAT+
Sbjct: 500 GRLIDVLTLSKGKVTNLRRVTFLVLDEADRMFDMGFAPQISAIVGNIRPDRQTALFSATF 559

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P  ++ LA+  L   +QI +G    SA
Sbjct: 560 PIMIENLAKKILAKPLQIVVGQRGKSA 586



 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 42/84 (50%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LPAI H  +QP +R  DG I LV+APTREL  QI   ++ F     ++   
Sbjct: 415 GSGKTLAFLLPAIRHALDQPSLRENDGMIVLVIAPTRELVIQISNESSKFSRAVGLKTLA 474

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGA   EQ   L+RG EIVI T
Sbjct: 475 IYGGAGIGEQLNALKRGAEIVIGT 498


>UniRef50_UPI00004994C0 Cluster: DEAD/DEAH box helicase; n=2;
           Entamoeba histolytica HM-1:IMSS|Rep: DEAD/DEAH box
           helicase - Entamoeba histolytica HM-1:IMSS
          Length = 722

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 47/93 (50%), Positives = 63/93 (67%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L       TNL+R T++VLDEADRM DMGF PQI++IIE IR
Sbjct: 260 LKRGTEIVVCTPGRMIDILVTNNGRITNLRRVTFVVLDEADRMFDMGFGPQIKRIIEGIR 319

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PD+Q +M+SAT+P  V++ A ++L   I+I  G
Sbjct: 320 PDKQIVMFSATFPISVEQHAREFLKKPIEIICG 352



 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 41/84 (48%), Positives = 52/84 (61%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY +P I H+  Q P+ +G+GPI +V AP RELA+QI      FG    +R+  
Sbjct: 187 GSGKTLAYTIPLIKHVMAQRPLSKGEGPIGIVFAPIRELAEQINTEINKFGKYLNIRSVA 246

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGG     Q   L+RG EIV+ T
Sbjct: 247 VFGGTGISNQIGALKRGTEIVVCT 270


>UniRef50_A7P8T9 Cluster: Chromosome chr3 scaffold_8, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr3 scaffold_8, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 971

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 40/84 (47%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP + HI +QPP+  GDGPI L++APTREL QQI      F     +    
Sbjct: 531 GSGKTLAFVLPMLRHIKDQPPVMPGDGPIGLIMAPTRELVQQIHSDIKKFAKVVGISCVP 590

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+   +Q  +L+RG E+V+ T
Sbjct: 591 VYGGSGVAQQISELKRGAEVVVCT 614


>UniRef50_Q5KME7 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Filobasidiella neoformans|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 1072

 Score = 89.0 bits (211), Expect = 9e-17
 Identities = 46/112 (41%), Positives = 66/112 (58%), Gaps = 3/112 (2%)
 Frame = +2

Query: 182 CVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMG 352
           CV   S       + +G+    C  GR+ID L       TN++R TY+V+DEADRM DMG
Sbjct: 510 CVGGSSISEDIAAMKKGAEVVICTPGRMIDLLTANNGRVTNVRRTTYIVMDEADRMFDMG 569

Query: 353 FEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           FEPQ+ KII  +RP  Q +++SAT+PK ++ LA   L   ++I +G   + A
Sbjct: 570 FEPQVMKIINNVRPSAQKVLFSATFPKTMESLARRILVKPLEITVGGRSVVA 621



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 35/84 (41%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A++LP + H+ +Q P+   +GPIA+V++PTRELA QI +    F     +R +C
Sbjct: 450 GSGKTVAFLLPMLRHVRDQRPVSGSEGPIAVVMSPTRELASQIYKECQPFLKVLNIRASC 509

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG+   E    +++G E+VI T
Sbjct: 510 CVGGSSISEDIAAMKKGAEVVICT 533


>UniRef50_Q6CCZ1 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Yarrowia lipolytica|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Yarrowia lipolytica (Candida lipolytica)
          Length = 974

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L +G+    C  GR+ID L        +L R T+LV+DEADRM DMGFEPQ+ K+ + IR
Sbjct: 506 LKKGTHIIVCTPGRMIDLLAANQGRVLSLSRVTFLVIDEADRMFDMGFEPQVLKLTQSIR 565

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQL 502
           PDRQT+++SAT+PK++++LA   L      ++G +++
Sbjct: 566 PDRQTVLFSATFPKKMEQLARRVLSKRSSDSLGPIEI 602



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 8/92 (8%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR--------GDGPIALVLAPTRELAQQIQQVAADFGH 158
           GSGKTLA++LP + HI ++  +             P+ +++ PTREL  QI +    F  
Sbjct: 425 GSGKTLAFLLPMLRHIKHRVGVETHTTTLSGASSHPLGVIITPTRELCVQIYRDLRPFLA 484

Query: 159 TSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
              +   C +GG+P ++Q   L++G  I++ T
Sbjct: 485 ALELTAVCAYGGSPIKDQIAALKKGTHIIVCT 516


>UniRef50_A7RGX3 Cluster: Predicted protein; n=3; Eukaryota|Rep:
           Predicted protein - Nematostella vectensis
          Length = 487

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 43/105 (40%), Positives = 61/105 (58%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           ++C+   S K  S  +  G        GRL+D L+K    L  C YLVLDEADRM+DMGF
Sbjct: 161 NLCIGGSSIKEQSDAMKRGVHMVVATPGRLMDLLDKRIITLDVCRYLVLDEADRMIDMGF 220

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           E  +R I    +  RQTL++SAT PK+++  A+  L   + +N+G
Sbjct: 221 EEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKPVTVNVG 265



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------- 152
           GSGKTL + LP I+    Q    P +R +GP  +++ P+RELA+Q  +V   F       
Sbjct: 94  GSGKTLVFTLPIIMFSLEQEKAMPFQRNEGPYGMIVVPSRELARQTFEVITHFSRALEAH 153

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           G  S   N C+ GG+  +EQ+  ++RGV +V+AT
Sbjct: 154 GFPSLRTNLCI-GGSSIKEQSDAMKRGVHMVVAT 186


>UniRef50_A0D361 Cluster: Chromosome undetermined scaffold_36, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_36,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 813

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 46/84 (54%), Positives = 57/84 (67%), Gaps = 1/84 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+DF++ G   L   T +VLDEADRMLDMGFE QI +I+  +R DRQTL +SATWP E
Sbjct: 565 GRLLDFMKDGLP-LNSITQVVLDEADRMLDMGFEDQITQILSAVRDDRQTLFFSATWPNE 623

Query: 437 VKKLAEDYLG-DYIQINIGSLQLS 505
           V++LA      D I I +G   LS
Sbjct: 624 VQRLANSLCNQDPIMIQLGEQGLS 647



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY LP I+H   QP +    GP  LVLAPTRELAQQIQ       +  + R  C
Sbjct: 479 GSGKTLAYALPGIIHSQAQPKVL---GPRILVLAPTRELAQQIQS-----QYELFTRTCC 530

Query: 183 VFGGAPKREQARDL 224
           V+GG  K  Q  ++
Sbjct: 531 VYGGVFKNLQYSEI 544


>UniRef50_Q0UN57 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Phaeosphaeria nodorum|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1149

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 43/82 (52%), Positives = 58/82 (70%), Gaps = 3/82 (3%)
 Frame = +2

Query: 254 SGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           +GRLID L+  +    + +R TY+VLDEADRM DMGFEPQ+ KI+  IRPDRQT+++SAT
Sbjct: 641 AGRLIDLLQSNSGRVLSFRRITYVVLDEADRMFDMGFEPQVMKILASIRPDRQTILFSAT 700

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PK +  LA   L    ++ IG
Sbjct: 701 FPKTMAALARKALDKPAEVIIG 722



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 38/85 (44%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ +P I H+ +Q P++  DGPI L+LAPTREL+ QI      F + S +   C
Sbjct: 556 GSGKTLAFGIPMIRHVLDQRPLKPADGPIGLILAPTRELSLQIVNELKPFLNASGITIKC 615

Query: 183 VFGGAPKREQARDLER-GVEIVIAT 254
            +GG P  +Q   ++R G+ I+ AT
Sbjct: 616 AYGGQPISDQIAMIKRGGIHILCAT 640


>UniRef50_UPI00006CF9CE Cluster: DEAD/DEAH box helicase family
            protein; n=1; Tetrahymena thermophila SB210|Rep:
            DEAD/DEAH box helicase family protein - Tetrahymena
            thermophila SB210
          Length = 1357

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 44/84 (52%), Positives = 54/84 (64%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
            GSGKTLAY+LP I H++ Q P++ GDGPI L+L PTRELA QI   A  F          
Sbjct: 754  GSGKTLAYLLPMIRHVSAQRPLQEGDGPIGLILVPTRELATQIYLEAKPFLKAYKYEIVA 813

Query: 183  VFGGAPKREQARDLERGVEIVIAT 254
            VFGG   + Q  +L+RG EIV+AT
Sbjct: 814  VFGGTGIKGQLSELKRGCEIVVAT 837



 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 40/69 (57%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = +2

Query: 257  GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
            GRLID L       TNL+R T +V+DEADRM D+GFEPQI KI+   RPD+QT+++SAT+
Sbjct: 839  GRLIDVLTTSNGKITNLKRITMVVIDEADRMFDLGFEPQIAKILATTRPDKQTVLFSATF 898

Query: 428  PKEVKKLAE 454
            PK V+ LA+
Sbjct: 899  PKNVENLAK 907


>UniRef50_A3AD37 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 552

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 42/85 (49%), Positives = 61/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +E G   L   +++VLDEADRMLDMGFEP++R I+ Q    RQT+M+SATWP  
Sbjct: 289 GRMKDLIEMGICRLNDVSFVVLDEADRMLDMGFEPEVRAILSQTASVRQTVMFSATWPPA 348

Query: 437 VKKLAEDYLG-DYIQINIGSLQLSA 508
           V +LA++++  + I++ IGS  L+A
Sbjct: 349 VHQLAQEFMDPNPIKVVIGSEDLAA 373



 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 37/87 (42%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN---QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT+A+ +PA++H+     +   ++G  P  LVL+PTRELAQQI  V  + G    + 
Sbjct: 139 GSGKTIAFGVPALMHVRRKMGEKSAKKGV-PRVLVLSPTRELAQQIADVLCEAGAPCGIS 197

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           + C++GG  K  Q   L+ GV+IVI T
Sbjct: 198 SVCLYGGTSKGPQISALKSGVDIVIGT 224


>UniRef50_Q5KHB7 Cluster: ATP-dependent RNA helicase DBP3; n=2;
           Filobasidiella neoformans|Rep: ATP-dependent RNA
           helicase DBP3 - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 605

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 43/87 (49%), Positives = 60/87 (68%), Gaps = 3/87 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI---RPDRQTLMWSATW 427
           GR +D  + G  +L   +YLVLDEADRMLD GFE  IR+II      +  RQT+M+SATW
Sbjct: 314 GRTLDLADSGELDLSSVSYLVLDEADRMLDAGFENDIRRIIAHTPGHKEGRQTVMFSATW 373

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P+ V++LA  +L + ++I +GS +LSA
Sbjct: 374 PESVRRLASTFLNNPLRITVGSDELSA 400



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 38/93 (40%), Positives = 57/93 (61%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI---RRGDGPIA-----LVLAPTRELAQQIQQVAADFGH 158
           GSGKTLA+ +P I  ++  PP+   ++G G +      LVLAPTRELAQQ  +  + FG 
Sbjct: 220 GSGKTLAFGVPGINLLSQLPPVTGSKKGRGQVPGQIQMLVLAPTRELAQQSHEHLSAFGE 279

Query: 159 TSYVRNTCVFGGAPKREQARDL-ERGVEIVIAT 254
              +++ C+FGG  K  QAR+L ++   +V+ T
Sbjct: 280 QVGLKSVCIFGGVGKDGQARELSQKDTRVVVGT 312


>UniRef50_A5KB15 Cluster: ATP-dependent RNA helicase, putative; n=1;
           Plasmodium vivax|Rep: ATP-dependent RNA helicase,
           putative - Plasmodium vivax
          Length = 1341

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 39/84 (46%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+ P I H+ +QPP+R  DGPIA++L PTREL++Q++  A  +     +R   
Sbjct: 716 GSGKTLSYLFPLIRHVLHQPPLRNNDGPIAIILTPTRELSKQVKSEARPYCQAVNLRILA 775

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+    Q   L+RGVEI++ T
Sbjct: 776 VYGGSNIGTQLNTLKRGVEILVGT 799



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 3/81 (3%)
 Frame = +2

Query: 257  GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
            GR+ID L       TNL R +++VLDEADR+LD+GFE QI  I+   R D+QT M SAT+
Sbjct: 801  GRIIDILTISNCKVTNLNRVSFVVLDEADRLLDLGFESQIHNILNNCRKDKQTAMISATF 860

Query: 428  PKEVKKLAEDYLGDYIQINIG 490
            P  ++ LA+  L   I+I +G
Sbjct: 861  PNYIQNLAKKLLYKPIEIIVG 881


>UniRef50_Q4PDT1 Cluster: ATP-dependent RNA helicase DBP3; n=1;
           Ustilago maydis|Rep: ATP-dependent RNA helicase DBP3 -
           Ustilago maydis (Smut fungus)
          Length = 585

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 43/87 (49%), Positives = 57/87 (65%), Gaps = 3/87 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR---PDRQTLMWSATW 427
           GR++D    G+ +L   TYLVLDEADRMLD GFEP IR II   +     R T M+SATW
Sbjct: 300 GRVLDMARDGSLDLSGVTYLVLDEADRMLDKGFEPDIRAIIGMCKSREEGRHTSMFSATW 359

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P  V+ LAE ++   +++ +GS +LSA
Sbjct: 360 PPAVRGLAESFMNGPVRVTVGSDELSA 386



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-------RRGDGPIALVLAPTRELAQQIQQVAADFGHT 161
           GSGKT A+ LPA+ H+  +  +        +G     LV+APTRELA Q ++  A  G +
Sbjct: 206 GSGKTFAFGLPALQHLVTKHKVLDSGKKKAKGAQVNVLVIAPTRELAIQTEENMAKLGKS 265

Query: 162 SYVRNTCVFGGAPKREQARDLERG--VEIVIAT 254
             +   C++GG  K+EQ R L +   V IV+ T
Sbjct: 266 MGIGMICLYGGVSKQEQVRLLNQSPPVRIVVGT 298


>UniRef50_Q0FAJ4 Cluster: Dead-box ATP-dependent RNA helicase; n=6;
           Alphaproteobacteria|Rep: Dead-box ATP-dependent RNA
           helicase - alpha proteobacterium HTCC2255
          Length = 531

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 38/77 (49%), Positives = 56/77 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +++    L    +LVLDEAD+MLD+GF P +++II ++  DRQTL++SAT  KE
Sbjct: 235 GRLEDLVDQKGLRLDETKFLVLDEADQMLDIGFLPAVKRIISKVNKDRQTLLFSATMSKE 294

Query: 437 VKKLAEDYLGDYIQINI 487
           +KKL E YL D +Q+++
Sbjct: 295 IKKLTETYLTDPVQVSV 311



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 37/84 (44%), Positives = 51/84 (60%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP I  +   P   +G    A++L+PTRELA QI +    FG    +  T 
Sbjct: 150 GTGKTAAFALPLIQQLLMNPIAIKGRSARAIILSPTRELALQIHEAFVSFGKRLPLNFTH 209

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GGAP R+Q RDL +GV+I++AT
Sbjct: 210 AIGGAPIRKQMRDLSKGVDILVAT 233


>UniRef50_Q9GV13 Cluster: Vasa-related protein CnVAS1; n=3;
           Eumetazoa|Rep: Vasa-related protein CnVAS1 - Hydra
           magnipapillata (Hydra)
          Length = 797

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 42/84 (50%), Positives = 57/84 (67%), Gaps = 4/84 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL DFL K   +L    YL+LDEADRMLDMGF P+I+ II       + DR TLM+SAT
Sbjct: 490 GRLKDFLGKRKISLANLKYLILDEADRMLDMGFLPEIKAIINDFDMPPKEDRHTLMFSAT 549

Query: 425 WPKEVKKLAEDYLGDYIQINIGSL 496
           +P E++ LA ++L +Y+ + IG +
Sbjct: 550 FPTEIQNLAAEFLNNYVYLTIGKV 573



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAI---VHINNQ--PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+++P +   +   ++    +     P+ALV+APTRELA QIQ+ A  F   + 
Sbjct: 400 GSGKTAAFLIPVLNTLMQFRSELTSSLSEVQAPLALVIAPTRELAVQIQKEARKFAQNTS 459

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           ++   ++GG       R +++   +++ T
Sbjct: 460 IKPVVIYGGVQVAYHLRQVQQDCHLLVGT 488


>UniRef50_A7AWZ5 Cluster: DEAD/DEAH box helicase and helicase
           conserved C-terminal domain containing protein; n=1;
           Babesia bovis|Rep: DEAD/DEAH box helicase and helicase
           conserved C-terminal domain containing protein - Babesia
           bovis
          Length = 994

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 42/84 (50%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+AY+LPAI H+  QP +R  +G I L++APTRELA QI   ++       +R   
Sbjct: 435 GSGKTMAYLLPAIRHVLYQPKLRENEGMIVLIIAPTRELASQIGVESSKLCKLVGIRTKA 494

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+P  EQ   L+RGVEIV  T
Sbjct: 495 VYGGSPIGEQLNALKRGVEIVCGT 518



 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 44/87 (50%), Positives = 60/87 (68%), Gaps = 3/87 (3%)
 Frame = +2

Query: 257 GRLIDFL--EKG-TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRLI+ L    G  TNL+R T++V+DEADRM D+GF PQI  I++ IRPDRQT ++SAT+
Sbjct: 520 GRLIEVLTISNGKVTNLRRVTFVVIDEADRMFDLGFSPQISAIVDNIRPDRQTALFSATF 579

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P  ++ LA+  L   +QI +G    SA
Sbjct: 580 PPTIEALAKKILTKPLQIIVGESGKSA 606


>UniRef50_A1XCP2 Cluster: Vasa-like protein; n=2; Coelomata|Rep:
           Vasa-like protein - Macrobrachium rosenbergii (Giant
           fresh water prawn)
          Length = 710

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 40/83 (48%), Positives = 62/83 (74%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ----IRPDRQTLMWSAT 424
           GRL+D +++G   L +  YLVLDEADRMLDMGFEP +R+++       + +RQTL++SAT
Sbjct: 414 GRLLDVIQRGWIGLTKLRYLVLDEADRMLDMGFEPDMRRLVASPGMPPKENRQTLLFSAT 473

Query: 425 WPKEVKKLAEDYL-GDYIQINIG 490
           +P++++KLA D+L  DY+ + +G
Sbjct: 474 YPQDIQKLAADFLKTDYLFLAVG 496



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG----DGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +  +               P A+++APTREL  QI   A  F + + V
Sbjct: 325 GSGKTAAFLLPILQQLMADGVAASSFVELQEPEAIIVAPTRELINQIFLEARKFAYGTCV 384

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V+GG     Q R++ +G  IV  T
Sbjct: 385 RPVVVYGGVNTGFQLREISKGCNIVCGT 412


>UniRef50_Q2PZC2 Cluster: Vasa protein; n=3; Apidae|Rep: Vasa
           protein - Apis mellifera (Honeybee)
          Length = 630

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 43/82 (52%), Positives = 58/82 (70%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII--EQIRP--DRQTLMWSAT 424
           GRL+DF+EKG        +LVLDEADRMLDMGF P I K++  E + P  +RQTLM+SAT
Sbjct: 332 GRLLDFVEKGRVKFSSVQFLVLDEADRMLDMGFLPSIEKMVDHETMVPLGERQTLMFSAT 391

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P EV+ LA  +L +Y+ + +G
Sbjct: 392 FPDEVQHLARRFLNNYLFLAVG 413



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP----IRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+ +P I  +  +            P  ++++PTREL  QI Q    F   S +
Sbjct: 243 GSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSIL 302

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +    +GG     Q   L  G  I++AT
Sbjct: 303 KTVVAYGGTSVMHQRGKLSAGCHILVAT 330


>UniRef50_Q00T47 Cluster: Putative RNA helicase, DRH1; n=1;
           Ostreococcus tauri|Rep: Putative RNA helicase, DRH1 -
           Ostreococcus tauri
          Length = 1118

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 46/84 (54%), Positives = 58/84 (69%), Gaps = 5/84 (5%)
 Frame = +2

Query: 257 GRLIDFLEK--GTT---NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSA 421
           GRL DFLE   G T   +  +  Y+VLDEADRMLDMGFEPQI+KI +     RQT+M++A
Sbjct: 231 GRLNDFLEPPPGFTAPVSAVKAAYVVLDEADRMLDMGFEPQIKKIFKLCPSARQTVMFTA 290

Query: 422 TWPKEVKKLAEDYLGDYIQINIGS 493
           TWPK V+K+A+ +    I I IGS
Sbjct: 291 TWPKGVQKIADAFTTKPIHIQIGS 314



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 38/97 (39%), Positives = 52/97 (53%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-----NNQPPIRRGDG--------PIALVLAPTRELAQQIQQVA 143
           GSGKT  ++LPA+  I        P ++  DG        P  +VLAPTRELA QI    
Sbjct: 133 GSGKTCGFLLPALAKIVAEGTQKAPEMQLVDGRWRPGAVTPSVIVLAPTRELAIQIHDEC 192

Query: 144 ADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           A F   +  R+  ++GGA K +Q R L  G ++V+AT
Sbjct: 193 AKFCPAAGCRSAVLYGGAAKGDQLRALRSGADVVVAT 229


>UniRef50_Q9GV12 Cluster: Vasa-related protein CnVAS2; n=14;
           Eumetazoa|Rep: Vasa-related protein CnVAS2 - Hydra
           magnipapillata (Hydra)
          Length = 890

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 41/82 (50%), Positives = 57/82 (69%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE--QIRPD--RQTLMWSAT 424
           GRL DF+++G  N Q   YL+LDEAD+M+DMGF PQI  IIE   + P   R TLM+SAT
Sbjct: 588 GRLEDFIKRGKVNFQNLKYLILDEADKMIDMGFGPQIEHIIEFSGMPPKGIRNTLMFSAT 647

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P +++ LA  +L DY+ + +G
Sbjct: 648 FPDQIQHLAAQFLNDYLFLTVG 669



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ--PPIRRG-DG---PIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKT +++LP I ++ N+    I    DG   P+A +LAPTREL  Q+   A  F + S
Sbjct: 497 GSGKTASFLLPIITNLMNEGLDNIDSNIDGVALPLAAILAPTRELVVQLFTEARKFSYNS 556

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            ++   ++GG     QA  L  G  +++AT
Sbjct: 557 SLKPVVLYGGVAVAHQADRLRMGCHLLVAT 586


>UniRef50_Q012T2 Cluster: DEAD-box protein abstrakt; n=3;
           Ostreococcus|Rep: DEAD-box protein abstrakt -
           Ostreococcus tauri
          Length = 1025

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +2

Query: 257 GRLIDFL-EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL D + ++G  +L++ + +VLDEADRMLDMGFEPQI+ I       RQTL++SATWPK
Sbjct: 175 GRLTDLMSQEGVLSLEKLSVIVLDEADRMLDMGFEPQIKTIFGATPASRQTLLFSATWPK 234

Query: 434 EVKKLAEDYL 463
            V+KLA  YL
Sbjct: 235 SVRKLAACYL 244



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 30/74 (40%), Positives = 37/74 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+      H      +++  G   LV+APTRELA QIQ     FG      +  
Sbjct: 100 GSGKTLAF------H-----GMKKHGGVEGLVVAPTRELAIQIQAECEKFGAERGFHSVV 148

Query: 183 VFGGAPKREQARDL 224
           V+GGA   EQ   L
Sbjct: 149 VYGGASAYEQKNAL 162


>UniRef50_Q10202 Cluster: ATP-dependent RNA helicase dbp3; n=1;
           Schizosaccharomyces pombe|Rep: ATP-dependent RNA
           helicase dbp3 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 578

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 6/90 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------RQTLMWS 418
           GRL+D +  G+ +  +  YLVLDEADRMLD GFE  IR II    PD      RQT+ +S
Sbjct: 294 GRLLDLINDGSIDCSQVGYLVLDEADRMLDTGFEQDIRNIISH-TPDPTRNGSRQTVFFS 352

Query: 419 ATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
           ATWP+ V+ LA  +L D ++I IGS +L+A
Sbjct: 353 ATWPESVRALAATFLKDPVKITIGSDELAA 382



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 31/84 (36%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A+ +PA+ ++N     +    P  LV++PTRELA Q  +        + ++   
Sbjct: 212 GSGKTVAFGIPALQYLNGLSDNK--SVPRVLVVSPTRELAIQTYENLNSLIQGTNLKAVV 269

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GGAPK EQAR   +   ++I T
Sbjct: 270 VYGGAPKSEQAR-AAKNASVIIGT 292


>UniRef50_Q9N5K1 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 630

 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 41/91 (45%), Positives = 58/91 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   NL+ C YLVLDEADRMLDMGFE +I+ I    +  RQTL++SAT P++
Sbjct: 331 GRLSDMLTKKIINLEVCRYLVLDEADRMLDMGFEDEIKSIFYFFKAQRQTLLFSATMPRK 390

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITTFFKL 529
           ++  A+  L   I +N+G    +++    +L
Sbjct: 391 IQFFAKSALVKPIVVNVGRAGAASLNVLQEL 421



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAAD----FGHT 161
           GSGKT+ ++LP ++    Q    P  R +GP  L++ P+RELA+QI  +  +     G  
Sbjct: 237 GSGKTMTFVLPLVMFCLEQEMKLPFMRSEGPFGLIIVPSRELARQIFDLIIEMFDALGKA 296

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R     GG P  EQA+D+  G+ IV+AT
Sbjct: 297 GLPEMRAGLCIGGVPIGEQAKDVRDGIHIVVAT 329


>UniRef50_Q9GNP1 Cluster: Vasa homolog; n=18; Eumetazoa|Rep: Vasa
           homolog - Ciona savignyi (Pacific transparent sea
           squirt)
          Length = 770

 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 39/83 (46%), Positives = 58/83 (69%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ----IRPDRQTLMWSAT 424
           GRL+DF+ +G   L    +++LDEADRMLDMGFE +IRK+        + DR TLM+SAT
Sbjct: 449 GRLMDFINRGLVGLDHVEFVILDEADRMLDMGFETEIRKLASSPGMPSKSDRHTLMFSAT 508

Query: 425 WPKEVKKLAEDYL-GDYIQINIG 490
           +P E+++LA D+L  D++ + +G
Sbjct: 509 FPDEIQRLAHDFLREDFLFLTVG 531



 Score = 59.7 bits (138), Expect = 6e-08
 Identities = 36/88 (40%), Positives = 45/88 (51%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVH-INN---QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +   I N            P A+V+ PTREL  QI   A  F   + V
Sbjct: 360 GSGKTAAFLLPVLTKLITNGLQSSQFSEKQTPRAIVVGPTRELIYQIFLEARKFSRGTVV 419

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R    +GG     Q RDL+RG  I+IAT
Sbjct: 420 RPVVAYGGTSMNHQIRDLQRGCHILIAT 447


>UniRef50_P09052 Cluster: ATP-dependent RNA helicase vasa; n=5;
           Eukaryota|Rep: ATP-dependent RNA helicase vasa -
           Drosophila melanogaster (Fruit fly)
          Length = 661

 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 36/80 (45%), Positives = 60/80 (75%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL+DF+++     +   ++VLDEADRMLDMGF   +R+I+  +  RP+ QTLM+SAT+P
Sbjct: 377 GRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFP 436

Query: 431 KEVKKLAEDYLGDYIQINIG 490
           +E++++A ++L +Y+ + IG
Sbjct: 437 EEIQRMAGEFLKNYVFVAIG 456



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 33/84 (39%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  +   P       P  ++++PTRELA QI   A  F   SY++   
Sbjct: 292 GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI 351

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG   R Q   + RG  +VIAT
Sbjct: 352 VYGGTSFRHQNECITRGCHVVIAT 375


>UniRef50_UPI0000F3242A Cluster: Probable ATP-dependent RNA helicase
           DDX43 (EC 3.6.1.-) (DEAD box protein 43) (DEAD box
           protein HAGE) (Helical antigen).; n=1; Bos taurus|Rep:
           Probable ATP-dependent RNA helicase DDX43 (EC 3.6.1.-)
           (DEAD box protein 43) (DEAD box protein HAGE) (Helical
           antigen). - Bos Taurus
          Length = 597

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 35/85 (41%), Positives = 60/85 (70%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL+Y++P  +HI++QP ++R  +GP  LVL PTRELA Q+    +++ +   +++ 
Sbjct: 288 GTGKTLSYLMPGFIHIDSQPVLQRARNGPGMLVLTPTRELALQVDAECSEYSYRG-LKSV 346

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C++GG  +  Q +DL +G +I+IAT
Sbjct: 347 CIYGGGDRDGQIKDLSKGADIIIAT 371



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 34/54 (62%), Positives = 39/54 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWS 418
           GRL D        L+  TYLVLDEAD+MLDMGFEPQI KI+  +RPDRQT+M S
Sbjct: 373 GRLHDLQMNNFVYLKSITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTS 426


>UniRef50_Q01PH0 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Solibacter usitatus Ellin6076|Rep: DEAD/DEAH box
           helicase domain protein - Solibacter usitatus (strain
           Ellin6076)
          Length = 422

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 38/80 (47%), Positives = 56/80 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL DF+ +G  NL     L+LDE+DRMLDMGF P I++II  +  +RQTL++SAT    
Sbjct: 131 GRLYDFMSRGLINLTTVRMLILDESDRMLDMGFLPTIKRIIAAMPAERQTLLFSATLESS 190

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           VK+L E ++ + ++I +GS+
Sbjct: 191 VKQLVETHVRNAVRIELGSI 210



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 35/84 (41%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA++LP I  ++ +P   R  G  AL+L PTRELA QI +        + +R   
Sbjct: 49  GTGKTLAFLLPTIQLLSTEP---RQPGVRALILTPTRELALQINEALLQIARGTGIRAAV 105

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG  +R Q RD+  G  IV+AT
Sbjct: 106 AVGGLNERSQLRDIRGGANIVVAT 129


>UniRef50_A7CUH7 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Opitutaceae bacterium TAV2|Rep: DEAD/DEAH box
           helicase domain protein - Opitutaceae bacterium TAV2
          Length = 536

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 42/86 (48%), Positives = 56/86 (65%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E+GT  L     LVLDE DRMLDMGF P +++I++Q    RQTL +SAT P E
Sbjct: 260 GRLLDHIEQGTMTLADVEILVLDEVDRMLDMGFLPDVKRIVQQCPQARQTLFFSATLPPE 319

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
           + +LA   L D ++I IG  +  A T
Sbjct: 320 LAQLASWALRDPVEIKIGQRRSPAET 345



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 31/84 (36%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  +       R      LVL PTRELA Q+++    +   + +  T 
Sbjct: 180 GTGKTAAFALPILHKLGAHERRLR-----CLVLEPTRELALQVEEAFQKYSKYTDLTATV 234

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    +Q  DL+RGV++V AT
Sbjct: 235 VYGGVGYGKQREDLQRGVDVVAAT 258


>UniRef50_Q7S5R1 Cluster: ATP-dependent RNA helicase dbp-3; n=10;
           Pezizomycotina|Rep: ATP-dependent RNA helicase dbp-3 -
           Neurospora crassa
          Length = 614

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 40/80 (50%), Positives = 55/80 (68%), Gaps = 2/80 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP--DRQTLMWSATWP 430
           GRL DFL +G+ +L   ++ VLDEADRMLD GF   I+ I+    P   RQTLM++ATWP
Sbjct: 318 GRLKDFLSEGSISLANVSFAVLDEADRMLDRGFSEDIKLILSGCPPKEQRQTLMFTATWP 377

Query: 431 KEVKKLAEDYLGDYIQINIG 490
            +++KLAE Y+ +  Q+ IG
Sbjct: 378 LDIQKLAESYMINPAQVTIG 397



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-----RGDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT+A+ LP +  + ++P  +     R   P A++++PTRELA Q     +       
Sbjct: 226 GSGKTMAFSLPCVESLASRPKPKFNSRDRTAHPRAVIVSPTRELAMQTHAALSGLASLVG 285

Query: 168 VRNTCVFGGAPKREQARDL--ERGVEIVIAT 254
           +   C+FGG+ K EQ   L    GV+I+ AT
Sbjct: 286 LSAVCIFGGSDKNEQRNLLYKNNGVDIITAT 316


>UniRef50_Q5NN72 Cluster: DNA and RNA helicase; n=3;
           Sphingomonadales|Rep: DNA and RNA helicase - Zymomonas
           mobilis
          Length = 492

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 40/77 (51%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D  E+G   L  C  LV+DEADRMLDMGF P I  I  ++   RQTL++SAT P  
Sbjct: 131 GRLLDLFERGKILLSSCEMLVIDEADRMLDMGFIPDIETICTKLPTSRQTLLFSATMPPA 190

Query: 437 VKKLAEDYLGDYIQINI 487
           +KKLA+ +L +  QI I
Sbjct: 191 IKKLADRFLSNPKQIEI 207



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 31/84 (36%), Positives = 49/84 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT +++LP I  + +     R   P +L+L PTRELA Q+ +    +G    +  + 
Sbjct: 48  GTGKTASFVLPMIDILAHGRC--RARMPRSLILEPTRELAAQVAENFEKYGKYHKLSMSL 105

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG P  EQ   LE+GV+++IAT
Sbjct: 106 LIGGVPMAEQQAALEKGVDVLIAT 129


>UniRef50_Q54CD6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 697

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 39/83 (46%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLI+ +E G  +L   T LVLDEAD+ML  G  PQ+++I  QIRPD Q +++SAT+P  
Sbjct: 351 GRLIEMIENGHVDLSSVTMLVLDEADKMLSKGLIPQLKQIRGQIRPDSQNILFSATFPDS 410

Query: 437 VKKLAEDYLGD-YIQINIGSLQL 502
           +K++++D++ D  I++ IGS +L
Sbjct: 411 LKEVSKDWIKDPSIRLRIGSSEL 433



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 13/97 (13%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVH------------INNQPPIRRGDGPIALVLAPTRELAQQIQQVAA 146
           GSGKTL Y+ P I H            I  +   ++  G + LVL PTREL  Q+     
Sbjct: 253 GSGKTLGYLAPMIPHCLARVDRGGKNKITGEKAPKQYTGILVLVLVPTRELGLQVHSNTL 312

Query: 147 DFGHTSYVRNTCVFGGAPKREQARDLER-GVEIVIAT 254
                  ++ + ++GG  K  Q   LE+   +I+I+T
Sbjct: 313 IITQLFGIKTSVIYGGISKNLQIEQLEKEKPQILIST 349


>UniRef50_Q0E3X4 Cluster: DEAD-box ATP-dependent RNA helicase 35A;
           n=50; Eukaryota|Rep: DEAD-box ATP-dependent RNA helicase
           35A - Oryza sativa subsp. japonica (Rice)
          Length = 627

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   NL  C YL LDEADR++D+GFE  IR++ +  +  RQTL++SAT PK+
Sbjct: 323 GRLKDLLAKKKMNLDNCRYLTLDEADRLVDLGFEDDIREVFDHFKAQRQTLLFSATMPKK 382

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A+  L   + +N+G
Sbjct: 383 IQNFAKSALVKPVIVNVG 400



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQ----IQQVAADFGHT 161
           GSGKTL ++LP I+    +    PI  G+GP  +++ P+RELA+Q    I+Q        
Sbjct: 229 GSGKTLVFVLPLIMVALQEEMMMPIVPGEGPFGMIICPSRELAKQTYDVIEQFLVPLKEA 288

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            Y  +R     GG   R Q   +++GV IV+AT
Sbjct: 289 GYPEIRPLLCIGGVDMRAQLDVVKKGVHIVVAT 321


>UniRef50_UPI00015B61D8 Cluster: PREDICTED: similar to vasa-like
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to vasa-like protein - Nasonia vitripennis
          Length = 732

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/82 (45%), Positives = 59/82 (71%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII--EQIRP--DRQTLMWSAT 424
           GRL+D + KG        ++VLDEADRMLDMGF P + K++  + ++P  +RQTLM+SAT
Sbjct: 440 GRLLDLVGKGKITFDAIEFVVLDEADRMLDMGFLPDVEKVLRHDTMKPPGERQTLMFSAT 499

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P+E+++LA  +L +Y+ + +G
Sbjct: 500 FPQEIQQLAAKFLNNYVFVTVG 521



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 30/92 (32%), Positives = 52/92 (56%), Gaps = 8/92 (8%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVH--------INNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH 158
           GSGKT A+++P I+H        +++     + + P AL+++PTREL  QI   A  F  
Sbjct: 349 GSGKTAAFLIP-IIHTLLAKDRDLSDMSSANQVE-PRALIISPTRELTIQIFDEARKFSK 406

Query: 159 TSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            S ++   ++GG     Q + + +GV+I++AT
Sbjct: 407 DSVLKCHIIYGGTSTSHQMKQIFQGVDILVAT 438


>UniRef50_Q62IF8 Cluster: ATP-dependent RNA helicase RhlE; n=59;
           Betaproteobacteria|Rep: ATP-dependent RNA helicase RhlE
           - Burkholderia mallei (Pseudomonas mallei)
          Length = 482

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 40/86 (46%), Positives = 58/86 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++ T NL +   LVLDEADRMLDMGF P +++I+  +  +RQTL++SAT+  E
Sbjct: 146 GRLLDHVQQKTANLGQVQILVLDEADRMLDMGFLPDLQRILNLLPKERQTLLFSATFSPE 205

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
           +KKLA  YL +   I +     +A T
Sbjct: 206 IKKLASTYLRNPQTIEVARSNAAAST 231



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG--PI-ALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKT ++ LP I  +  Q          P+ AL+L PTRELA Q+      +   + +R
Sbjct: 58  GTGKTASFSLPIIQRLLPQANTSASPARHPVRALILTPTRELADQVAANVHAYAKHTPLR 117

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           +  VFGG     Q  +L RGVEI+IAT
Sbjct: 118 SAVVFGGVDMNPQMAELRRGVEILIAT 144


>UniRef50_Q9C551 Cluster: DEAD-box ATP-dependent RNA helicase 5;
           n=4; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 5 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 537

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +E     L   +++VLDEADRMLDMGFE  +R I+      RQ +M+SATWP +
Sbjct: 250 GRLRDLIESNVLRLSDVSFVVLDEADRMLDMGFEEPVRFILSNTNKVRQMVMFSATWPLD 309

Query: 437 VKKLAEDYLG-DYIQINIGSLQLSA 508
           V KLA++++  + I++ IGS+ L+A
Sbjct: 310 VHKLAQEFMDPNPIKVIIGSVDLAA 334



 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIRRGD---GPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKTLA+ +PAI+H+      I  G     P  LVL+PTRELA QI  V  + G    +
Sbjct: 161 GSGKTLAFGIPAIMHVLKKNKKIGGGSKKVNPTCLVLSPTRELAVQISDVLREAGEPCGL 220

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           ++ CV+GG+ K  Q   +  GV+IVI T
Sbjct: 221 KSICVYGGSSKGPQISAIRSGVDIVIGT 248


>UniRef50_Q3ZDP1 Cluster: Vasa-like protein; n=7; Neoptera|Rep:
           Vasa-like protein - Anopheles gambiae (African malaria
           mosquito)
          Length = 596

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 38/82 (46%), Positives = 57/82 (69%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL+DF+++G    +   ++VLDEADRMLDMGF P I K++       +  RQTLM+SAT
Sbjct: 308 GRLLDFIDRGYVTFENVNFVVLDEADRMLDMGFLPSIEKVMGHATMPEKQQRQTLMFSAT 367

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P E+++LA  +L +YI + +G
Sbjct: 368 FPAEIQELAGKFLHNYICVFVG 389



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKT A++LP I H+ + +  +  R   P  +++APTRELA QI      F H + ++ 
Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKV 280

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
              +GG   + Q + +  G  +++AT
Sbjct: 281 CVSYGGTAVQHQLQLMRGGCHVLVAT 306


>UniRef50_A2G6R5 Cluster: DEAD/DEAH box helicase family protein;
           n=1; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 865

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 35/83 (42%), Positives = 57/83 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+DF+       +    +V+DEAD+M+   FEPQ + +I +   + QTLM+SATWP E
Sbjct: 615 GRLLDFIRNNNIKPESIGIVVIDEADKMVSNDFEPQCKAVISRCPKNIQTLMFSATWPDE 674

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           V+ +A++YLG+YI++ + S +L+
Sbjct: 675 VQFMAQNYLGEYIRVIVNSRELT 697



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT AY++PAI ++ NQ   R   GP  L++A TREL +QIQ+        + V+   
Sbjct: 533 GSGKTAAYLIPAITYVINQNKKR---GPHVLIMANTRELVKQIQEFGEILTKNTSVKVAV 589

Query: 183 VFGGA-PKREQARDLERGVEIVIA 251
            +GG   +R+Q RD+  G +I+ A
Sbjct: 590 AYGGENNRRQQIRDI-AGADIIAA 612


>UniRef50_Q9V3C0 Cluster: ATP-dependent RNA helicase abstrakt; n=7;
           Eukaryota|Rep: ATP-dependent RNA helicase abstrakt -
           Drosophila melanogaster (Fruit fly)
          Length = 619

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 37/78 (47%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+K    L  C YL +DEADRM+DMGFE  +R I    +  RQTL++SAT PK+
Sbjct: 318 GRLMDMLDKKILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKK 377

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + IN+G
Sbjct: 378 IQNFARSALVKPVTINVG 395



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTS-- 164
           GSGKTL ++LP I+    Q    P  R +GP  L++ P+RELA+Q  ++   +  H    
Sbjct: 224 GSGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQAC 283

Query: 165 ---YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               +R+    GG P  E    + RGV IV+AT
Sbjct: 284 GMPEIRSCLAMGGLPVSEALDVISRGVHIVVAT 316


>UniRef50_Q58083 Cluster: Probable ATP-dependent RNA helicase
           MJ0669; n=11; cellular organisms|Rep: Probable
           ATP-dependent RNA helicase MJ0669 - Methanococcus
           jannaschii
          Length = 367

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 33/72 (45%), Positives = 50/72 (69%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D + +GT NL+   Y +LDEAD ML+MGF   + KI+     D++ L++SAT P+E
Sbjct: 132 GRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKRILLFSATMPRE 191

Query: 437 VKKLAEDYLGDY 472
           +  LA+ Y+GDY
Sbjct: 192 ILNLAKKYMGDY 203



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 25/84 (29%), Positives = 40/84 (47%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT ++ +P I  +N        +G  A++L PTRELA Q+            ++   
Sbjct: 54  GSGKTASFAIPLIELVNEN------NGIEAIILTPTRELAIQVADEIESLKGNKNLKIAK 107

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q + L +   IV+ T
Sbjct: 108 IYGGKAIYPQIKAL-KNANIVVGT 130


>UniRef50_A5BHG9 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 757

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 4/79 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPD---RQTLMWSAT 424
           GRL+D +E+   +L+   YL LDEADRMLDMGFEPQIRKI+EQ+  P    RQT+++SAT
Sbjct: 255 GRLVDMIERARVSLRMIKYLALDEADRMLDMGFEPQIRKIVEQMDMPPPGARQTMLFSAT 314

Query: 425 WPKEVKKLAEDYLGDYIQI 481
           +P E++ L  D+L  Y  +
Sbjct: 315 FPNEIQIL--DHLEFYAAV 331



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG---PIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A+  P I  I      R G     P AL+L+PTREL+ QI + A  F + + ++
Sbjct: 167 GSGKTAAFCFPIICGILRNQLSRGGARLACPTALILSPTRELSCQIHEEAKKFSYKTGLK 226

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
               +GGAP  +Q R+LERGV+I++AT
Sbjct: 227 VVVAYGGAPISQQFRNLERGVDILVAT 253


>UniRef50_Q95QN2 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 730

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 40/88 (45%), Positives = 56/88 (63%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP +V I + P + R +    GP A+++APTRELAQQI++    FG    +
Sbjct: 348 GSGKTAAFLLPLLVWITSLPKMERQEHRDLGPYAIIMAPTRELAQQIEEETNKFGKLLGI 407

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   V GGA + +Q   L  GVE+VIAT
Sbjct: 408 KTVSVIGGASREDQGMKLRMGVEVVIAT 435



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 26/105 (24%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------------- 397
           GRL+D LE     L +CTY++LDEADRMLDMGFEP ++K++E + PD             
Sbjct: 437 GRLLDVLENRYLLLNQCTYVILDEADRMLDMGFEPDVQKVLEYM-PDTNMKKDTDEFDNE 495

Query: 398 -------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
                        RQT+M++AT    +++LA  YL     ++IGS
Sbjct: 496 EALMKGFSTREKYRQTVMFTATMSSAIERLARQYLRRPAVVHIGS 540


>UniRef50_Q23WN3 Cluster: Helicase conserved C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Helicase conserved C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 602

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 38/78 (48%), Positives = 54/78 (69%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR  D ++K   N+  C Y+VLDEADR+LDM FE +IR II+ +   RQTL++S+T PK+
Sbjct: 293 GRTSDMVDKQKFNMNLCRYIVLDEADRLLDMIFEKEIRNIIDHVPGARQTLLFSSTMPKK 352

Query: 437 VKKLAEDYLGDYIQINIG 490
           V+  A+  L D I +N+G
Sbjct: 353 VQDFAKQALIDPIIVNVG 370



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 5/86 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIV----HINNQPPIRRGDGPIALVLAP-TRELAQQIQQVAADFGHTSY 167
           G GKT+ ++LPA+V    H  N P + RG+GP+A+++ P T ELA    Q   + G+   
Sbjct: 183 GQGKTIVFLLPALVMAIEHEMNMP-LFRGEGPLAIIIVPSTYELACYYSQKLQEAGYPQ- 240

Query: 168 VRNTCVFGGAPKREQARDLERGVEIV 245
           +R +   GG    +Q   +  GV ++
Sbjct: 241 IRCSLSIGGMDMMQQIAQVREGVHLI 266


>UniRef50_Q82T78 Cluster: RhlE; ATP-dependent RNA helicase RhlE;
           n=3; Nitrosomonadaceae|Rep: RhlE; ATP-dependent RNA
           helicase RhlE - Nitrosomonas europaea
          Length = 498

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 36/75 (48%), Positives = 53/75 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E+   N  +   LVLDEADRMLDMGF P I++++  + P RQ+LM+SAT+  E
Sbjct: 140 GRLLDLVEQKAVNFSKTEILVLDEADRMLDMGFLPDIKRVMALLSPQRQSLMFSATFSGE 199

Query: 437 VKKLAEDYLGDYIQI 481
           ++KLA+  L   ++I
Sbjct: 200 IRKLADSLLKQPVRI 214



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN--QPPIRRGDGPI-ALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKT  + LP +  +       +     P+ AL++APTRELA QI +    +G    +R
Sbjct: 52  GTGKTAGFTLPLLYRLQAYANTSVSPARHPVRALIMAPTRELAMQIDESVRKYGKYLALR 111

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              VFGG     Q   L+ GVEI++AT
Sbjct: 112 TAVVFGGINIEPQIAALQAGVEILVAT 138


>UniRef50_Q81JK1 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=30; Firmicutes|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Bacillus anthracis
          Length = 481

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 35/77 (45%), Positives = 55/77 (71%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D +EKGT +L+R  YLV+DEAD ML+MGF  Q+  II+++   R T+++SAT P++
Sbjct: 131 GRVLDHIEKGTLSLERLKYLVIDEADEMLNMGFIDQVEAIIDELPTKRMTMLFSATLPED 190

Query: 437 VKKLAEDYLGDYIQINI 487
           V++L+  Y+     I I
Sbjct: 191 VERLSRTYMNAPTHIEI 207



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 26/84 (30%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT ++ +P    +  +      + P ALVL PTRELA Q+++   + G    ++   
Sbjct: 51  GSGKTASFGIPLCEMVEWEE-----NKPQALVLTPTRELAVQVKEDITNIGRFKRIKAAA 105

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++G +P   Q  +L++   IV+ T
Sbjct: 106 IYGKSPFARQKLELKQKTHIVVGT 129


>UniRef50_Q11UI8 Cluster: DEAD box-related helicase; n=3;
           Sphingobacteriales|Rep: DEAD box-related helicase -
           Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 437

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 39/77 (50%), Positives = 54/77 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+  L+ GT NL++  +LVLDEADRMLDMGF   I ++I  +  +RQT+M+SAT P +
Sbjct: 132 GRLLAQLQSGTANLKQIKHLVLDEADRMLDMGFYDDIVRVISYLPTERQTIMFSATMPTK 191

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ LA   + D  QINI
Sbjct: 192 MRALANKLMKDPQQINI 208



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 36/87 (41%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY+LP +  I         D    LVL PTRELA QI Q    F +   V +  
Sbjct: 48  GTGKTAAYMLPILHKIIES----NTDSLDTLVLVPTRELAIQIDQQIEGFSYFINVSSIA 103

Query: 183 VFG---GAPKREQARDLERGVEIVIAT 254
           V+G   GA   +Q + L  G  IVIAT
Sbjct: 104 VYGGGDGATWDQQRKALTDGANIVIAT 130


>UniRef50_Q4JG17 Cluster: Vasa-like protein; n=1; Litopenaeus
           vannamei|Rep: Vasa-like protein - Penaeus vannamei
           (Penoeid shrimp) (European white shrimp)
          Length = 703

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 41/84 (48%), Positives = 59/84 (70%), Gaps = 4/84 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII--EQIRP--DRQTLMWSAT 424
           GRL+DFLEKG        YLVLDEADRMLDMGF   I+ +I  + + P  +R TLM+SAT
Sbjct: 397 GRLLDFLEKGKIVFSSLKYLVLDEADRMLDMGFLSSIKTVINHKTMTPTAERITLMFSAT 456

Query: 425 WPKEVKKLAEDYLGDYIQINIGSL 496
           +P E+++LA  +L +Y+ + +G++
Sbjct: 457 FPHEIQELASAFLNNYLFVVVGTV 480



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 35/88 (39%), Positives = 48/88 (54%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--NNQPP--IRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + +I  NN P         P  LV+ PTRELA QI + A  F H+S  
Sbjct: 308 GSGKTAAFLLPMLHYILDNNCPSNAFEEPAQPTGLVICPTRELAIQIMREARKFSHSSVA 367

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +    +GGA    Q + +  G  I++AT
Sbjct: 368 KCCVAYGGAAGFHQLKTIHSGCHILVAT 395


>UniRef50_Q9NQI0 Cluster: Probable ATP-dependent RNA helicase DDX4;
           n=49; Euteleostomi|Rep: Probable ATP-dependent RNA
           helicase DDX4 - Homo sapiens (Human)
          Length = 724

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 39/85 (45%), Positives = 61/85 (71%), Gaps = 5/85 (5%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE----QIRPDRQTLMWSAT 424
           GRL+D + K    L++  YLVLDEADRMLDMGF P+++K+I       +  RQTLM+SAT
Sbjct: 424 GRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSAT 483

Query: 425 WPKEVKKLAEDYL-GDYIQINIGSL 496
           +P+E+++LA ++L  +Y+ + +G +
Sbjct: 484 FPEEIQRLAAEFLKSNYLFVAVGQV 508



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ----PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP + H+ +        +    P  +++APTREL  QI   A  F   + V
Sbjct: 335 GSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCV 394

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   ++GG       R + +G  I+ AT
Sbjct: 395 RAVVIYGGTQLGHSIRQIVQGCNILCAT 422


>UniRef50_UPI00015B4D1B Cluster: PREDICTED: similar to DEAD box
           ATP-dependent RNA helicase; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to DEAD box
           ATP-dependent RNA helicase - Nasonia vitripennis
          Length = 594

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/78 (47%), Positives = 49/78 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+K    L  C YL +DEADRM+DMGFE  +R I       RQTL++SAT PK+
Sbjct: 320 GRLMDMLDKKMVKLGVCRYLCMDEADRMIDMGFEEDVRTIFSFFEGQRQTLLFSATMPKK 379

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + IN+G
Sbjct: 380 IQNFARSALVKPVTINVG 397



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQIQQVAADF------G 155
           GSGKTL ++LP I+    Q    P  R +GP  L++ P+RELA+Q   +   +       
Sbjct: 226 GSGKTLVFVLPLIMFCLEQEVALPFGRNEGPYGLIICPSRELAKQTYDIIQHYTNSLRHH 285

Query: 156 HTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           H   +R     GG P  E    + RGV I++AT
Sbjct: 286 HCPEIRCCLAIGGVPVSESLDVISRGVHIMVAT 318


>UniRef50_Q67NW1 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase -
           Symbiobacterium thermophilum
          Length = 526

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 38/83 (45%), Positives = 56/83 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D L + T +L +   +VLDEAD MLDMGF   I KI++    +RQTL++SAT P E
Sbjct: 133 GRILDHLGRSTLDLSQVRMVVLDEADEMLDMGFIEDIEKILQNTPAERQTLLFSATMPPE 192

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           +++LA  Y+ D I I++   QL+
Sbjct: 193 IRRLAGRYMRDPITISVTPQQLT 215



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  +    P +R     ALVL PTRELA Q+ +     G  + V+   
Sbjct: 53  GTGKTAAFGVPIVERL---VPGQRAVQ--ALVLTPTRELAIQVAEEITKIGRHARVKTIA 107

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q R L  GV++VI T
Sbjct: 108 IYGGQSIERQIRSLRFGVDVVIGT 131


>UniRef50_A3FQ46 Cluster: U5 snRNP 100 kD protein, putative; n=2;
           Cryptosporidium|Rep: U5 snRNP 100 kD protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 529

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 38/82 (46%), Positives = 57/82 (69%), Gaps = 2/82 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD--RQTLMWSATWP 430
           GR+ D LEK  T L +C+Y++LDEADRM+D+GF+  +  I++QI P+  R T M+SAT  
Sbjct: 281 GRMQDCLEKTLTVLVQCSYVILDEADRMIDLGFQDSLNFILDQIPPEIQRTTHMFSATMQ 340

Query: 431 KEVKKLAEDYLGDYIQINIGSL 496
           KE++ +A+ YL   I + IG +
Sbjct: 341 KELENIAKRYLNSPINVTIGDI 362



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI---RRGDGPIALVLAPTRELAQQIQQVAADFGHTSY-- 167
           GSGKT+A+++P I ++ N+P +      +GP  L+LAP RELA QI+  A    + ++  
Sbjct: 189 GSGKTIAFLIPLISYVGNKPILDYKTSQEGPYGLILAPARELALQIEDEAQKLLNKTHEL 248

Query: 168 --VRNTCVFGGAPKREQARDLERGVEIVIAT 254
             +R   + GG    +QA  L +GVEI+IAT
Sbjct: 249 KRIRTLSIVGGRNIDQQAFSLRKGVEIIIAT 279


>UniRef50_P21372 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=2; Saccharomyces cerevisiae|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 849

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQVAADFGHT-SYVRN 176
           GSGKT++Y+LP +  +  Q P+ + + GP+ L+LAPTRELA QI +    F    + +R+
Sbjct: 303 GSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRS 362

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
            C  GG+  ++Q  DL+RG EIV+AT
Sbjct: 363 VCCTGGSEMKKQITDLKRGTEIVVAT 388



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 36/82 (43%), Positives = 54/82 (65%), Gaps = 3/82 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL---QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GR ID L      L   +R T++V+DEADR+ D+GFEPQI +I++ +RPD+Q +++SAT+
Sbjct: 390 GRFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATF 449

Query: 428 PKEVKKLAEDYLGDYIQINIGS 493
           P +++  A   L   I I I S
Sbjct: 450 PNKLRSFAVRVLHSPISITINS 471


>UniRef50_Q754U8 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=2; Saccharomycetaceae|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Ashbya gossypii (Yeast) (Eremothecium gossypii)
          Length = 816

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 37/85 (43%), Positives = 57/85 (67%), Gaps = 3/85 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL---QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GR ID L   + NL   +R  ++V+DEADR+ D+GFEPQ+ +I++ IRPD+Q +++SAT+
Sbjct: 371 GRFIDLLSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATF 430

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQL 502
           P ++K  A   L D + I + S  L
Sbjct: 431 PNKLKSFASKILHDPVYITVNSKSL 455



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQVAADF--GHTSYVR 173
           GSGKT+++ILP +  I  Q P+   + GP+ L+L+PTRELA QI +    F  G  S +R
Sbjct: 284 GSGKTVSFILPLLRQIKAQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPS-IR 342

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           + C  GG+  + Q  D++RGVEIVIAT
Sbjct: 343 SLCCTGGSELKRQINDIKRGVEIVIAT 369


>UniRef50_A7HG33 Cluster: DEAD/DEAH box helicase domain protein;
           n=5; Cystobacterineae|Rep: DEAD/DEAH box helicase domain
           protein - Anaeromyxobacter sp. Fw109-5
          Length = 455

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 37/77 (48%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D LE+G   L     LVLDEADRMLDMGF+PQ+ +I+ ++   RQTL++SAT   E
Sbjct: 130 GRLVDHLEQGNARLDGIEALVLDEADRMLDMGFKPQLDRILRRLPKQRQTLLFSATMAGE 189

Query: 437 VKKLAEDYLGDYIQINI 487
           V   A  +L D +++ +
Sbjct: 190 VADFARAHLRDPVRVEV 206



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 39/84 (46%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A++LP I  +  +P  R      ALVLAPTRELA QI +    FGH   VR   
Sbjct: 51  GTGKTAAFLLPLIDRLAGKPGTR------ALVLAPTRELALQIGEELERFGHARRVRGAV 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +QA  L +  EIVIAT
Sbjct: 105 IIGGVGMAQQAEALRQKREIVIAT 128


>UniRef50_A5UZK3 Cluster: DEAD/DEAH box helicase domain protein;
           n=12; Bacteria|Rep: DEAD/DEAH box helicase domain
           protein - Roseiflexus sp. RS-1
          Length = 467

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 39/87 (44%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D LE+GT  L+    L+LDEAD+M DMGF P +R+I+      RQT+++SAT P  
Sbjct: 129 GRLLDHLERGTLTLEHLDMLILDEADQMFDMGFLPDVRRILRLAPAQRQTMLFSATMPDA 188

Query: 437 VKKLAEDYLGDYIQINIG-SLQLSAIT 514
           ++ LA + L +   I IG S  +S +T
Sbjct: 189 IRALAREALREPQTIQIGRSAPVSTVT 215



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 32/82 (39%), Positives = 49/82 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A++LP +  +   P   RG    A+++ PTRELA+QIQ V    G  + +R+  
Sbjct: 48  GTGKTAAFVLPILQRLMRGP---RGRVR-AMIVTPTRELAEQIQGVIEALGKYTGLRSVT 103

Query: 183 VFGGAPKREQARDLERGVEIVI 248
           ++GG   + Q + L RGVEI +
Sbjct: 104 LYGGVGYQGQIQRLRRGVEIAV 125


>UniRef50_Q8I416 Cluster: ATP-dependent RNA helicase, putative; n=2;
            Plasmodium|Rep: ATP-dependent RNA helicase, putative -
            Plasmodium falciparum (isolate 3D7)
          Length = 1490

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 35/84 (41%), Positives = 55/84 (65%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
            GSGKTL+Y+ P I H+ +Q P+R  DGPI+++L PTREL+ Q++  A  +     +    
Sbjct: 770  GSGKTLSYLFPVIRHVLHQEPLRNNDGPISIILTPTRELSIQVKNEAKIYCKAVNIEILA 829

Query: 183  VFGGAPKREQARDLERGVEIVIAT 254
            V+GG+    Q + L++GVEI++ T
Sbjct: 830  VYGGSNIARQLKVLKKGVEILVGT 853



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 38/81 (46%), Positives = 53/81 (65%), Gaps = 3/81 (3%)
 Frame = +2

Query: 257  GRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
            GR+ID L       TNL R +++VLDEADR+LD+GFE QI  I+   R D+QT M SAT+
Sbjct: 855  GRIIDILTISNCKVTNLNRVSFVVLDEADRLLDLGFESQIYNILRNCRKDKQTAMISATF 914

Query: 428  PKEVKKLAEDYLGDYIQINIG 490
            P  ++ +A+  L   I+I +G
Sbjct: 915  PNYIQNMAKKLLYKPIEIIVG 935


>UniRef50_A2DH37 Cluster: DEAD/DEAH box helicase family protein;
           n=2; Trichomonas vaginalis G3|Rep: DEAD/DEAH box
           helicase family protein - Trichomonas vaginalis G3
          Length = 541

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE--QIRP--DRQTLMWSAT 424
           GRLID L++    L    +L+LDEADRMLDMGFEPQ++++I    + P  DRQT+++SAT
Sbjct: 250 GRLIDILKQHCITLSEVRFLILDEADRMLDMGFEPQMQEVINGWDMPPADDRQTMLFSAT 309

Query: 425 WPKEVKKLAEDYL-GDYIQINIG 490
           +P  V+ LA D++   Y +I++G
Sbjct: 310 FPDAVRNLARDFMRPKYCRISVG 332



 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 39/84 (46%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP I  +           P  + L PTRELA QI +    F   + ++ TC
Sbjct: 168 GSGKTAAFMLPVITQLIGTC---HSPNPSCVALCPTRELAIQIFEETRKFCKGTDLKTTC 224

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGGAP  EQ R+L RG++IVIAT
Sbjct: 225 VFGGAPITEQIRNLSRGIDIVIAT 248


>UniRef50_A7TJK8 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 872

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 38/85 (44%), Positives = 58/85 (68%), Gaps = 3/85 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL---QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRLID L   +  L   +R T++V+DEADR+ DMGFEPQI +I++ +RPD+Q +++SAT+
Sbjct: 411 GRLIDILTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKTVRPDKQCVLFSATF 470

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQL 502
           P +++  A   L D + + I S  L
Sbjct: 471 PNKLRSFAARILTDPLTVTINSNNL 495



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 40/86 (46%), Positives = 55/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQVAADFGHTSY-VRN 176
           GSGKT++YILP +  I  Q  + + + GP+ L+LAPTRELA QI +    F      +R 
Sbjct: 324 GSGKTISYILPMLRQIKAQRTLSKNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRT 383

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
            C  GG+  ++Q  DL+RGVEIV+AT
Sbjct: 384 ICCTGGSEMKKQINDLKRGVEIVVAT 409


>UniRef50_P93008 Cluster: DEAD-box ATP-dependent RNA helicase 21;
           n=8; Viridiplantae|Rep: DEAD-box ATP-dependent RNA
           helicase 21 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 733

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 40/87 (45%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI---RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A++LP + +I+  PP+      +GP A+V+APTRELAQQI++    F H    R
Sbjct: 360 GSGKTAAFVLPMLAYISRLPPMSEENETEGPYAVVMAPTRELAQQIEEETVKFAHYLGFR 419

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
            T + GG    EQ   + +G EIVIAT
Sbjct: 420 VTSIVGGQSIEEQGLKITQGCEIVIAT 446



 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 40/96 (41%), Positives = 58/96 (60%), Gaps = 17/96 (17%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------- 397
           GRLID LE+    L +C Y+VLDEADRM+DMGFEPQ+  +++      ++P+        
Sbjct: 448 GRLIDCLERRYAVLNQCNYVVLDEADRMIDMGFEPQVAGVLDAMPSSNLKPENEEEELDE 507

Query: 398 ----RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
               R T M+SAT P  V++LA  YL + + + IG+
Sbjct: 508 KKIYRTTYMFSATMPPGVERLARKYLRNPVVVTIGT 543


>UniRef50_P42305 Cluster: ATP-dependent RNA helicase dbpA; n=9;
           Firmicutes|Rep: ATP-dependent RNA helicase dbpA -
           Bacillus subtilis
          Length = 479

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 35/82 (42%), Positives = 58/82 (70%), Gaps = 2/82 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D +EKGT  L R +YLV+DEAD ML+MGF  Q+  II+ +  +R T+++SAT P++
Sbjct: 129 GRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTMLFSATLPQD 188

Query: 437 VKKLAEDYL--GDYIQINIGSL 496
           ++KL+  Y+   ++I++    L
Sbjct: 189 IEKLSRQYMQNPEHIEVKAAGL 210



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/84 (33%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT ++ +P +  + N    +    P AL+L PTRELA Q+++   + G    ++ T 
Sbjct: 49  GSGKTASFGIP-LCELANWDENK----PQALILTPTRELAVQVKEDITNIGRFKRIKATA 103

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFG +   +Q  +L++   IV+ T
Sbjct: 104 VFGKSSFDKQKAELKQKSHIVVGT 127


>UniRef50_Q8XKJ8 Cluster: ATP-dependent RNA helicase; n=12;
           Clostridium|Rep: ATP-dependent RNA helicase -
           Clostridium perfringens
          Length = 528

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 38/92 (41%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D + + +  L    +LVLDEAD ML+MGF   + +I++ ++ DRQTL++SAT P +
Sbjct: 133 GRVLDLIRRKSLPLNDIGFLVLDEADEMLNMGFIDDLEEIVKSLKTDRQTLLFSATMPPQ 192

Query: 437 VKKLAEDYLGD---YIQINIGSLQLSAITTFF 523
           +KKLA +Y+ +   +I I   SL +S I  F+
Sbjct: 193 IKKLARNYMKEDTKHIAIKKSSLTVSKIEQFY 224



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 32/84 (38%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+       INN     +   P AL+LAPTRELA Q+ +     G    +    
Sbjct: 51  GTGKTAAF---GCAIINNADFSGKKKSPKALILAPTRELAIQVNEELVRLGKHEKLSVLP 107

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG P   Q R L+ GV+IV+ T
Sbjct: 108 IYGGQPIDRQIRALKNGVDIVVGT 131


>UniRef50_Q9KAA6 Cluster: ATP-dependent RNA helicase; n=5;
           Firmicutes|Rep: ATP-dependent RNA helicase - Bacillus
           halodurans
          Length = 539

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 36/84 (42%), Positives = 54/84 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID L + T  L     ++LDEAD MLDMGF   I  I+ Q++ +RQTL++SAT P  
Sbjct: 132 GRIIDHLRRKTLILDHVNTVILDEADEMLDMGFIDDIESILRQVKNERQTLLFSATMPPA 191

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           +KKL+  Y+ D   ++I   +++A
Sbjct: 192 IKKLSRKYMNDPQTVSINRREVTA 215



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  ++    ++      AL+L PTRELA Q+            +R   
Sbjct: 53  GTGKTAAFGIPVVEKVSTGRHVQ------ALILTPTRELAIQVSGEIQKLSKHKKIRTLP 106

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q + L++GV++VI T
Sbjct: 107 IYGGQSIVHQIKALKQGVQVVIGT 130


>UniRef50_A2EPC6 Cluster: Type III restriction enzyme, res subunit
           family protein; n=1; Trichomonas vaginalis G3|Rep: Type
           III restriction enzyme, res subunit family protein -
           Trichomonas vaginalis G3
          Length = 505

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL++FL+  T N Q CTY+V+DEADR+ + GF  Q+R I++ IRPDRQTL++ AT P +
Sbjct: 245 GRLMNFLK--TVNWQFCTYVVVDEADRIFETGFLRQLRSIMDYIRPDRQTLLFGATLPPQ 302

Query: 437 VKKLAEDYLGDYIQINIG 490
           +++L+ + L    ++ IG
Sbjct: 303 IEELSMNSLKFSTRVQIG 320



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTL +++P + H+  Q    + +GP AL+L+PT  LA+Q   V      ++ ++   
Sbjct: 163 GTGKTLCFLIPLLYHVLAQG---KQEGPTALILSPTELLARQTTLVCHQLIKSTDIKCVE 219

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + G   K +Q   L +G +++I T
Sbjct: 220 LTGNQMKHKQQSSLMKGADVIIGT 243


>UniRef50_Q0AVQ9 Cluster: ATP-dependent RNA helicase; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           ATP-dependent RNA helicase - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 530

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 35/69 (50%), Positives = 49/69 (71%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D + +GT +L    Y+VLDEAD MLDMGF P I+KI+ Q   +RQT ++SAT P E
Sbjct: 130 GRLMDHMNRGTISLSPLKYVVLDEADEMLDMGFLPDIQKILSQCPRERQTFLFSATLPDE 189

Query: 437 VKKLAEDYL 463
           V++L   ++
Sbjct: 190 VRELGTKFM 198



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 28/84 (33%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT ++ +P +    N+  + +G+G  ALVL PTRELA Q+ +  +       ++   
Sbjct: 51  GTGKTASFGIPIL----NR--VIKGEGLQALVLCPTRELAVQVTEEISSLSRRMRIQVLA 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q R L R  EI++ T
Sbjct: 105 IYGGQSIELQLRSLRRNPEIIVGT 128


>UniRef50_O07897 Cluster: Heat resistant RNA dependent ATPase; n=3;
           Thermus thermophilus|Rep: Heat resistant RNA dependent
           ATPase - Thermus thermophilus
          Length = 510

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 35/77 (45%), Positives = 50/77 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR +D+L +G  +L R    VLDEAD ML MGFE ++  ++    P RQTL++SAT P  
Sbjct: 129 GRALDYLRQGVLDLSRVEVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPSW 188

Query: 437 VKKLAEDYLGDYIQINI 487
            K+LAE Y+ + + IN+
Sbjct: 189 AKRLAERYMKNPVLINV 205



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 36/85 (42%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI-QQVAADFGHTSYVRNT 179
           G+GKTLA+ LP    +   P   RG  P ALVL PTRELA Q+  ++ A   H   V   
Sbjct: 48  GTGKTLAFALPIAERL--APSQERGRKPRALVLTPTRELALQVASELTAVAPHLKVV--- 102

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GG    +Q   L RG + V+AT
Sbjct: 103 AVYGGTGYGKQKEALLRGADAVVAT 127


>UniRef50_A7HKQ8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Fervidobacterium nodosum Rt17-B1|Rep: DEAD/DEAH box
           helicase domain protein - Fervidobacterium nodosum
           Rt17-B1
          Length = 571

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 34/76 (44%), Positives = 53/76 (69%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID L + T +L    YLVLDEADRMLDMGF   + +II++   +++T ++SAT PKE
Sbjct: 147 GRIIDHLNRDTLDLSHVEYLVLDEADRMLDMGFLDDVLEIIKRTGENKRTFLFSATMPKE 206

Query: 437 VKKLAEDYLGDYIQIN 484
           +  +A  ++ +YI ++
Sbjct: 207 IVDIARKFMKEYIHVS 222



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+     +      A+++ PTRELA QI +       T  V+ T 
Sbjct: 66  GTGKTAAFGIPLLERID----FKANKFVKAIIVTPTRELALQIFEELKSLKGTKRVKITT 121

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG    +Q +DLE+GV+IV+ T
Sbjct: 122 LYGGQSLEKQFKDLEKGVDIVVGT 145


>UniRef50_A0C369 Cluster: Chromosome undetermined scaffold_146,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_146,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 566

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + K   N+  C ++VLDEADRMLD  FE +IR I+E     RQT+++SAT PK+
Sbjct: 258 GRISDMVNKKKINMDLCRFIVLDEADRMLDQVFELEIRNILEHFTGPRQTMLFSATLPKK 317

Query: 437 VKKLAEDYLGDYIQINIG 490
           +++  +  L D + IN+G
Sbjct: 318 IQEFTKQTLVDPLVINVG 335



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 32/93 (34%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELA----QQIQQVAADFGHT 161
           G GKTL ++LPA++    +    P+ RG+GP AL+L P+ ELA    +  +Q    F   
Sbjct: 164 GQGKTLVFLLPALLQCIEEEMKMPVIRGEGPFALILLPSHELAILTYELAKQYCQKFQKK 223

Query: 162 SYVRNTCV--FGGAPKREQARDLERGVEIVIAT 254
            +    C+   GG     Q + +  GV IVI T
Sbjct: 224 GFPAIHCLLGIGGMDMSSQLQSIRNGVHIVIGT 256


>UniRef50_Q9BUQ8 Cluster: Probable ATP-dependent RNA helicase DDX23;
           n=50; Eumetazoa|Rep: Probable ATP-dependent RNA helicase
           DDX23 - Homo sapiens (Human)
          Length = 820

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR----GDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+++P +V I   P I R      GP A++LAPTRELAQQI++    FG    +
Sbjct: 438 GSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGI 497

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   V GG  + +Q   L  G EIVIAT
Sbjct: 498 RTVAVIGGISREDQGFRLRMGCEIVIAT 525



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 46/105 (43%), Positives = 59/105 (56%), Gaps = 26/105 (24%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----RPD-------- 397
           GRLID LE     L RCTY+VLDEADRM+DMGFEP ++KI+E +     +PD        
Sbjct: 527 GRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPE 586

Query: 398 -------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
                        RQT+M++AT P  V++LA  YL     + IGS
Sbjct: 587 KMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGS 631


>UniRef50_Q8YH70 Cluster: ATP-DEPENDENT RNA HELICASE RHLE; n=10;
           Rhizobiales|Rep: ATP-DEPENDENT RNA HELICASE RHLE -
           Brucella melitensis
          Length = 535

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 35/77 (45%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +  G  +L +  +LVLDEADRMLDMGF   +++I +    +RQT ++SAT PKE
Sbjct: 219 GRLTDLMRDGLVDLSQTRWLVLDEADRMLDMGFINDVKRIAKATHAERQTALFSATMPKE 278

Query: 437 VKKLAEDYLGDYIQINI 487
           +  LAE  L D +++ +
Sbjct: 279 IASLAERLLRDPVRVEV 295



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 33/84 (39%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  I      RR     AL+LAPTRELA QI+Q   +   ++++    
Sbjct: 134 GSGKTAAFSLPILQKIIGLGDKRRPKTARALILAPTRELAVQIEQTIRNVSKSAHISTAL 193

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG  K  Q + +  G++++IAT
Sbjct: 194 VLGGVSKLSQIKRIAPGIDVLIAT 217


>UniRef50_Q7MT81 Cluster: ATP-dependent RNA helicase, DEAD/DEAH box
           family; n=9; Bacteroidales|Rep: ATP-dependent RNA
           helicase, DEAD/DEAH box family - Porphyromonas
           gingivalis (Bacteroides gingivalis)
          Length = 427

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 38/77 (49%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLI  L  G+ +L   +Y VLDEADRMLDMGF   I +I +Q+    QT+M+SAT P +
Sbjct: 134 GRLISHLNLGSADLSHVSYFVLDEADRMLDMGFFDDIMQIYKQLPSSCQTVMFSATMPPK 193

Query: 437 VKKLAEDYLGDYIQINI 487
           ++KLA   L D I++ I
Sbjct: 194 IRKLAASILRDPIEVEI 210



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY+LP +  ++        D   A+++APTRELAQQI Q    F +   V    
Sbjct: 48  GTGKTAAYLLPILDRLSAGE--FASDVVNAVIMAPTRELAQQIDQQVEGFSYFMPVSAVA 105

Query: 183 VFGGAPK---REQARDLERGVEIVIAT 254
           ++GG       +Q R +  G +IVIAT
Sbjct: 106 IYGGTDGVAWEQQRRGMAMGADIVIAT 132


>UniRef50_Q0M1B5 Cluster: Helicase-like:DEAD/DEAH box helicase-like;
           n=11; Alphaproteobacteria|Rep: Helicase-like:DEAD/DEAH
           box helicase-like - Caulobacter sp. K31
          Length = 678

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 35/75 (46%), Positives = 50/75 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D  E+G   +    +LV+DEADRMLDMGF P I +I +   P +QTL +SAT P E
Sbjct: 132 GRLLDHFERGKLLMTGVQFLVVDEADRMLDMGFIPDIERIFKMTPPKKQTLFFSATMPPE 191

Query: 437 VKKLAEDYLGDYIQI 481
           + +L + +L D ++I
Sbjct: 192 ITRLTKQFLKDPVRI 206



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/84 (38%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP I  + N     R   P ALV+APTRELA Q+      +   + +    
Sbjct: 49  GTGKTAAFTLPLIDKLMNGRAKARM--PRALVIAPTRELADQVASSFEKYAKGTKLSWAL 106

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q + L+RGV+++IAT
Sbjct: 107 LIGGVSFGDQEKKLDRGVDVLIAT 130


>UniRef50_A6DK15 Cluster: ATP-dependent RNA helicase, specific for
           23S rRNA; n=1; Lentisphaera araneosa HTCC2155|Rep:
           ATP-dependent RNA helicase, specific for 23S rRNA -
           Lentisphaera araneosa HTCC2155
          Length = 462

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 36/79 (45%), Positives = 54/79 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++  L K + +L     LVLDEADRMLDMGF+ +I  II+Q    RQTL++SAT+PK+
Sbjct: 132 GRILKHLNKSSLSLDHVRTLVLDEADRMLDMGFQDEIDAIIDQTNKQRQTLLFSATYPKK 191

Query: 437 VKKLAEDYLGDYIQINIGS 493
           +  +A+  + D ++I + S
Sbjct: 192 IATIAKRVMKDPLRIELDS 210



 Score = 37.1 bits (82), Expect = 0.40
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 93  LVLAPTRELAQQIQQVAADFGH-TSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           L+L PTREL +Q+ +   D       ++   + GG P R Q + +  G  IV+ T
Sbjct: 76  LILCPTRELCEQVSKAIRDLARMMPNIKLLSLGGGMPFRPQMKSVAHGAHIVVGT 130


>UniRef50_Q4Z5Q6 Cluster: ATP-dependent RNA helicase, putative; n=4;
           Plasmodium (Vinckeia)|Rep: ATP-dependent RNA helicase,
           putative - Plasmodium berghei
          Length = 1312

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 3/81 (3%)
 Frame = +2

Query: 257 GRLIDFL---EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GR+ID L       TNL R +++VLDEADR+LD+GFE QI  I+   R D+QT M SAT+
Sbjct: 701 GRIIDILTISNSKVTNLNRASFIVLDEADRLLDLGFESQIHSILNNCRKDKQTAMISATF 760

Query: 428 PKEVKKLAEDYLGDYIQINIG 490
           P  ++ LA+  L   I+I +G
Sbjct: 761 PNYIQNLAKKLLYKPIEIIVG 781



 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 33/84 (39%), Positives = 54/84 (64%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT++Y+ P I H+ +Q  +R  DGPI ++L PTREL+ Q++  A+ +     ++   
Sbjct: 616 GSGKTISYLFPLIRHVLHQDKLRNNDGPIGIILTPTRELSIQVKNEASIYCKAVDLKILA 675

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG+    Q   L++GVEI++ T
Sbjct: 676 VYGGSNIGAQLNVLKKGVEIIVGT 699


>UniRef50_Q388E8 Cluster: ATP-dependent DEAD/H RNA helicase,
           putative; n=3; Trypanosoma|Rep: ATP-dependent DEAD/H RNA
           helicase, putative - Trypanosoma brucei
          Length = 660

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------RQTLMWS 418
           GRL+D   +G        +L+LDEADRMLDMGFEPQIR I++    D      RQTL++S
Sbjct: 295 GRLMDMFSRGYVRFSEIRFLILDEADRMLDMGFEPQIRMIVQGPDSDMPRAGQRQTLLYS 354

Query: 419 ATWPKEVKKLAEDYLGDYIQINIG 490
           AT+P E+++LA +++  +  + +G
Sbjct: 355 ATFPVEIQRLAREFMCRHSFLQVG 378



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 41/90 (45%), Positives = 58/90 (64%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAI----VHINNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKT +Y++PAI    ++I+N+PP   G    P AL+LAPTREL+ QI   A  F + +
Sbjct: 204 GSGKTASYLIPAINEILLNISNRPPYSPGSHSSPQALILAPTRELSLQIYGEARKFTYHT 263

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            VR   V+GGA  R Q  +L RG ++++AT
Sbjct: 264 PVRCVVVYGGADPRHQVHELSRGCKLLVAT 293


>UniRef50_A4V6K8 Cluster: Putative RNA helicase protein; n=1;
           Dugesia japonica|Rep: Putative RNA helicase protein -
           Dugesia japonica (Planarian)
          Length = 515

 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 43/96 (44%), Positives = 59/96 (61%), Gaps = 6/96 (6%)
 Frame = +2

Query: 221 LGEGSRNSHCY---SGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           + + SR  H      GRL D  ++G  +L+ C  LV+DEADRMLDMGFEPQIR+II  + 
Sbjct: 221 INDASRGCHALIATPGRLKDLTDRGIFSLKYCNKLVIDEADRMLDMGFEPQIREIINNLP 280

Query: 392 --PDRQTLMWSATWPKEVKKLAEDYL-GDYIQINIG 490
               R T M+SAT+PK V  LA   +  ++ +I +G
Sbjct: 281 SVSKRHTSMFSATFPKSVMSLASKLMKPNFGEITVG 316



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 10/94 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP------IRRGDG----PIALVLAPTRELAQQIQQVAADF 152
           GSGKT+AY+ P + +I    P      +++ D     P+ LVLAPTREL  QI  VA   
Sbjct: 141 GSGKTIAYLAPLLNNIMKHYPEEMMNELKQNDEELQYPLLLVLAPTRELVNQITSVAKTL 200

Query: 153 GHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
              +++R+  V GG   R Q  D  RG   +IAT
Sbjct: 201 LKLTHLRSVSVIGGVDARSQINDASRGCHALIAT 234


>UniRef50_Q9LU46 Cluster: DEAD-box ATP-dependent RNA helicase 35;
           n=2; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 35 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 591

 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 34/78 (43%), Positives = 50/78 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   +L  C YL LDEADR++D+GFE  IR++ +  +  RQTL++SAT P +
Sbjct: 287 GRLKDMLAKKKMSLDACRYLTLDEADRLVDLGFEDDIREVFDHFKSQRQTLLFSATMPTK 346

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A   L   + +N+G
Sbjct: 347 IQIFARSALVKPVTVNVG 364



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 37/93 (39%), Positives = 53/93 (56%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQ----IQQVAADFGHT 161
           GSGKTL ++LP I+    +    PI  G+GPI L++ P+RELA+Q    ++Q  A     
Sbjct: 193 GSGKTLVFVLPMIMIALQEEMMMPIAAGEGPIGLIVCPSRELARQTYEVVEQFVAPLVEA 252

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            Y  +R+    GG   R Q   ++RGV IV+AT
Sbjct: 253 GYPPLRSLLCIGGIDMRSQLEVVKRGVHIVVAT 285


>UniRef50_Q9PGP6 Cluster: ATP-dependent RNA helicase; n=10; cellular
           organisms|Rep: ATP-dependent RNA helicase - Xylella
           fastidiosa
          Length = 614

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 34/84 (40%), Positives = 55/84 (65%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID LE+GT +L     LVLDEAD ML MGF   + +++ ++   RQ  ++SAT P +
Sbjct: 143 GRVIDHLERGTLDLSELKTLVLDEADEMLRMGFIEDVEEVLRKLPASRQVALFSATMPPQ 202

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           ++++A+ YL D I++ I +   +A
Sbjct: 203 IRRIAQTYLQDPIEVTIATKTTTA 226



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVH-INNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYVRN 176
           G+GKT A+ LP +   + NQ        P  LVLAPTRELA Q+ +    +  + S  R 
Sbjct: 62  GTGKTAAFALPLLTRTVLNQVK------PQVLVLAPTRELAIQVAEAFQRYAASISGFRV 115

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V+GG    +Q   L+RGV +++ T
Sbjct: 116 LPVYGGQSYGQQLAALKRGVHVIVGT 141


>UniRef50_Q5FUQ9 Cluster: ATP-dependent RNA helicase; n=11; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 793

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 40/87 (45%), Positives = 56/87 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D   +G   L + + LV+DEADRMLDMGF P I KI+  +   RQTL +SAT   E
Sbjct: 421 GRLLDLFGRGGLLLTQTSTLVIDEADRMLDMGFIPDIEKIVALLPAHRQTLFFSATMAPE 480

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           +++LA+ +L   ++I + S Q S  TT
Sbjct: 481 IRRLADAFLRHPVEITV-SRQSSVATT 506



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT ++ LP +  +       R   P +L+L PTRELA Q+ +    +G    + +  
Sbjct: 338 GTGKTASFTLPMLQKLAGSRA--RARMPRSLILEPTRELALQVAENFKLYGKYLRLTHAL 395

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    EQ   L RGV+++IAT
Sbjct: 396 LIGGESMAEQRDVLNRGVDVLIAT 419


>UniRef50_Q2BP56 Cluster: Putative ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: Putative ATP-dependent
           RNA helicase - Neptuniibacter caesariensis
          Length = 427

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 37/77 (48%), Positives = 54/77 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L +   +L++  YLVLDEADRMLD+GF   I+KI++    DRQTL+++AT  + 
Sbjct: 135 GRLLDLLRQKAISLEKLEYLVLDEADRMLDLGFIDPIQKIMDYAADDRQTLLFTATADES 194

Query: 437 VKKLAEDYLGDYIQINI 487
           V+ LAE YL +  +I +
Sbjct: 195 VEVLAEFYLNNPTKIKV 211



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT ++ LP I  ++  P    G  P+ ALVLAPTRELA Q+     ++G    +R  
Sbjct: 51  GTGKTASFALPIIEKLSKNPI--DGYRPVRALVLAPTRELAIQVADNTLEYGRDLGMRVI 108

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GG P   Q + L+RG +I++AT
Sbjct: 109 SVYGGVPVENQIKRLKRGTDILVAT 133


>UniRef50_A6TTG0 Cluster: DEAD/DEAH box helicase domain protein;
           n=3; Clostridiaceae|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 549

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 37/83 (44%), Positives = 54/83 (65%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L + T NL + + LVLDEAD+ML MGF   +  I+  I   RQ + +SAT P +
Sbjct: 130 GRLLDHLRRKTINLGKLSMLVLDEADQMLHMGFLRDVEDIMTHIPKRRQNMFFSATMPNQ 189

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           V+ LAE Y+ D +QI + S +++
Sbjct: 190 VRTLAEQYMKDPVQIQVQSKRVT 212



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 29/84 (34%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA+ILP +  +N + P  +     AL++ PTRELA QI            +    
Sbjct: 50  GTGKTLAFILPILERVNVEKPTIQ-----ALIITPTRELAIQITAETKKLAEVKGINILA 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG    +Q R L+  + I+I T
Sbjct: 105 AYGGQDVEQQLRKLKGSIHIIIGT 128


>UniRef50_Q54Y81 Cluster: Putative RNA helicase; n=2; Dictyostelium
           discoideum|Rep: Putative RNA helicase - Dictyostelium
           discoideum AX4
          Length = 834

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 37/87 (42%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A+++P +++I+ QP + +    DGP ALV+APTREL QQI++   +F      R
Sbjct: 460 GSGKTCAFVIPMLIYISKQPRLTKDTEADGPYALVMAPTRELVQQIEKETRNFAQHFGFR 519

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              + GG    +QA  + +G EI+IAT
Sbjct: 520 VVSLVGGQSIEDQAYQVSKGCEIIIAT 546



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 39/99 (39%), Positives = 53/99 (53%), Gaps = 21/99 (21%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII----------------EQI 388
           GRL D LEK    L +C Y+VLDEAD M+D+GFEPQ+  ++                E+ 
Sbjct: 548 GRLNDCLEKRYLVLNQCNYIVLDEADMMIDLGFEPQVTSVLDAMPSSFLKSEDDEMAEKQ 607

Query: 389 RPDRQ-----TLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             DR      T+++SAT P  V+KL++ YL     I IG
Sbjct: 608 ESDRSHIYRTTILFSATMPPLVEKLSKKYLRRPCTITIG 646


>UniRef50_Q384E1 Cluster: Mitochondrial DEAD box protein; n=5;
           Trypanosoma|Rep: Mitochondrial DEAD box protein -
           Trypanosoma brucei
          Length = 546

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 36/71 (50%), Positives = 48/71 (67%), Gaps = 2/71 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR--QTLMWSATWP 430
           GRL DFL+ G       ++LV DEADR+LDMGF+ Q+  I+      R  QT+MWSATWP
Sbjct: 245 GRLKDFLQNGDVIFDEVSFLVFDEADRLLDMGFKVQLDDILGYFSSHRPAQTMMWSATWP 304

Query: 431 KEVKKLAEDYL 463
             V++LA++YL
Sbjct: 305 PVVEQLAQEYL 315



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 33/83 (39%), Positives = 46/83 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT+A+ +PA+      P       P  +VLAPTREL QQ  +V      +  VR   
Sbjct: 165 GSGKTVAFAVPALKKFQWSP----NGSPRIVVLAPTRELVQQTAKVFHQLS-SGKVRVCE 219

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
            +GGAP+  QAR L  G ++++A
Sbjct: 220 AYGGAPREAQARRLHNGCDVLVA 242


>UniRef50_Q9P9G7 Cluster: DEAD-box RNA helicase; n=3;
           Methanosarcinaceae|Rep: DEAD-box RNA helicase -
           Methanococcoides burtonii
          Length = 522

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 35/71 (49%), Positives = 51/71 (71%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E+GT +L     LVLDEADRMLDMGF   + +II++   DRQT+M+SAT  K+
Sbjct: 127 GRLLDHIERGTIDLGDVEILVLDEADRMLDMGFIDDVEEIIDECPSDRQTMMFSATVSKD 186

Query: 437 VKKLAEDYLGD 469
           ++ L+  Y+ +
Sbjct: 187 IQYLSSKYMNN 197



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 35/84 (41%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+    I        I +G+G  ALVL PTRELA+Q+Q    +F     +R   
Sbjct: 49  GSGKTLAFGCGII------QKIEKGNGIRALVLTPTRELAEQVQNSLKEFSRHKQLRVAP 102

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q R LER  ++V+AT
Sbjct: 103 IYGGVAINPQIRQLER-ADVVVAT 125


>UniRef50_Q88NB7 Cluster: ATP-dependent RNA helicase rhlB; n=18;
           Proteobacteria|Rep: ATP-dependent RNA helicase rhlB -
           Pseudomonas putida (strain KT2440)
          Length = 398

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 37/70 (52%), Positives = 51/70 (72%), Gaps = 2/70 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP--DRQTLMWSATWP 430
           GRL+DF ++G  +L     +VLDEADRMLDMGF PQ+R+II Q  P  +RQTL++SAT+ 
Sbjct: 144 GRLLDFNQRGEVHLDMVEVMVLDEADRMLDMGFIPQVRQIIRQTPPKSERQTLLFSATFT 203

Query: 431 KEVKKLAEDY 460
            +V  LA+ +
Sbjct: 204 DDVMNLAKQW 213



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR-RGDG-PIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G+GKT A+++  I  +   PP + R  G P AL++APTREL  QI + AA     + +  
Sbjct: 56  GTGKTAAFLISIISQLQQTPPPKERYMGEPRALIIAPTRELVVQIAKDAAALTKYTGLNV 115

Query: 177 TCVFGGAPKREQARDLE-RGVEIVIAT 254
               GG    +Q + LE R  +I++AT
Sbjct: 116 MSFVGGMDFDKQLKALEARHCDILVAT 142


>UniRef50_Q87HW1 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=6; Vibrio|Rep: ATP-dependent RNA helicase,
           DEAD box family - Vibrio parahaemolyticus
          Length = 421

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 36/98 (36%), Positives = 59/98 (60%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDR 400
           L EG+       GRL+D L  G  N+ +   LVLDEADRMLDMGF P +++I+ ++  D+
Sbjct: 124 LEEGADILIATPGRLLDHLFNGNVNISKTGVLVLDEADRMLDMGFWPDLQRILRRLPNDK 183

Query: 401 QTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSAIT 514
           Q +++SAT+ K +K +A   +   +++ +     +A T
Sbjct: 184 QIMLFSATFEKRIKTIAYKLMDSPVEVEVSPANTTAET 221



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 34/84 (40%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP I  +  +   +R   P AL+L PTRELAQQ+      +   + +R  C
Sbjct: 54  GTGKTAAFGLPIIQAVQQK---KRNGTPHALILVPTRELAQQVFDNLTQYAEHTDLRIVC 110

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG     Q   LE G +I+IAT
Sbjct: 111 VYGGTSIGVQKNKLEEGADILIAT 134


>UniRef50_Q4AEL1 Cluster: Helicase, C-terminal:DEAD/DEAH box
           helicase, N-terminal; n=1; Chlorobium phaeobacteroides
           BS1|Rep: Helicase, C-terminal:DEAD/DEAH box helicase,
           N-terminal - Chlorobium phaeobacteroides BS1
          Length = 356

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L +G  +L    YLVLDEAD M++MGF+ +I +I++  +P    L+++AT PK+
Sbjct: 29  GRLIDLLNRGVLSLDDLKYLVLDEADEMINMGFKAEIDEILKSCKPAITKLLFTATMPKD 88

Query: 437 VKKLAEDYL-GDYIQINIGSLQL 502
           VK L E+YL  D  +I I   +L
Sbjct: 89  VKLLIEEYLVADASEIRINKEEL 111


>UniRef50_Q6T442 Cluster: Hel61; n=4; Leishmania|Rep: Hel61 -
           Leishmania major
          Length = 544

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/73 (46%), Positives = 50/73 (68%), Gaps = 2/73 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL DFL+ G  +++  ++LV DEADR+LDMGF+  + +I+  +      QT+MWSATWP
Sbjct: 220 GRLKDFLDGGDVSIRNLSFLVFDEADRLLDMGFQVHLDEIMAYLDSASHPQTMMWSATWP 279

Query: 431 KEVKKLAEDYLGD 469
           + V+ +A  YL D
Sbjct: 280 ESVQAMARKYLSD 292



 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-PIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKT+A+ +PA+  +   P     DG P  LVLAPTREL QQ  +V  + G    VR  
Sbjct: 140 GSGKTVAFAVPALAGLKPNP-----DGTPSVLVLAPTRELVQQTTKVFQNLG-CGQVRVC 193

Query: 180 CVFGGAPKREQARDLERGVEIVIA 251
             +GGAP+  QAR L  G + ++A
Sbjct: 194 EAYGGAPRDLQARHLRNGCDALVA 217


>UniRef50_Q6FML5 Cluster: Pre-mRNA-processing ATP-dependent RNA
           helicase PRP5; n=1; Candida glabrata|Rep:
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 816

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 3/82 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ---RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GR ID L     NL    R +++V+DEADR+ D GFEPQI  ++  +RPDRQ +++SAT+
Sbjct: 385 GRFIDLLSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATF 444

Query: 428 PKEVKKLAEDYLGDYIQINIGS 493
           P +V   A  +L   +QI + +
Sbjct: 445 PSKVSNFASRFLDSPLQITVNA 466



 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 38/85 (44%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKT++Y+LP I H+  Q  +R G+ GPIA++ APTRELA QI +          + + 
Sbjct: 299 GSGKTISYLLPMIRHVKAQKKLRNGETGPIAVIFAPTRELAVQINEEVQKLISDLDISSI 358

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C  GG+  ++Q   L+ GVEI IAT
Sbjct: 359 CCTGGSDLKKQIDKLKTGVEIAIAT 383


>UniRef50_Q7UNV7 Cluster: ATP-dependent RNA helicase; n=2;
           Planctomycetaceae|Rep: ATP-dependent RNA helicase -
           Rhodopirellula baltica
          Length = 452

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/76 (47%), Positives = 52/76 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L++GT        +VLDEADRMLD+GF PQI +I+ +   +RQTL+ SAT P  
Sbjct: 173 GRVHDHLQRGTLRTNNVWCVVLDEADRMLDIGFRPQIERIMRKCPRNRQTLLLSATLPPV 232

Query: 437 VKKLAEDYLGDYIQIN 484
           V++LAE Y+ + + I+
Sbjct: 233 VRRLAESYMHEPVVID 248



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  +++    R    P A+V+ PTRELA Q+   A             
Sbjct: 91  GTGKTAAFSIPILEQLDSLEDCR---DPQAIVIVPTRELADQVAAEAERLARGVPTEIAV 147

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q R LE G ++V+ T
Sbjct: 148 LSGGKNMNRQLRQLENGTQLVVGT 171


>UniRef50_A6QC93 Cluster: ATP-independent RNA helicase DbpA; n=1;
           Sulfurovum sp. NBC37-1|Rep: ATP-independent RNA helicase
           DbpA - Sulfurovum sp. (strain NBC37-1)
          Length = 453

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 38/81 (46%), Positives = 54/81 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D L KGT  L+    LVLDEADRMLDMGF  +I KI   +   +QTL++SAT+P +
Sbjct: 131 GRIQDHLAKGTLTLESIKTLVLDEADRMLDMGFYEEIIKIGSNMPKQKQTLLFSATFPPK 190

Query: 437 VKKLAEDYLGDYIQINIGSLQ 499
           ++ LA+  L D + I + ++Q
Sbjct: 191 IESLAKALLKDPLTIKVDTVQ 211



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/85 (34%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI-QQVAADFGHTSYVRNT 179
           GSGKTLA+ +PA++  +      + + P  +V+ PTRELA+Q+  ++     + + ++  
Sbjct: 50  GSGKTLAFGIPAVMGTDV-----KSNKPQTIVITPTRELAEQVAMELRKIAAYKANLKIL 104

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            ++GG P R QA  L +G  I+I T
Sbjct: 105 TLYGGVPLRAQADSLAKGAHILIGT 129


>UniRef50_A6DIU5 Cluster: Probable ATP dependent RNA helicase; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Probable ATP
           dependent RNA helicase - Lentisphaera araneosa HTCC2155
          Length = 537

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/79 (46%), Positives = 48/79 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR I F+E G   L    YLVLDEAD ML+MGF   + K+++    DR  LM+SAT P  
Sbjct: 130 GRCIHFIEDGKLELDSLEYLVLDEADEMLNMGFVEDVEKVLKASPDDRTVLMFSATMPPR 189

Query: 437 VKKLAEDYLGDYIQINIGS 493
           +KK+AE Y+ + I I   S
Sbjct: 190 LKKIAESYMHNSITIKAKS 208



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/84 (39%), Positives = 52/84 (61%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  I  +P +++   P AL+L PTRELA Q+ +    F     +    
Sbjct: 50  GTGKTAAFGLPIVQKI--EPGLKK---PQALILCPTRELAIQVNEEIKSFCKGRGITTVT 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAP  +Q R L++GV++V+AT
Sbjct: 105 LYGGAPIMDQKRALKKGVDLVVAT 128


>UniRef50_A4EAF2 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 749

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 37/86 (43%), Positives = 53/86 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E+G  +L     LVLDEADRMLDMGF P +R+I+ +   +RQTL++SAT  +E
Sbjct: 197 GRLVDLIEQGACHLDEVKVLVLDEADRMLDMGFLPAVRRIVRETPAERQTLLFSATLDEE 256

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
                 D + D  ++ I     +A T
Sbjct: 257 AVGEITDLVSDPARVEIAPATSTADT 282



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 20/104 (19%)
 Frame = +3

Query: 3   GSGKTLAYILPA---IVHINNQPPIRR----------------GDGPIALVLAPTRELAQ 125
           G+GKT A++LP    + HI    P+R                 G GP+ LV+ PTRELAQ
Sbjct: 93  GTGKTAAFLLPTMNNLEHIAPPKPVRERGGRNRRRGAKKPEGNGRGPVMLVITPTRELAQ 152

Query: 126 QIQQVAADFGH-TSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           QI +VA      T +V  T V GG   + Q   L+ G +I++AT
Sbjct: 153 QIDEVAGKIADVTGHVAVT-VVGGVSYKPQTAALKYGCDILVAT 195


>UniRef50_Q7QTB0 Cluster: GLP_15_15676_17025; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_15_15676_17025 - Giardia lamblia
           ATCC 50803
          Length = 449

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 43/97 (44%), Positives = 63/97 (64%), Gaps = 7/97 (7%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-------RPDRQTLMW 415
           GRL DFLE+   +L+    +VLDEAD+MLDMGFEPQIR ++ +          +RQTLM+
Sbjct: 106 GRLKDFLERRCLSLKYVRVMVLDEADKMLDMGFEPQIRDLVYKFDMPGNGPNGNRQTLMF 165

Query: 416 SATWPKEVKKLAEDYLGDYIQINIGSLQLSAITTFFK 526
           SAT+   V+ +A+ YL +  +I++G  Q+ + TT  K
Sbjct: 166 SATFGTGVQAMAKRYLHNEARIHVG--QIGSTTTMIK 200



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 11/95 (11%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN---QPPIRRGDG--------PIALVLAPTRELAQQIQQVAAD 149
           GSGKT +++ P I  + +   +  I   D         P+A++L+PTREL QQI  +   
Sbjct: 10  GSGKTFSFLSPIIAQLISSRAKDAISDDDKNMEQSMSFPLAVILSPTRELTQQIAFMCYQ 69

Query: 150 FGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
               + +    V+GG   REQ   L++G +IVIAT
Sbjct: 70  LTFKTNLIVRLVYGGEGAREQRGLLKKGCDIVIAT 104


>UniRef50_A7SE71 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 411

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII---EQIR 391
           L EG+       GRL+D  ++G   L + TYLV+DEADRML MG E Q+RKI+       
Sbjct: 160 LREGADVVVATPGRLLDLCKRGALCLDKITYLVMDEADRMLGMGMEEQLRKIVGLATGTS 219

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             RQTL+WSAT P+ +++LA   + + I I +G
Sbjct: 220 RARQTLLWSATLPESLERLARSAVLNPITIQVG 252



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 34/84 (40%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLAY LP  + +  + P   GD P+AL+L PTREL QQ+    ++           
Sbjct: 87  GSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQVFMNVSEMLDVIRCPGNP 146

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG P   Q   L  G ++V+AT
Sbjct: 147 VCGGVPVSTQTIALREGADVVVAT 170


>UniRef50_Q9W3Y5 Cluster: Putative ATP-dependent RNA helicase
           CG14443; n=1; Drosophila melanogaster|Rep: Putative
           ATP-dependent RNA helicase CG14443 - Drosophila
           melanogaster (Fruit fly)
          Length = 438

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 32/83 (38%), Positives = 53/83 (63%), Gaps = 2/83 (2%)
 Frame = +2

Query: 254 SGRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           +GRL+  ++  K    L+RCTYLVLD  DRM+D+G E  I +++ ++RP  Q ++ S +W
Sbjct: 159 AGRLLQMIDNKKHVVELERCTYLVLDNIDRMIDVGLEGNICRLLCRLRPHAQLIVSSTSW 218

Query: 428 PKEVKKLAEDYLGDYIQINIGSL 496
              +K++A  +LG Y  I +G +
Sbjct: 219 SSNLKRMANKFLGQYTAIRVGEI 241



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL Y+LP I+ ++NQ  + +   GPI L+L   RE A  +Q+    + +   +R  
Sbjct: 79  GTGKTLGYLLPGIMKMHNQRGLMQHKKGPIVLILVDCREAAVMVQREVLYYTNPLELRTH 138

Query: 180 CVFGGA 197
           C+ G +
Sbjct: 139 CLLGNS 144


>UniRef50_Q8D7D0 Cluster: Superfamily II DNA and RNA helicase; n=20;
           Gammaproteobacteria|Rep: Superfamily II DNA and RNA
           helicase - Vibrio vulnificus
          Length = 418

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/86 (43%), Positives = 58/86 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L    T+L +   LVLDEADRMLDMGF P I++I++++  +RQTL++SAT+   
Sbjct: 136 GRLLDHLFTKKTSLNQLQMLVLDEADRMLDMGFLPDIQRIMKRMPEERQTLLFSATFETR 195

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
           VK LA   + + +++ + +   +A T
Sbjct: 196 VKALAYRLMKEPVEVQVAAANSTADT 221



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-PIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT AY LP I  ++ Q         P AL+LAPTRELAQQ+      +   + +   
Sbjct: 50  GTGKTAAYGLPLIQMLSRQSREETAPKHPRALILAPTRELAQQVFDNLKQYAQHTELAIV 109

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GG   R Q   L +GV+I+IAT
Sbjct: 110 TVYGGTSIRVQQEQLAKGVDILIAT 134


>UniRef50_Q89UH0 Cluster: Dead-box ATP-dependent RNA helicase; n=23;
           Alphaproteobacteria|Rep: Dead-box ATP-dependent RNA
           helicase - Bradyrhizobium japonicum
          Length = 530

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/84 (44%), Positives = 54/84 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D ++     L    +LVLDEADRMLDMGF   IRKI+ ++   RQTL +SAT PK+
Sbjct: 148 GRLLDLVQSNGLKLGSVEFLVLDEADRMLDMGFINDIRKIVAKLPIKRQTLFFSATMPKD 207

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           + +LA+  L D  ++ +  +  +A
Sbjct: 208 IAELADSMLRDPARVAVTPVSSTA 231



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 29/84 (34%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT ++ LP +  +       +      LVL+PTREL+ QI      +G    + +T 
Sbjct: 63  GTGKTASFALPILHRLLEHRIKPQPKTTRVLVLSPTRELSGQILDSFNAYGRHIRLSSTL 122

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG P   Q R L +GVE+++AT
Sbjct: 123 AIGGVPMGRQVRSLMQGVEVLVAT 146


>UniRef50_A3ZWP8 Cluster: ATP-dependent RNA helicase; n=1;
           Blastopirellula marina DSM 3645|Rep: ATP-dependent RNA
           helicase - Blastopirellula marina DSM 3645
          Length = 428

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 36/86 (41%), Positives = 55/86 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID + +    L+    +VLDEADRMLD+GF P I KI+ +   +RQTL+ SAT P  
Sbjct: 133 GRVIDLMTRRALQLEMLRTVVLDEADRMLDIGFRPDIEKILRRCPEERQTLLLSATVPPT 192

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
           ++KLA+ Y+ +  +++     +SA T
Sbjct: 193 IEKLAQRYMRNPEKVDFSPTNISAET 218



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P I  + + P  R    P AL+L PTRELA Q++   A   H   +    
Sbjct: 51  GTGKTAAFGIPIIERLEHGPNSRN---PQALILTPTRELAVQVRDEIAKLTHGQRINVVA 107

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG P R Q   L+R   IV+ T
Sbjct: 108 VYGGKPLRSQMEKLKRAPHIVVGT 131


>UniRef50_A0VLH7 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Rhodobacteraceae|Rep: DEAD/DEAH box helicase domain
           protein - Dinoroseobacter shibae DFL 12
          Length = 508

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 34/77 (44%), Positives = 53/77 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L++    L    +LVLDEAD+MLD+GF   +RKI   +  +RQT+++SAT PK+
Sbjct: 203 GRLIDLLDRKALRLSETRFLVLDEADQMLDLGFIHALRKIAPLLPAERQTMLFSATMPKQ 262

Query: 437 VKKLAEDYLGDYIQINI 487
           +++L+  YL D  ++ +
Sbjct: 263 MEELSRAYLTDPARVEV 279



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILP---AIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKT A+ LP   A++    +P  R   G   L+LAPTREL  QI +    F   S+++
Sbjct: 118 GTGKTAAFGLPLLDALMKAGTKPAPRTCRG---LILAPTRELVSQICESLRAFTEGSHLK 174

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              + GG     Q +  ERG ++++AT
Sbjct: 175 LQVIVGGVAIGPQIKRAERGADLIVAT 201


>UniRef50_Q9HXE5 Cluster: ATP-dependent RNA helicase rhlB; n=22;
           Gammaproteobacteria|Rep: ATP-dependent RNA helicase rhlB
           - Pseudomonas aeruginosa
          Length = 397

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/73 (50%), Positives = 52/73 (71%), Gaps = 2/73 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRL+DF ++G  +L     +VLDEADRMLDMGF PQ+R+II Q   + +RQTL++SAT+ 
Sbjct: 144 GRLLDFNQRGEVHLDMVEVMVLDEADRMLDMGFIPQVRQIIRQTPHKGERQTLLFSATFT 203

Query: 431 KEVKKLAEDYLGD 469
            +V  LA+ +  D
Sbjct: 204 DDVMNLAKQWTVD 216



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIRRGDG-PIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G+GKT A+++  I  +    PP  R  G P AL++APTREL  QI + AA     + +  
Sbjct: 56  GTGKTAAFLISIITQLLQTPPPKERYMGEPRALIIAPTRELVVQIAKDAAALTKYTGLNV 115

Query: 177 TCVFGGAPKREQARDLE-RGVEIVIAT 254
               GG    +Q + LE R  +I++AT
Sbjct: 116 MTFVGGMDFDKQLKQLEARFCDILVAT 142


>UniRef50_P21693 Cluster: ATP-independent RNA helicase dbpA; n=195;
           cellular organisms|Rep: ATP-independent RNA helicase
           dbpA - Escherichia coli (strain K12)
          Length = 457

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/79 (46%), Positives = 49/79 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L+KGT +L     LV+DEADRMLDMGF   I  +I      RQTL++SATWP+ 
Sbjct: 131 GRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRFAPASRQTLLFSATWPEA 190

Query: 437 VKKLAEDYLGDYIQINIGS 493
           +  ++     D + I I S
Sbjct: 191 IAAISGRVQRDPLAIEIDS 209



 Score = 32.7 bits (71), Expect = 8.5
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQ---QVAADFGHTSYVR 173
           GSGKT A+ L  +  I+      +     ALVL PTRELA Q+    +  A F   + + 
Sbjct: 50  GSGKTAAFGLGLLQQIDASLFQTQ-----ALVLCPTRELADQVAGELRRLARFLPNTKIL 104

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
             C  GG P   Q   L+    I++AT
Sbjct: 105 TLC--GGQPFGMQRDSLQHAPHIIVAT 129


>UniRef50_Q44NG9 Cluster: Helicase, C-terminal:DEAD/DEAH box
           helicase, N-terminal; n=9; Bacteroidetes/Chlorobi
           group|Rep: Helicase, C-terminal:DEAD/DEAH box helicase,
           N-terminal - Chlorobium limicola DSM 245
          Length = 499

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 33/77 (42%), Positives = 53/77 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D + +G  +L+   + VLDEADRMLDMGF   IRKI+ ++   +Q+L +SAT P E
Sbjct: 214 GRLLDLMNQGHLHLRNIEFFVLDEADRMLDMGFIHDIRKILAELPKKKQSLFFSATMPPE 273

Query: 437 VKKLAEDYLGDYIQINI 487
           + +LA   L + +++++
Sbjct: 274 ITRLAASILHNPVEVSV 290



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  +N      +     +L++ PTRELA QI +    +G  + + +T 
Sbjct: 129 GTGKTAAFAIPVLQLLNAVKTNEKKRKIRSLIITPTRELAIQIGESFKAYGRHTGLTSTV 188

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGG  +  Q   L++G++I+IAT
Sbjct: 189 IFGGVNQNPQTASLQKGIDILIAT 212


>UniRef50_Q54DV7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 777

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 38/82 (46%), Positives = 57/82 (69%), Gaps = 3/82 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTN---LQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL+D +++       L     L+LDEADRML +GF  Q++KI EQIRPDRQTLM+SAT+
Sbjct: 446 GRLVDLIQRSKEVVGLLGGVGMLILDEADRMLQLGFGDQLQKISEQIRPDRQTLMFSATF 505

Query: 428 PKEVKKLAEDYLGDYIQINIGS 493
           P+ ++  A+ +L + ++I + S
Sbjct: 506 PQTMQDAAKKWLTNPLKIRVKS 527



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 36/109 (33%), Positives = 50/109 (45%), Gaps = 25/109 (22%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN---QPPIRRGD---------------------GPIALVLAPT 110
           GSGKTL Y+LPAI +I     Q  IRR                       GP+ L++ PT
Sbjct: 336 GSGKTLGYLLPAIPNILEHLRQRKIRRQQMTMQEKLENKKKSKLLKNTNMGPMVLIIVPT 395

Query: 111 RELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDL-ERGVEIVIAT 254
           RELA+Q++           + +  ++GG    EQ   L +   EI+IAT
Sbjct: 396 RELAKQVESSCKPLRSKFNIHSIAIYGGVDANEQKDILGQEHNEIIIAT 444


>UniRef50_A4FZ46 Cluster: DEAD/DEAH box helicase domain protein;
           n=4; Euryarchaeota|Rep: DEAD/DEAH box helicase domain
           protein - Methanococcus maripaludis
          Length = 541

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 32/87 (36%), Positives = 57/87 (65%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D + + T  L+  +Y+VLDEAD ML+MGF   + +I++ +  +++ L++SAT P  
Sbjct: 130 GRILDHISRRTIKLENVSYVVLDEADEMLNMGFIDDVEEILKSVSTEKRMLLFSATLPDS 189

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           + KLA++Y+ +Y  I +   QL+   T
Sbjct: 190 IMKLAKNYMREYDIIKVKRQQLTTTLT 216



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P +  I+      +     AL+LAPTRELA Q+ +       +  +    
Sbjct: 50  GTGKTAAFGIPILETIDESSRNTQ-----ALILAPTRELAIQVAEEIDSIKGSKRLNVFP 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG     Q R+L RGV+IV+ T
Sbjct: 105 VYGGQSIDRQIRELRRGVQIVVGT 128


>UniRef50_Q480Z7 Cluster: ATP-dependent RNA helicase, DEAD box
           family; n=2; Alteromonadales|Rep: ATP-dependent RNA
           helicase, DEAD box family - Colwellia psychrerythraea
           (strain 34H / ATCC BAA-681) (Vibriopsychroerythus)
          Length = 399

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 37/77 (48%), Positives = 49/77 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E G  N +     VLDEAD MLDMGF   ++ II ++   RQTL++SAT P E
Sbjct: 134 GRLLDLIETGDINFKALEVFVLDEADTMLDMGFFKDVQSIISKLPKSRQTLLFSATMPAE 193

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ LAE  L D  +I I
Sbjct: 194 IEILAEAILTDPTKIQI 210



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP I          +     +L+L PTRELA QI Q   D+     ++   
Sbjct: 49  GTGKTAAFSLPIINKFGRNKIDIKAKSTRSLILTPTRELASQIMQNIDDYSDGLGLKTKV 108

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG  ++ Q   +E G++I++AT
Sbjct: 109 VYGGVGRQAQVDSIELGLDILVAT 132


>UniRef50_A3WD13 Cluster: DNA and RNA helicase; n=2;
           Alphaproteobacteria|Rep: DNA and RNA helicase -
           Erythrobacter sp. NAP1
          Length = 484

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 33/77 (42%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++   NL     LVLDEAD+MLD+GF   +R+I + +  +RQTL +SAT PK 
Sbjct: 134 GRLLDLIDQKAFNLGSVEVLVLDEADQMLDLGFVHALRRISQLVPKERQTLFFSATMPKA 193

Query: 437 VKKLAEDYLGDYIQINI 487
           +K+L   Y  + +Q+++
Sbjct: 194 IKELVSGYCNNPVQVSV 210



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 44/84 (52%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A++LP+I  +              LVLAPTREL  QI   A D+G  + ++   
Sbjct: 49  GTGKTAAFMLPSIDRLREADNRIPFKSCRMLVLAPTRELVSQIAASAKDYGALAGLKVQS 108

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +    L RG +I+IAT
Sbjct: 109 IVGGTSVNKDRNKLHRGTDILIAT 132


>UniRef50_A1KUM8 Cluster: Putative ATP-dependent RNA helicase; n=4;
           Neisseria|Rep: Putative ATP-dependent RNA helicase -
           Neisseria meningitidis serogroup C / serotype 2a (strain
           ATCC 700532 /FAM18)
          Length = 483

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 33/69 (47%), Positives = 51/69 (73%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++   +L +   +VLDEADRMLDMGF   IRKI++ +   RQTL++SAT+   
Sbjct: 164 GRLLDHVKQKNISLNKVEIVVLDEADRMLDMGFIDDIRKIMQMLPKQRQTLLFSATFSAP 223

Query: 437 VKKLAEDYL 463
           ++KLA+D++
Sbjct: 224 IRKLAQDFM 232



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG--PIA-LVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKT A++LP++  +             P+  LVL PTRELA QI Q    +     +R
Sbjct: 76  GTGKTAAFMLPSLERLKRYATASTSPAMHPVRMLVLTPTRELADQIDQNVQSYIKNLPLR 135

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           +T +FGG    +Q  DL  G EIV+AT
Sbjct: 136 HTVLFGGMNMDKQTADLRAGCEIVVAT 162


>UniRef50_A2ZD51 Cluster: Putative uncharacterized protein; n=7;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 370

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 30/48 (62%), Positives = 38/48 (79%)
 Frame = +2

Query: 347 MGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           MGFEPQ+ KII +   +R TLMWSATWP+EV+ LA +Y+ DYIQ+ IG
Sbjct: 1   MGFEPQLNKIIPKTHKNRHTLMWSATWPREVRSLANNYMKDYIQVTIG 48


>UniRef50_Q1DMX8 Cluster: Pre-mRNA-splicing ATP-dependent RNA
           helicase PRP28; n=16; Pezizomycotina|Rep:
           Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 -
           Coccidioides immitis
          Length = 817

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 40/89 (44%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI-----RRGDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A++LP +V+I   P +     R+ DGP A++LAPTRELAQQI+  A  F +   
Sbjct: 424 GSGKTAAFLLPLLVYIAELPRLDEFEWRKSDGPYAIILAPTRELAQQIENEARKFCNPLG 483

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
                + GG    EQ+  L  G EI+IAT
Sbjct: 484 FNVVSIVGGHSLEEQSFSLRNGAEIIIAT 512



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 25/105 (23%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-----RPD-------- 397
           GRL+D +E+    L +C Y+++DEADRM+D+GFE  + KI++ +     +PD        
Sbjct: 514 GRLVDCIERRILVLSQCCYVIMDEADRMIDLGFEEPVNKILDALPVSNEKPDTEEAEDAR 573

Query: 398 ------------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                       RQT+M++AT P  V+++A  YL     + IG++
Sbjct: 574 AMSQHLGGKDRYRQTMMYTATMPSAVERIARKYLRRPAIVTIGNI 618


>UniRef50_Q5QWG1 Cluster: ATP-dependent RNA helicase; n=1;
           Idiomarina loihiensis|Rep: ATP-dependent RNA helicase -
           Idiomarina loihiensis
          Length = 474

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 34/66 (51%), Positives = 47/66 (71%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D LE+   +L   T LVLDEADRML+MGF+  +  I++ I   RQTL++SAT+PK 
Sbjct: 149 GRVLDHLEQRNVDLSMLTTLVLDEADRMLEMGFQDSLNAIVKHIPKTRQTLLFSATYPKN 208

Query: 437 VKKLAE 454
           +  LAE
Sbjct: 209 IAALAE 214



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY-VRNT 179
           GSGKT A+ L  +  +       +   P ALVL PTRELA Q+         +   ++  
Sbjct: 68  GSGKTTAFALTLLAKLE-----AKSFSPQALVLCPTRELAHQVADEVRKLAKSMLNIKIL 122

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG P R Q   LE G  +++ T
Sbjct: 123 TLCGGEPSRIQTNSLEHGAHVLVGT 147


>UniRef50_Q2BMZ1 Cluster: ATP-dependent RNA helicase; n=1;
           Neptuniibacter caesariensis|Rep: ATP-dependent RNA
           helicase - Neptuniibacter caesariensis
          Length = 417

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 34/77 (44%), Positives = 55/77 (71%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D + K   +L+    LVLDEADRMLD+GF  ++  I++Q   + QTL++SAT+P +
Sbjct: 134 GRLLDLMRKNALDLRGLKALVLDEADRMLDLGFADELDDILDQTPGNVQTLLFSATFPDK 193

Query: 437 VKKLAEDYLGDYIQINI 487
           VK+L E+ L + ++I++
Sbjct: 194 VKELTEELLRNPVEISV 210



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 31/86 (36%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS--YVRN 176
           GSGKT  ++LP +  +++ P     +   ALVL PTRELA Q+ Q    +       +R+
Sbjct: 48  GSGKTAGFVLPLLEKLHSIPA-PGNNLTHALVLVPTRELAVQVSQSVDRYSENCPRKIRS 106

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             ++GGA    Q + L +G +IV+AT
Sbjct: 107 VAIYGGAAINPQMQSLSKGCDIVVAT 132


>UniRef50_Q12B10 Cluster: DEAD/DEAH box helicase-like; n=13;
           Proteobacteria|Rep: DEAD/DEAH box helicase-like -
           Polaromonas sp. (strain JS666 / ATCC BAA-500)
          Length = 422

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 34/77 (44%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D LE     +   + LVLDEADR+LD+GF  ++ +I+E + P RQ L +SAT+P  
Sbjct: 138 GRLLDLLEHNALKISEVSTLVLDEADRLLDLGFGEELGRILELLPPRRQNLFFSATFPPA 197

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ LAE  L D ++I +
Sbjct: 198 IEVLAESMLHDPLRIEV 214



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH--TSYVRN 176
           GSGKT A+ LP +  + N P          L+L PTRELA Q+ +  A F       V+ 
Sbjct: 52  GSGKTAAFALPMLQQLANAPT-GTPRPTRGLILVPTRELAAQVGEAIAGFAKYLPQRVKV 110

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             VFGG     Q  +L  G +IV+AT
Sbjct: 111 AVVFGGVSINPQMMNLRGGADIVVAT 136


>UniRef50_A6DHU9 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Lentisphaera araneosa HTCC2155|Rep: DEAD/DEAH box
           helicase-like protein - Lentisphaera araneosa HTCC2155
          Length = 412

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/83 (37%), Positives = 57/83 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+I+ +  G   L     L+LDEAD+MLD+GF  ++++++E +   RQ L++SAT P++
Sbjct: 135 GRIIELINLGEVRLVELEMLILDEADKMLDLGFADELKELLEALPKKRQNLLFSATLPQK 194

Query: 437 VKKLAEDYLGDYIQINIGSLQLS 505
           V++LAE++L   +++ I   Q++
Sbjct: 195 VQQLAEEFLNAAVELRISRDQIT 217



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY--VRN 176
           G+GKTLA+  P I  IN  PP ++    + LVL PTRELA Q+++   ++   S   ++ 
Sbjct: 48  GTGKTLAFSFPLIERINTLPPKKKKISILGLVLVPTRELALQVEKAFTNYAEFSLRPIKT 107

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG     Q R L  G++++IAT
Sbjct: 108 ATLIGGENIDGQIRKLRMGLDVLIAT 133


>UniRef50_A4M6V6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; cellular organisms|Rep: DEAD/DEAH box helicase
           domain protein - Petrotoga mobilis SJ95
          Length = 530

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/72 (43%), Positives = 49/72 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID L +GT ++ +  YLV+DEAD MLDMGF   +  I+ +   ++Q LM+SAT P+ 
Sbjct: 130 GRIIDHLNRGTLDITKIKYLVIDEADEMLDMGFIEDVEMILSKTNKEKQILMFSATMPQR 189

Query: 437 VKKLAEDYLGDY 472
           +  LA  ++G++
Sbjct: 190 IVTLARKHMGNF 201



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 28/84 (33%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +P I  ++      + +   ALVL PTRELA Q+            +    
Sbjct: 50  GTGKTAAFGIPLIERLDE-----KANDVQALVLTPTRELALQVCNEIDSLKGNKRLNLLP 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG     Q R L+R V++V+ T
Sbjct: 105 VYGGVSIGNQIRALKRRVDLVVGT 128


>UniRef50_A3ZXX1 Cluster: ATP-dependent RNA helicase; n=2;
           Planctomycetaceae|Rep: ATP-dependent RNA helicase -
           Blastopirellula marina DSM 3645
          Length = 447

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 32/77 (41%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++G  +L +    VLDEADRMLDMGF P ++ I+ ++   RQT+ ++AT P +
Sbjct: 128 GRLLDLMDQGYVDLSQAKTFVLDEADRMLDMGFMPALKTIVSKLPKQRQTIFFTATMPPK 187

Query: 437 VKKLAEDYLGDYIQINI 487
           V +LA   L + ++I +
Sbjct: 188 VAQLASGLLNNPVRIEV 204



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 35/84 (41%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  ++          P  LVL+PTRELA QI Q    +G     R T 
Sbjct: 43  GTGKTAAFALPILNQLDLDRSRADACAPQVLVLSPTRELAVQIAQSFNVYGRNVKFRLTT 102

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           +FGG  +  Q R L+RGV + IAT
Sbjct: 103 IFGGVGQNPQVRALKRGVHVAIAT 126


>UniRef50_Q8I0W7 Cluster: Snrnp protein, putative; n=6;
            Plasmodium|Rep: Snrnp protein, putative - Plasmodium
            falciparum (isolate 3D7)
          Length = 1123

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 40/87 (45%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINNQPPIR---RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
            GSGKT A++LP + ++   PP+      DGP ALV+AP+RELA QI +    F      R
Sbjct: 745  GSGKTAAFVLPMLSYVKQLPPLTYETSQDGPYALVIAPSRELAIQIYEETNKFASYCSCR 804

Query: 174  NTCVFGGAPKREQARDLERGVEIVIAT 254
               V GG     QA +L RGVEIVI T
Sbjct: 805  TVAVVGGRNAEAQAFELRRGVEIVIGT 831



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/44 (56%), Positives = 33/44 (75%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           GRL D LEK  T L +C Y++LDEADRM+DMGFE  +  I+++I
Sbjct: 833 GRLQDCLEKAYTVLNQCNYVILDEADRMMDMGFEDTVHYILDKI 876


>UniRef50_Q7R3F3 Cluster: GLP_158_79919_77949; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_158_79919_77949 - Giardia lamblia
           ATCC 50803
          Length = 656

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 40/99 (40%), Positives = 59/99 (59%), Gaps = 19/99 (19%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRP-------------- 394
           GRL+DF+++G        ++V DE DRMLDMGFEPQIR I+ ++ P              
Sbjct: 279 GRLLDFIKQGVVETTYVRFVVFDECDRMLDMGFEPQIRDILHELPPIHHSVQDPSNPDIT 338

Query: 395 ---DRQTLMWSATWPKEVKKLAEDYLGD--YIQINIGSL 496
              +RQTL++SAT+PKE+K LA ++L     + I +G +
Sbjct: 339 HQIERQTLLFSATFPKEIKNLAMEFLRQDRLVSITVGQI 377



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +3

Query: 84  PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           P  ++++PTREL QQ  + +    + + +     +GG P   Q   L+ G +I++AT
Sbjct: 221 PFCIIMSPTRELVQQTAKASWMLSYGTSILTRVAYGGDPSGPQRDALQMGCDILVAT 277


>UniRef50_Q92GV2 Cluster: ATP-dependent RNA helicase RhlE; n=10;
           Rickettsia|Rep: ATP-dependent RNA helicase RhlE -
           Rickettsia conorii
          Length = 414

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 34/84 (40%), Positives = 54/84 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID L +G+  + R    VLDE DRMLDMG + Q+ +I + +   RQ LM+SAT PK 
Sbjct: 128 GRIIDHLNRGSLKIDRIGITVLDEMDRMLDMGMKEQLEEINKFLPEKRQVLMFSATMPKH 187

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           +  +++ YL + ++I +G+   +A
Sbjct: 188 IIAVSQKYLNNPVRITVGATNKAA 211



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 36/86 (41%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKTLAY+LP I   I N+          AL+L PTRELA QI         TSY  N+
Sbjct: 50  GSGKTLAYLLPLIDSFIKNKTT--------ALILVPTRELATQIHSTLNKV-TTSYKINS 100

Query: 180 CV-FGGAPKREQARDLERGVEIVIAT 254
            V  GG P  +Q   L++  +++I T
Sbjct: 101 AVLIGGEPMPKQFIQLKKNPKVIIGT 126


>UniRef50_Q6APU7 Cluster: Related to ATP-dependent RNA helicase;
           n=1; Desulfotalea psychrophila|Rep: Related to
           ATP-dependent RNA helicase - Desulfotalea psychrophila
          Length = 498

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 37/73 (50%), Positives = 47/73 (64%), Gaps = 2/73 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPDRQTLMWSATWP 430
           GRLIDF  K   N   C  LV+DEADRMLDMGF P +R+I+  +  + DRQTLM+SAT  
Sbjct: 228 GRLIDFHNKRLVNFDNCQTLVIDEADRMLDMGFIPDVRRIVSWMPKKRDRQTLMFSATIS 287

Query: 431 KEVKKLAEDYLGD 469
            +V  L+  +  D
Sbjct: 288 SDVNNLSAQWCVD 300



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-PIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT  +++  +  +        G   P AL+LAPTREL  QI + A   G  + V   
Sbjct: 141 GTGKTAVFLVGVMARLLADKKGGLGKRTPRALILAPTRELVMQIVKDAKKLGRYTGVNAD 200

Query: 180 CVFGGAPKREQARDLERG-VEIVIAT 254
            V+GGA   +Q   L+RG  +IV+AT
Sbjct: 201 AVYGGAEYEKQMELLKRGKTDIVVAT 226


>UniRef50_Q3AX69 Cluster: DEAD/DEAH box helicase-like; n=15;
           Cyanobacteria|Rep: DEAD/DEAH box helicase-like -
           Synechococcus sp. (strain CC9902)
          Length = 624

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 33/77 (42%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D + +GT +    T LVLDEAD ML MGF   +  I+EQ+  +RQ +++SAT P E
Sbjct: 199 GRVMDHMRQGTLDTSGLTSLVLDEADEMLRMGFIDDVEWILEQLPKERQVVLFSATMPPE 258

Query: 437 VKKLAEDYLGDYIQINI 487
           +++L++ YL D  ++ I
Sbjct: 259 IRRLSKRYLNDPAEVTI 275



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF--GHTSYVRN 176
           G+GKT A+ LP +  + +         P  LVLAPTRELA Q+      +  GH  +++ 
Sbjct: 118 GTGKTAAFALPLLERLESGQKT-----PQVLVLAPTRELAMQVADSFKAYAAGHP-HLKV 171

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V+GG   R Q   L RGV++V+ T
Sbjct: 172 LAVYGGTDFRSQISTLRRGVDVVVGT 197


>UniRef50_A0V009 Cluster: DEAD/DEAH box helicase-like; n=1;
           Clostridium cellulolyticum H10|Rep: DEAD/DEAH box
           helicase-like - Clostridium cellulolyticum H10
          Length = 542

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 35/91 (38%), Positives = 57/91 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +  GT + +   +LVLDEADRMLDMGF  Q+ +I++ +  +R TL++SAT P E
Sbjct: 130 GRVFDHISHGTLSTKNIRFLVLDEADRMLDMGFLDQVVRIVKTLPKERITLLFSATMPPE 189

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITTFFKL 529
           +  + + Y+ + + I I S Q   + T  ++
Sbjct: 190 IHNICKRYMNNPVTIEIES-QTKTVDTIHQV 219



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  + + +I+ + N        GP  L+L P RELA Q+             + T 
Sbjct: 50  GSGKTAVFGV-SILQLTNPEEA----GPQGLILTPARELAVQVDNDIRKMAKYLKHKTTA 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++G      + + L +GV IV  T
Sbjct: 105 IYGQHNINLETQILNKGVSIVTGT 128


>UniRef50_Q8L7S8 Cluster: DEAD-box ATP-dependent RNA helicase 3;
           n=13; Magnoliophyta|Rep: DEAD-box ATP-dependent RNA
           helicase 3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 748

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 35/77 (45%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +E  +  L    YLVLDEAD+ML +GFE  +  I+E +   RQ++++SAT P  
Sbjct: 237 GRIIDLIEGRSLKLGEVEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTW 296

Query: 437 VKKLAEDYLGDYIQINI 487
           VKKLA  YL + + I++
Sbjct: 297 VKKLARKYLDNPLNIDL 313



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP----PIRR-GDGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           G+GKTLA+ +P I  +  +       RR G  P  LVLAPTRELA+Q+++   +     Y
Sbjct: 149 GTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTRELAKQVEKEIKE--SAPY 206

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   CV+GG     Q   L RGV++V+ T
Sbjct: 207 LSTVCVYGGVSYTIQQSALTRGVDVVVGT 235


>UniRef50_Q89M45 Cluster: ATP-dependent RNA helicase; n=29; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Bradyrhizobium japonicum
          Length = 500

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 35/86 (40%), Positives = 54/86 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D  E+G   L     LV+DEADRMLDMGF P I +I + +   RQTL ++AT P E
Sbjct: 131 GRLLDHTERGGLLLTGVELLVIDEADRMLDMGFIPDIERICKLVPFTRQTLFFTATMPPE 190

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
           ++++ E +L +  ++ +     +A+T
Sbjct: 191 IRRITETFLHNPQKVEVSKPATTAVT 216



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A++LP +  +       R   P  L+L PTRELA Q+++    +G    +    
Sbjct: 48  GTGKTAAFVLPMLTILEKGRA--RARMPRTLILEPTRELAAQVKENFDRYGAGQKLNVAL 105

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q   L RGV+++IAT
Sbjct: 106 LIGGVSFGDQDAKLTRGVDVLIAT 129


>UniRef50_Q5FS73 Cluster: ATP-dependent RNA helicase; n=2;
           Gluconobacter oxydans|Rep: ATP-dependent RNA helicase -
           Gluconobacter oxydans (Gluconobacter suboxydans)
          Length = 432

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 34/77 (44%), Positives = 50/77 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E+G  +L +   LVLDEAD+MLDMGF   I +I+  +  DR T+++SAT PK 
Sbjct: 139 GRLLDLIEQGLCDLSQLETLVLDEADQMLDMGFAKPIERIVATLPEDRHTVLFSATMPKS 198

Query: 437 VKKLAEDYLGDYIQINI 487
           +  L E  L +  ++ I
Sbjct: 199 IAALVESLLRNPAKVEI 215



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/83 (39%), Positives = 45/83 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT ++ LP +  +   P     +G   LVLAPTREL  QI      F     VR T 
Sbjct: 54  GTGKTASFALPLLHRLAATPRPAPKNGARVLVLAPTRELVSQIADGFESFSRHQPVRVTT 113

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           +FGG  +  Q + LE GV+I++A
Sbjct: 114 IFGGVSQVHQVKALEEGVDIIVA 136


>UniRef50_Q3AZR1 Cluster: DEAD/DEAH box helicase-like; n=2;
           Synechococcus|Rep: DEAD/DEAH box helicase-like -
           Synechococcus sp. (strain CC9902)
          Length = 458

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 39/87 (44%), Positives = 53/87 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D + +          LVLDEADRMLDMGF   I+K+IE +  +RQ +M+SAT+   
Sbjct: 155 GRLLDLINQKMIRFDNLKVLVLDEADRMLDMGFIRDIKKVIEYLPKNRQNMMFSATFSTP 214

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           +KKLA   L D ++I   S+Q  A  T
Sbjct: 215 IKKLALGLLNDPVEIK-ASVQNQAAPT 240



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 34/84 (40%), Positives = 50/84 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ILP I  +  +   +R     +LVL PTRELA Q++  A  +     +R+  
Sbjct: 71  GTGKTAAFILPIIELLRAEDKPKRYQVH-SLVLTPTRELAAQVEASAKAYTKYLALRSDA 129

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGG   R Q + L+ GV+I++AT
Sbjct: 130 VFGGVSIRPQVKRLQGGVDILVAT 153


>UniRef50_A6GPV2 Cluster: Helicase; n=1; Limnobacter sp. MED105|Rep:
           Helicase - Limnobacter sp. MED105
          Length = 539

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 33/69 (47%), Positives = 51/69 (73%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++ + NL +   LVLDEADRMLDMGF P +++II  +   RQ L++SAT+  E
Sbjct: 155 GRLLDHVQQKSINLGQVQVLVLDEADRMLDMGFLPDLQRIINLLPKTRQNLLFSATFSPE 214

Query: 437 VKKLAEDYL 463
           ++KLA+ ++
Sbjct: 215 IQKLAKSFM 223



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 35/90 (38%), Positives = 49/90 (54%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-----NNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAADFGHTS 164
           G+GKT  + LP +  +      N  P R    P+ AL+L PTRELA Q+      +   +
Sbjct: 67  GTGKTAGFSLPILNRLMPLATENTSPARH---PVRALILTPTRELADQVAANVHTYAKFT 123

Query: 165 YVRNTCVFGGAPKREQARDLERGVEIVIAT 254
            +R+T V+GG     Q + L RGVE+VIAT
Sbjct: 124 PLRSTVVYGGVDINPQIQTLRRGVELVIAT 153


>UniRef50_Q015I7 Cluster: ATP-dependent RNA helicase; n=2;
           Ostreococcus|Rep: ATP-dependent RNA helicase -
           Ostreococcus tauri
          Length = 637

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 40/88 (45%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +2

Query: 230 GSRNSHCY-----SGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKI---IEQ 385
           G   SH +      GRL   LE G   L RC  LVLDEADRML +GFE Q+ KI   +  
Sbjct: 228 GQHTSHAFLVIGTPGRLNAVLESGALKLDRCKILVLDEADRMLALGFEEQLLKIRDALPN 287

Query: 386 IRPDRQTLMWSATWPKEVKKLAEDYLGD 469
               RQTL++SAT+PK V+ +++ +LG+
Sbjct: 288 ANDGRQTLLFSATFPKAVRTISKSWLGE 315



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 6/80 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAI------VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 164
           GSGKTL ++LPAI      +  N     +    P ALV+APTREL  QI  V        
Sbjct: 148 GSGKTLGFLLPAIEVALRDLRENPNAGKKYPGSPAALVVAPTRELTLQISTVCNKLKKAV 207

Query: 165 YVRNTCVFGGAPKREQARDL 224
            VR+  V+GG  + +Q   L
Sbjct: 208 PVRSVAVYGGVSQEDQEEAL 227


>UniRef50_Q4W7T7 Cluster: VASA RNA helicase; n=3; Daphniidae|Rep:
           VASA RNA helicase - Moina macrocopa
          Length = 843

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ--IRP--DRQTLMWSAT 424
           GRL DF++KG  +     + +LDEADRMLDMGF   I  I +   + P   R TLM+SAT
Sbjct: 545 GRLKDFVDKGFIDFSNVQFFILDEADRMLDMGFGSDIEFIAQHPTMTPVGRRVTLMFSAT 604

Query: 425 WPKEVKKLAEDYLGDYIQINIGSL 496
           +P +V+K+A  YL DY+ +  G++
Sbjct: 605 FPDDVQKIAGKYLHDYVFVTTGNI 628



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQ---PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+++P + + +  Q    P      P  ++++PTRELA QI + A  F H S +
Sbjct: 456 GSGKTAAFLVPVVNILLEKQVQGAPSGEVQKPEVVIISPTRELAIQIHREARKFSHNSVL 515

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           ++  V+GG     Q   L  G  I++ T
Sbjct: 516 KSVIVYGGTQVSHQKSSLMNGCNILVGT 543


>UniRef50_Q9Y7T7 Cluster: Pre-mRNA-splicing ATP-dependent RNA
           helicase prp28; n=1; Schizosaccharomyces pombe|Rep:
           Pre-mRNA-splicing ATP-dependent RNA helicase prp28 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 662

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 40/87 (45%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD---GPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A+I+P I+ I+  PP+   +   GP A+VLAPTRELAQQIQ     F      R
Sbjct: 296 GSGKTAAFIIPLIIAISKLPPLTESNMHLGPYAVVLAPTRELAQQIQVEGNKFAEPLGFR 355

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V GG    EQ+  + +G  IV+AT
Sbjct: 356 CVSVVGGHAFEEQSFQMSQGAHIVVAT 382



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 19/99 (19%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD------------- 397
           GRL+D LE+    L +CTY+V+DEADRMLDMGFE  + KI+  +                
Sbjct: 384 GRLLDCLERRLFVLSQCTYVVMDEADRMLDMGFEDDVNKILSSLPSSNASEKDGSILATA 443

Query: 398 ------RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                 RQT+M+SAT P  V  LA+ YL + + + IG++
Sbjct: 444 NSSSSRRQTIMFSATLPPRVANLAKSYLIEPVMLTIGNI 482


>UniRef50_Q8F0Q7 Cluster: ATP-dependent RNA helicase; n=4;
           Leptospira|Rep: ATP-dependent RNA helicase - Leptospira
           interrogans
          Length = 540

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/77 (44%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID ++ G+ ++    + VLDEADRMLDMGF   IR ++ + +  +QTL++SAT   E
Sbjct: 130 GRLIDMIKSGSIDISNVEFFVLDEADRMLDMGFIQDIRWLLHKCKNRKQTLLYSATLSVE 189

Query: 437 VKKLAEDYLGDYIQINI 487
           V +LA  +L + ++I I
Sbjct: 190 VMRLAYRFLNEPVEIQI 206



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAAD-FGHTSYVRN 176
           G+GKT+A+++P I +I     + +G  G  ALVLAPTREL  QI + A     H+  +R+
Sbjct: 48  GTGKTVAFLIPVIHNI-----LTKGIQGIAALVLAPTRELTMQIAEEAKKLLKHSEGIRS 102

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             + GG   + Q +DLE    I++AT
Sbjct: 103 VPIIGGTDYKSQNKDLEGLNGIIVAT 128


>UniRef50_Q6KI10 Cluster: DEAD-box ATP-dependent RNA helicase; n=1;
           Mycoplasma mobile|Rep: DEAD-box ATP-dependent RNA
           helicase - Mycoplasma mobile
          Length = 557

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 28/72 (38%), Positives = 52/72 (72%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D+++ G  +L +   +VLDEAD M+DMGF   +++I+++ + ++Q +++SAT PK 
Sbjct: 134 GRLLDYIKSGKLSLSQVDTVVLDEADLMVDMGFIDDVKEILKRTKEEKQVMLFSATMPKA 193

Query: 437 VKKLAEDYLGDY 472
           +  L ED++G +
Sbjct: 194 IMNLVEDFMGKF 205



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +  I  I              L+L PTREL+ Q+ +    F     + +  
Sbjct: 48  GTGKTAAFGVSIINKILKNKKNNAKSSLTTLILVPTRELSVQVNENIKLFSSNLPITSLA 107

Query: 183 VFGGAPKREQARDL-ERGVEIVIAT 254
           ++GG   RE    + +RG++I++AT
Sbjct: 108 IYGGMRNRESHFSIFKRGLDIIVAT 132


>UniRef50_Q31AC4 Cluster: DEAD/DEAH box helicase-like protein; n=7;
           Prochlorococcus marinus|Rep: DEAD/DEAH box helicase-like
           protein - Prochlorococcus marinus (strain MIT 9312)
          Length = 593

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/81 (41%), Positives = 54/81 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D + +GT  +     LVLDEAD ML+MGF   I  II+Q+  ++Q +++SAT P E
Sbjct: 180 GRIMDHIRQGTFKVNSINCLVLDEADEMLNMGFLEDIEWIIDQLPKNKQMVLFSATMPNE 239

Query: 437 VKKLAEDYLGDYIQINIGSLQ 499
           ++ +A+ YL D  +I I S++
Sbjct: 240 IRNIAKKYLNDPAEILIKSVK 260



 Score = 46.0 bits (104), Expect = 9e-04
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF-GHTSYVRNT 179
           G+GKT A+ LP I  + +   +        LV+ PTRELA Q+ +    +   ++  +  
Sbjct: 98  GTGKTAAFALPLIEKLADNKELNAK----VLVMTPTRELATQVAESFKSYSSESTNFKTI 153

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            ++GG   R Q   L+R V++V+ T
Sbjct: 154 AIYGGTDYRNQIYALKRKVDVVVGT 178


>UniRef50_Q1IMK6 Cluster: DEAD/DEAH box helicase-like; n=1;
           Acidobacteria bacterium Ellin345|Rep: DEAD/DEAH box
           helicase-like - Acidobacteria bacterium (strain
           Ellin345)
          Length = 423

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 36/89 (40%), Positives = 56/89 (62%)
 Frame = +2

Query: 230 GSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTL 409
           G+R      GRL D++ +   +L +   LVLDEADRM+DMGF P I++I+  +  D+QTL
Sbjct: 146 GARVVVATPGRLEDYMGRRLVDLSQVEMLVLDEADRMMDMGFLPAIKRILRALPRDKQTL 205

Query: 410 MWSATWPKEVKKLAEDYLGDYIQINIGSL 496
            +SAT    V  + +D L + +++ IGS+
Sbjct: 206 CFSATMGPAVSGIVQDCLYNAVRVEIGSI 234



 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 30/84 (35%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKTLA+I+PA+  + +  P     G   L+L PTRELA Q+  V              
Sbjct: 74  GTGKTLAFIIPALEMLRDTEPC----GVQVLILVPTRELAMQVHGVYEQLKGKKLKSAAL 129

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG  +R Q + +  G  +V+AT
Sbjct: 130 VMGGTSERNQIQSIRSGARVVVAT 153


>UniRef50_A6T3R2 Cluster: ATP-dependent RNA helicase; n=52; cellular
           organisms|Rep: ATP-dependent RNA helicase -
           Janthinobacterium sp. (strain Marseille) (Minibacterium
           massiliensis)
          Length = 778

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/71 (47%), Positives = 47/71 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID LEKG+ +L R   +VLDEAD ML MGF   +  I+++    RQT ++SAT P  
Sbjct: 135 GRVIDHLEKGSLDLSRIKTMVLDEADEMLRMGFIDDVETILQKTPESRQTALFSATMPSA 194

Query: 437 VKKLAEDYLGD 469
           +K++A  YL D
Sbjct: 195 IKRIATTYLRD 205



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           G+GKT ++ LP +  I+ +        P ALVLAPTRELA Q+ +    +  +       
Sbjct: 54  GTGKTASFALPILARIDIKQTT-----PQALVLAPTRELAIQVAEAFQRYATYIPGFHVL 108

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            ++GG     Q   L RGV +V+ T
Sbjct: 109 PIYGGQSYGAQLSALRRGVHVVVGT 133


>UniRef50_A3WBM2 Cluster: Cold-shock dead-box protein A; n=1;
           Erythrobacter sp. NAP1|Rep: Cold-shock dead-box protein
           A - Erythrobacter sp. NAP1
          Length = 598

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 33/78 (42%), Positives = 52/78 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE+G  +L     +VLDEAD MLDMGF   + +I++     R+TL++SAT P+ 
Sbjct: 132 GRLRDHLERGALDLSGLIGVVLDEADEMLDMGFREDLEEILDATPDTRRTLLFSATMPQA 191

Query: 437 VKKLAEDYLGDYIQINIG 490
           + +LA+ Y  D +++++G
Sbjct: 192 IVRLAQKYQSDALRLSLG 209



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ---PPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT+A+ +     I +Q    P++  + P+ L +APTRELA Q+ +        + +R
Sbjct: 46  GSGKTVAFGIALAQDILDQISGTPLQ--ERPLVLAIAPTRELALQVSRELGWLYAKAGLR 103

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
                GG    ++ R L  G  IV+ T
Sbjct: 104 IATCVGGMDASKERRALRSGPAIVVGT 130


>UniRef50_Q4QIG1 Cluster: ATP-dependent DEAD/H RNA helicase,
           putative; n=7; Trypanosomatidae|Rep: ATP-dependent
           DEAD/H RNA helicase, putative - Leishmania major
          Length = 685

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/84 (40%), Positives = 49/84 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y LP I H  +QP   +G+GPI LVL PT+ELA Q+  +  + G  + +R   
Sbjct: 94  GSGKTLCYALPLIRHCADQPRCEKGEGPIGLVLVPTQELAMQVFTLLDELGEAARLRCVA 153

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +G     +  R  + G E+++AT
Sbjct: 154 SYGSTSLSDNIRHAKVGCELMVAT 177



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/81 (39%), Positives = 51/81 (62%), Gaps = 3/81 (3%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL+D L      T +L R +++++DEADR+ D GF   +   ++ IRPDR T M SAT 
Sbjct: 179 GRLLDLLTVNGGKTLSLSRVSFVIVDEADRLFDSGFMEHVEAFLKNIRPDRVTGMISATM 238

Query: 428 PKEVKKLAEDYLGDYIQINIG 490
           PKE++ +   +L + + I++G
Sbjct: 239 PKELRGVVAQHLRNPVVISVG 259


>UniRef50_Q6YPL1 Cluster: Superfamily II DNA and RNA helicase; n=3;
           Candidatus Phytoplasma|Rep: Superfamily II DNA and RNA
           helicase - Onion yellows phytoplasma
          Length = 552

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR ID LE+G  +L     L LDEAD ML MGF+  +  I+++I  +RQT+++SAT P  
Sbjct: 131 GRAIDHLERGKIDLSALKILTLDEADEMLKMGFQEALETILKKIPEERQTVLFSATLPPF 190

Query: 437 VKKLAEDYLGD--YIQINIGSLQLSAI 511
           +KK+A  Y  D   +Q+ + ++ ++AI
Sbjct: 191 IKKIASKYQKDTKILQVPVKNIAVNAI 217



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI-QQVAADFGHTSYVRNT 179
           G+GKT A+ +P I  I  +P I++     +L+L PTREL  Q+ +++         +R  
Sbjct: 50  GTGKTFAFGIPIIEKI--EPKIQKTQ---SLILCPTRELTLQVYEELKKLLRFYQEIRIA 104

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GG    +Q R LE    ++IAT
Sbjct: 105 VVYGGESYTKQFRALEAKPHLIIAT 129


>UniRef50_O54116 Cluster: Probable DEAD-box RNA helicase; n=10;
           Streptomyces|Rep: Probable DEAD-box RNA helicase -
           Streptomyces coelicolor
          Length = 498

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 34/87 (39%), Positives = 54/87 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D +++G   L + +  VLDEAD+M DMGF PQ+  +++Q+RP+ Q +++SAT  + 
Sbjct: 199 GRLKDLIDRGDCRLNQVSVTVLDEADQMADMGFMPQVTALLDQVRPEGQRMLFSATLDRN 258

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           V  L   YL D +  ++      A+TT
Sbjct: 259 VDLLVRRYLSDPVVHSVDP-SAGAVTT 284



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/84 (39%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ L  +     +    R   P+ LVL PTRELAQQ+      +  +  +R   
Sbjct: 116 GSGKTLAFGLALLARTAGRRAEPRQ--PLGLVLVPTRELAQQVTDALTPYARSVKLRLAT 173

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V GG     QA  L  G E+V+AT
Sbjct: 174 VVGGMSIGRQASALRGGAEVVVAT 197


>UniRef50_Q0HKH0 Cluster: DEAD/DEAH box helicase domain protein;
           n=37; Gammaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Shewanella sp. (strain MR-4)
          Length = 427

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D L      L R   LVLDEADRML +GF  ++ +++E +   +QTL++SAT+P+E
Sbjct: 144 GRLLDLLASNALKLNRVLALVLDEADRMLSLGFTDELNQVLEALPAKKQTLLYSATFPEE 203

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAI 511
           V+ L    L   ++ ++ S Q S I
Sbjct: 204 VRALTAKLLHQPLEYHLQSEQESTI 228



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAADFG--HTSYVR 173
           GSGKT A+ +P +  +       +  G +  LVL PTRELAQQ+      +       ++
Sbjct: 56  GSGKTAAFAVPLLQRLFEAKTAEKSAGQVRCLVLVPTRELAQQVADSFLSYASHFNGQLK 115

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
               FGG     Q + L  G ++++AT
Sbjct: 116 IVAAFGGVSVNLQMQSLRAGADVLVAT 142


>UniRef50_Q0G0P8 Cluster: Superfamily II DNA and RNA helicase; n=2;
           Aurantimonadaceae|Rep: Superfamily II DNA and RNA
           helicase - Fulvimarina pelagi HTCC2506
          Length = 457

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 32/77 (41%), Positives = 54/77 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +E+   +L+   +L+LDEADRMLDMGF   + KI+ +   DRQ++M+SAT PK 
Sbjct: 136 GRLLDLMEQRAIDLRETRHLILDEADRMLDMGFVRDVMKIVGKCPDDRQSMMFSATMPKP 195

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ L++  L +  ++++
Sbjct: 196 IEDLSKKILTNPQKVSV 212



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 36/87 (41%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVH---INNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKT A+ LP + H   +  +P  R      AL+L+PTRELA QI +  AD    + + 
Sbjct: 51  GTGKTAAFALPLLHHLMTVGGKPTTRTTK---ALILSPTRELAVQIAESIADLSEGTPIS 107

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           +  VFGG   R Q + L RGV+I++AT
Sbjct: 108 HCVVFGGVSVRPQIQALARGVDILVAT 134


>UniRef50_A6CFZ8 Cluster: ATP-dependent RNA helicase; n=1;
           Planctomyces maris DSM 8797|Rep: ATP-dependent RNA
           helicase - Planctomyces maris DSM 8797
          Length = 445

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 33/77 (42%), Positives = 49/77 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D + +G   L +    VLDEADRMLDMGF P +++II Q+   RQ+L +SAT   +
Sbjct: 134 GRLLDLMNQGHIKLNQLEVFVLDEADRMLDMGFLPDLKRIITQLPTQRQSLFFSATLAPK 193

Query: 437 VKKLAEDYLGDYIQINI 487
           + +LA   L   + +N+
Sbjct: 194 ITELAHSLLSKPVTVNV 210



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 32/84 (38%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A  LP +  +           P+ALVLAPTRELA QI      +G    +R+  
Sbjct: 49  GTGKTAALALPILNQLGKNSRKSIPHHPLALVLAPTRELAIQIGDSFDAYGRHLKLRSVL 108

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG  +  Q + L+RG  I++AT
Sbjct: 109 IYGGVGQGNQVKALKRGAHILVAT 132


>UniRef50_A4BET4 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Reinekea sp. MED297|Rep: DEAD/DEAH box helicase-like
           protein - Reinekea sp. MED297
          Length = 579

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 34/77 (44%), Positives = 50/77 (64%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D L +GT +L    +LVLDEAD ML MGF   I  I+E    D+QT ++SAT P +
Sbjct: 133 GRVMDHLRRGTLDLSDLKHLVLDEADEMLRMGFIEDIDWILEHTPKDKQTALFSATMPHQ 192

Query: 437 VKKLAEDYLGDYIQINI 487
           +K++ + Y  D ++I I
Sbjct: 193 IKRITDQYQKDPVKIEI 209



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH-TSYVRNT 179
           G+GKT A+ LP +  I+        + P ALVL PTRELA Q+ +    +          
Sbjct: 52  GTGKTAAFSLPLLSRIDTTK-----NKPQALVLCPTRELAIQVAEAFQTYARGVDNFHVL 106

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            ++GGA  R Q R L++  ++++ T
Sbjct: 107 PIYGGADMRNQLRALKQNPQVIVGT 131


>UniRef50_A0KXT6 Cluster: DEAD/DEAH box helicase domain protein;
           n=22; Gammaproteobacteria|Rep: DEAD/DEAH box helicase
           domain protein - Shewanella sp. (strain ANA-3)
          Length = 491

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 37/77 (48%), Positives = 48/77 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D   +        + LVLDEADRMLDMGF   I  IIE++   RQ L++SAT  K+
Sbjct: 132 GRLLDMYTQRAIRFDEVSVLVLDEADRMLDMGFIEDINSIIEKLPEQRQNLLFSATLSKQ 191

Query: 437 VKKLAEDYLGDYIQINI 487
           VK LA+  + D I+I I
Sbjct: 192 VKALAKSAIPDAIEIEI 208



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT +++LP +    + P IR      A++L PTRELA Q+++    +     +    
Sbjct: 48  GTGKTASFVLPLLHRFADAPKIRP-KRVRAIILTPTRELALQVEENINQYAKYLPLTAMA 106

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q + L  GV++++AT
Sbjct: 107 MYGGVDAAPQKKRLIEGVDLLVAT 130


>UniRef50_Q11039 Cluster: Cold-shock DEAD box protein A homolog;
           n=31; Bacteria|Rep: Cold-shock DEAD box protein A
           homolog - Mycobacterium tuberculosis
          Length = 563

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 35/88 (39%), Positives = 53/88 (60%)
 Frame = +2

Query: 218 GLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPD 397
           GL  G++      GR+ID LE+ T +L R  +LVLDEAD ML MGF   + +I+ +    
Sbjct: 128 GLRRGAQVVVGTPGRMIDHLERATLDLSRVDFLVLDEADEMLTMGFADDVERILSETPEY 187

Query: 398 RQTLMWSATWPKEVKKLAEDYLGDYIQI 481
           +Q  ++SAT P  ++KL+  YL D  ++
Sbjct: 188 KQVALFSATMPPAIRKLSAKYLHDPFEV 215



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           G+GKT A+ +P +  I+    +     P ALVL PTRELA Q+ +    +G + S +   
Sbjct: 60  GTGKTAAFAIPMLSKIDITSKV-----PQALVLVPTRELALQVAEAFGRYGAYLSQLNVL 114

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            ++GG+    Q   L RG ++V+ T
Sbjct: 115 PIYGGSSYAVQLAGLRRGAQVVVGT 139


>UniRef50_Q8YXJ0 Cluster: ATP-dependent RNA helicase; n=11;
           Cyanobacteria|Rep: ATP-dependent RNA helicase - Anabaena
           sp. (strain PCC 7120)
          Length = 513

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 32/77 (41%), Positives = 46/77 (59%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID LE+G   L +  + VLDEAD ML MGF   + KI+ Q   DRQT ++SAT P  
Sbjct: 130 GRVIDLLERGNLKLDQVKWFVLDEADEMLSMGFIDDVEKILSQAPQDRQTALFSATMPPS 189

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ L   +L   + + +
Sbjct: 190 IRMLVNKFLRSPVTVTV 206



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 32/84 (38%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  ++ Q    +     A+VL PTRELA Q+    A F   S +R   
Sbjct: 50  GTGKTAAFSLPILERLDPQQKAVQ-----AIVLTPTRELAIQVHDAMAQFVGNSGLRTLA 104

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q   L+RGV IV+ T
Sbjct: 105 IYGGQSIDRQMLQLKRGVHIVVGT 128


>UniRef50_Q2YZZ9 Cluster: Putative uncharacterized protein; n=1;
           uncultured candidate division OP8 bacterium|Rep:
           Putative uncharacterized protein - uncultured candidate
           division OP8 bacterium
          Length = 453

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 38/84 (45%), Positives = 49/84 (58%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D        L    +LVLDEADRMLDMGF P IR+I++ I   RQTL +SAT P  
Sbjct: 129 GRLLDHFRAPYAKLAGLEHLVLDEADRMLDMGFLPDIRRILKHIPARRQTLFFSATMPAP 188

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           +  LA + L +   +NI  +   A
Sbjct: 189 IGVLAREMLRNPATVNINRIAAPA 212



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 34/84 (40%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP +  + ++P   RG    ALV+ PTRELA QI +   D    + +    
Sbjct: 48  GSGKTAAFLLPILHQLIDRP---RGTTR-ALVITPTRELAAQILEDLNDLAVHTPISAAA 103

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGG   R Q     RGV+++I T
Sbjct: 104 VFGGVSIRPQEHAFRRGVDVLIGT 127


>UniRef50_Q0BSI7 Cluster: ATP-dependent RNA helicase; n=12;
           Alphaproteobacteria|Rep: ATP-dependent RNA helicase -
           Granulobacter bethesdensis (strain ATCC BAA-1260 /
           CGDNIH1)
          Length = 763

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/77 (44%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID  ++G   L     LV+DEADRMLDMGF P + +I+  +  +RQTL +SAT   E
Sbjct: 353 GRLIDLFDRGGLLLTDTRILVIDEADRMLDMGFIPDVERIVSLLPHNRQTLFFSATMAPE 412

Query: 437 VKKLAEDYLGDYIQINI 487
           +++LA+ +L +  +I +
Sbjct: 413 IRRLADAFLQNPKEITV 429



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT ++ LP +  ++++    R   P +L+L PTRELA Q+ +    +G    + +  
Sbjct: 270 GTGKTASFTLPMMDILSDRRA--RARMPRSLILEPTRELALQVAENFVKYGQYLKLNHAL 327

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +Q   L +GV+++IAT
Sbjct: 328 LIGGESMNDQRDVLSKGVDVLIAT 351


>UniRef50_A6TUK6 Cluster: DEAD/DEAH box helicase domain protein;
           n=2; Firmicutes|Rep: DEAD/DEAH box helicase domain
           protein - Alkaliphilus metalliredigens QYMF
          Length = 484

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 34/77 (44%), Positives = 48/77 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +EKGT +  +  YLV+DEAD M +MGF  QI  II+ +   R T++ SAT P  
Sbjct: 131 GRIIDHMEKGTFDTSQIKYLVIDEADEMFNMGFVDQIETIIKDLSKKRVTMLLSATMPSA 190

Query: 437 VKKLAEDYLGDYIQINI 487
           ++ L+  Y+ D I   I
Sbjct: 191 IETLSNRYMKDPIHAEI 207



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 28/84 (33%), Positives = 46/84 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ +P    ++        + P ALVL PTRELA Q+++   + G    ++   
Sbjct: 51  GSGKTAAFAIPICQLVDWDE-----NKPQALVLVPTRELAIQVKEDMFNIGRFKRLKVAA 105

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+G AP   Q ++L++   +V+ T
Sbjct: 106 VYGKAPFYHQEKELKQKTHVVVGT 129


>UniRef50_Q978T9 Cluster: ATP-dependent RNA helicase; n=3;
           Thermoplasma|Rep: ATP-dependent RNA helicase -
           Thermoplasma volcanium
          Length = 373

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/69 (44%), Positives = 48/69 (69%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR +D +++G  N  + +Y VLDEAD MLDMGF   I+KII  +  +RQ+ ++SAT P E
Sbjct: 128 GRTLDLIDRGILNFDKVSYFVLDEADEMLDMGFIEDIKKIINVLPVERQSFLFSATIPSE 187

Query: 437 VKKLAEDYL 463
           + +LA+ ++
Sbjct: 188 IIELAKGFM 196



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 33/84 (39%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT AY++P I +   +  IR      AL+L PTRELA Q+ +V+   G  S +R   
Sbjct: 49  GSGKTAAYLIPIINNTAKEKGIR------ALILLPTRELAVQVAKVSEALGKRSGIRTVV 102

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    +Q   + RG  I++ T
Sbjct: 103 VYGGVSINKQIELILRGANIIVGT 126


>UniRef50_UPI0000E87E35 Cluster: putative ATP-dependent RNA helicase
           protein; n=1; Methylophilales bacterium HTCC2181|Rep:
           putative ATP-dependent RNA helicase protein -
           Methylophilales bacterium HTCC2181
          Length = 427

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 33/77 (42%), Positives = 51/77 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D  ++   N +    ++LDEADRMLDMGF P IRKI       +Q LM+SAT+   
Sbjct: 131 GRLLDLYQQKKINFKGLEVMILDEADRMLDMGFVPDIRKIYNATSKKQQMLMFSATFDPP 190

Query: 437 VKKLAEDYLGDYIQINI 487
           ++K+A+++L + + I+I
Sbjct: 191 IQKIAQEFLTNPVTISI 207



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 28/104 (26%), Positives = 51/104 (49%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A++LP +  +        G GP  L+++PTRELA QI      +     + +  
Sbjct: 48  GTGKTAAFVLPILDKLTKNRS--EGRGPRVLIVSPTRELATQITDSIKKYSRYLRINSIT 105

Query: 183 VFGGAPKREQARDLERGVEIVIATQVD*LISWKRAQPTYSGAHI 314
           + GG     Q R   + ++I++AT    L  +++ +  + G  +
Sbjct: 106 ITGGISYGLQNRMFSKPIDILVATPGRLLDLYQQKKINFKGLEV 149


>UniRef50_Q1VL45 Cluster: DEAD/DEAH box helicase-like protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: DEAD/DEAH box
           helicase-like protein - Psychroflexus torquis ATCC
           700755
          Length = 255

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  E+G  +L     L LDEADRMLDMGF P I  I+E++   +QTL++SAT+P+E
Sbjct: 131 GRVMDMNERGHIDLNSPKMLCLDEADRMLDMGFFPDIMWIVERMTSRQQTLLFSATFPQE 190

Query: 437 VKKLAEDYLG--DYIQINIGSLQLSAITTF 520
           +   A +++   D++  N   L +  I  +
Sbjct: 191 IIDAAHEFMNEPDFVLTNAEELDIPPIDLY 220



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/84 (36%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +        ++      ALVLAPTRELA Q+ Q        + +    
Sbjct: 52  GSGKTAAFGLPILERCQPSGKLQ------ALVLAPTRELANQVAQEFELLQGNAGLSIVT 105

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    +QA+ L +GV+I++ T
Sbjct: 106 VYGGTDLEKQAKTLAKGVDIIVGT 129


>UniRef50_Q4UA43 Cluster: DEAD-family helicase, putative; n=3;
           Piroplasmida|Rep: DEAD-family helicase, putative -
           Theileria annulata
          Length = 757

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 37/87 (42%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A++LP + ++   PP+      DGP AL+LAP+RELA QI      F      R
Sbjct: 386 GSGKTAAFVLPMLTYVKKLPPLDDETSLDGPYALILAPSRELALQIYDETVKFSAFCSCR 445

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           +  V GG     QA +L +G EI+I T
Sbjct: 446 SVAVVGGRNAESQAFELRKGCEIIIGT 472



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 33/44 (75%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           GR+ D L++  T L +C Y++LDEADRM+DMGFE  ++ I++ I
Sbjct: 474 GRVKDCLDRAYTVLSQCNYVILDEADRMIDMGFEDVLKYILDCI 517


>UniRef50_O83749 Cluster: ATP-dependent RNA helicase; n=2;
           Treponema|Rep: ATP-dependent RNA helicase - Treponema
           pallidum
          Length = 649

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 30/73 (41%), Positives = 45/73 (61%)
 Frame = +2

Query: 254 SGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           +GR+ID +E+G+  L    Y +LDEAD ML+MGF   I  I      D + LM+SAT P+
Sbjct: 173 TGRVIDHIERGSLELSYLRYFILDEADEMLNMGFVEDIESIFSHANKDARVLMFSATMPR 232

Query: 434 EVKKLAEDYLGDY 472
           ++  +A  ++G Y
Sbjct: 233 QILSIASTFMGSY 245



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 34/84 (40%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP I  + +  P      P ALVL PTRELA Q+    +        R   
Sbjct: 94  GTGKTAAFGLPLIQELGS--PCEH---PGALVLVPTRELAAQVASELSSLRIQKIPRIHT 148

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG    EQ R+LE+G EI++ T
Sbjct: 149 VYGGVSIAEQLRNLEQGGEIIVGT 172


>UniRef50_Q1J0S9 Cluster: DEAD/DEAH box helicase-like protein; n=2;
           Deinococcus|Rep: DEAD/DEAH box helicase-like protein -
           Deinococcus geothermalis (strain DSM 11300)
          Length = 591

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 34/77 (44%), Positives = 49/77 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE+G  +L    Y VLDEAD ML +GF   I  I++Q    RQT+++SAT   E
Sbjct: 133 GRLIDHLERGNLDLSAIQYAVLDEADEMLSVGFADAIETILQQTPAARQTMLFSATLNDE 192

Query: 437 VKKLAEDYLGDYIQINI 487
           + +LA  YL + + +++
Sbjct: 193 IHRLARKYLREPVVVDL 209



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI---NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKTLA+ LP I ++   + +    RG  P A+V+APTRELA+Q+ +  +  G    + 
Sbjct: 47  GTGKTLAFALPIIQNLTAPDGRGSRERGRLPRAIVIAPTRELAKQVAEEFSKSG--PQLS 104

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V+GGA    Q   L RGV++V+ T
Sbjct: 105 TVTVYGGAAYGPQENALRRGVDVVVGT 131


>UniRef50_Q12QV2 Cluster: DEAD/DEAH box helicase-like protein; n=16;
           Gammaproteobacteria|Rep: DEAD/DEAH box helicase-like
           protein - Shewanella denitrificans (strain OS217 / ATCC
           BAA-1090 / DSM 15013)
          Length = 433

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 34/69 (49%), Positives = 46/69 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL++ +     +L    +LVLDEADRMLDMGF   I+KI++ +   RQ L++SAT+   
Sbjct: 133 GRLLEHIVACNLSLSNVEFLVLDEADRMLDMGFSTDIQKILQAVNKKRQNLLFSATFSTA 192

Query: 437 VKKLAEDYL 463
           VKKLA D L
Sbjct: 193 VKKLANDML 201



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 27/84 (32%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ LP +  ++ +P   +     AL+L PTRELA Q+    + +     +    
Sbjct: 48  GTGKTAAFALPILQKMHERPMTVQHSNARALILTPTRELAAQVADNISAYSKHMNISVLT 107

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     QA+ L++G +I++AT
Sbjct: 108 IYGGMKMATQAQKLKQGADIIVAT 131


>UniRef50_Q0S0C5 Cluster: Possible ATP-dependent RNA helicase; n=6;
           Actinomycetales|Rep: Possible ATP-dependent RNA helicase
           - Rhodococcus sp. (strain RHA1)
          Length = 632

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 34/74 (45%), Positives = 47/74 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L +GT  L       LDEAD+M DMGF P++R I+ + R D Q L++SAT  +E
Sbjct: 158 GRLNDHLRQGTCILDSIEITALDEADQMADMGFLPEVRAILGETRADGQRLLFSATLDRE 217

Query: 437 VKKLAEDYLGDYIQ 478
           V+ L   +L D++Q
Sbjct: 218 VQSLVRQFLPDHVQ 231



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 32/84 (38%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+ LP +  ++          P ALVL PTRELA Q+      +     +    
Sbjct: 73  GSGKTLAFGLPMLTRLSRHEDRPAPKRPRALVLVPTRELAFQVVDSLNSYAGAMGLTVRP 132

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG P  +Q   L RGV+I++AT
Sbjct: 133 AVGGTPFSKQVDQLRRGVDILVAT 156


>UniRef50_A5FST0 Cluster: DEAD/DEAH box helicase domain protein;
           n=8; Bacteria|Rep: DEAD/DEAH box helicase domain protein
           - Dehalococcoides sp. BAV1
          Length = 561

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 32/79 (40%), Positives = 53/79 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D + +GT ++     L++DEADRM DMGF+P I+ I++ +    QTL++SAT P E
Sbjct: 129 GRLLDHIWRGTIDVCGVETLIIDEADRMFDMGFQPDIQSILKCLVQPHQTLLFSATMPPE 188

Query: 437 VKKLAEDYLGDYIQINIGS 493
           V+KL  +   + + + +G+
Sbjct: 189 VRKLTLETQTNPVTVQVGT 207



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY LP I  + + P   RG     LV+APTRELA QI       G  + +R   
Sbjct: 48  GTGKTAAYALPIIQKMLSTP---RGRVR-TLVIAPTRELACQISDSFRSLGQRARIRECS 103

Query: 183 VFGGAPKREQARDLERGVEIVIA 251
           ++GG    +Q R L  GV++V+A
Sbjct: 104 IYGGVNMDQQIRRLRSGVDVVVA 126


>UniRef50_A1USG3 Cluster: DEAD/DEAH box helicase domain/helicase
           conserved C-terminal domain protein; n=2;
           Rhizobiales|Rep: DEAD/DEAH box helicase domain/helicase
           conserved C-terminal domain protein - Bartonella
           bacilliformis (strain ATCC 35685 / KC583)
          Length = 462

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 37/77 (48%), Positives = 47/77 (61%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D  E+GT  L     LV+DEADRMLDMGF P I +I +     RQTL +SAT   E
Sbjct: 136 GRLLDHFERGTLLLMGVEILVIDEADRMLDMGFIPDIERICKLTPFTRQTLFFSATMAPE 195

Query: 437 VKKLAEDYLGDYIQINI 487
           + KL E +L   + + I
Sbjct: 196 IIKLTEQFLHSPVCVEI 212



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT +++LP +  +       R   P  L+L PTRELA Q+++    +G    +    
Sbjct: 53  GTGKTASFVLPMLTLLEKGRAKARM--PRTLILEPTRELAAQVKENFDKYGINHRLNVAL 110

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q R LERG +++IAT
Sbjct: 111 LIGGVSFDHQDRKLERGADVLIAT 134


>UniRef50_A5K9H3 Cluster: Pre-mRNA splicing factor RNA helicase
           PRP28, putative; n=2; Eukaryota|Rep: Pre-mRNA splicing
           factor RNA helicase PRP28, putative - Plasmodium vivax
          Length = 1006

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 37/87 (42%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIR---RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A++LP + ++   PP+      DGP AL++AP+RELA QI      F      R
Sbjct: 628 GSGKTAAFVLPMLAYVKQLPPLTYETSQDGPYALIIAPSRELAIQIFDETNKFASYCSCR 687

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V GG     QA +L +GVEI+I T
Sbjct: 688 TVAVVGGRNAEAQAFELRKGVEIIIGT 714



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 24/44 (54%), Positives = 33/44 (75%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           GR+ D LEK  T L +C Y++LDEADRM+DMGFE  +  I+++I
Sbjct: 716 GRIHDCLEKAYTVLNQCNYVILDEADRMMDMGFEDSVHFILDKI 759


>UniRef50_Q2NEZ7 Cluster: Predicted helicase; n=6; cellular
           organisms|Rep: Predicted helicase - Methanosphaera
           stadtmanae (strain DSM 3091)
          Length = 583

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 32/68 (47%), Positives = 48/68 (70%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D +++GT +L     ++LDEAD MLDMGF   I  I+E I  +RQ L++SAT P+E
Sbjct: 132 GRVMDHIDRGTLSLNNIKTVILDEADEMLDMGFREDIEYILEDIPYERQFLLFSATLPQE 191

Query: 437 VKKLAEDY 460
           + +LA+ Y
Sbjct: 192 ILQLAQRY 199



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           G+GKT A+ +P + +I+++      +   A++L PTRELA Q+ +       +   +   
Sbjct: 51  GTGKTAAFGIPLLENIDSED-----NNLQAIILCPTRELAIQVAEELRKLSVYLPKIDVL 105

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GG P   Q + L++GV+I+I T
Sbjct: 106 PVYGGQPIDRQIKALQKGVQIIIGT 130


>UniRef50_A0RUV7 Cluster: Superfamily II helicase; n=3;
           Thermoprotei|Rep: Superfamily II helicase - Cenarchaeum
           symbiosum
          Length = 434

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 37/84 (44%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTL-MWSATWPK 433
           GRLID +++G+ ++ R T+LVLDEAD MLDMGF   I+ I++ + PD + + ++SAT P 
Sbjct: 128 GRLIDHIKRGSISIDRVTHLVLDEADTMLDMGFIDDIQFILD-LTPDEKVMSLFSATMPI 186

Query: 434 EVKKLAEDYLGDYIQINIGSLQLS 505
           E+ +L+E+YL +  Q  + +  LS
Sbjct: 187 EILRLSEEYLKNPKQFLLDADDLS 210



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 32/84 (38%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT AY +  +  I      + G G   L++APTRELA QI +    F   + VR   
Sbjct: 49  GTGKTGAYSISMLQEI------KEGGGIQGLIVAPTRELAVQITEEVKKFAKYTKVRPVA 102

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG     Q   L+RG EI++AT
Sbjct: 103 IYGGQSMGVQLDALKRGAEILVAT 126


>UniRef50_Q2LY23 Cluster: Superfamily II DNA and RNA helicases; n=2;
           Bacteria|Rep: Superfamily II DNA and RNA helicases -
           Syntrophus aciditrophicus (strain SB)
          Length = 572

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 31/78 (39%), Positives = 51/78 (65%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D + +G  +L   +++VLDEAD ML MGF+ ++  I+      + TL++SAT P+E
Sbjct: 131 GRLHDLIRRGAVDLSGVSWVVLDEADEMLQMGFQDELNAILAVTPDSKNTLLFSATMPRE 190

Query: 437 VKKLAEDYLGDYIQINIG 490
           V  +A +Y+ D ++I +G
Sbjct: 191 VAAIAANYMKDPLEIIVG 208



 Score = 42.3 bits (95), Expect = 0.011
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVRNT 179
           G+GKT A+ +P I   + +  ++R     ALVL PTREL  Q+       G +   ++  
Sbjct: 50  GTGKTAAFGIPLIQLTDTR--LKRTQ---ALVLCPTRELCVQVAGDLNLMGRYVQKLKIV 104

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GGA    Q  +L +G ++V+AT
Sbjct: 105 PVYGGASIVSQTEELRKGAQVVVAT 129


>UniRef50_Q1I3W1 Cluster: ATP-dependent RNA helicase RhlE, DEAD box
           family; n=21; Pseudomonadaceae|Rep: ATP-dependent RNA
           helicase RhlE, DEAD box family - Pseudomonas entomophila
           (strain L48)
          Length = 634

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 33/77 (42%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D   +G+ +L R   LVLDEADRMLDMGF   ++K++ ++   RQ L++SAT+ K+
Sbjct: 138 GRLLDLAGQGSVDLSRVEILVLDEADRMLDMGFIHDVKKVLARLPAKRQNLLFSATFSKD 197

Query: 437 VKKLAEDYLGDYIQINI 487
           +  LA+  L +  +I +
Sbjct: 198 ITDLADKLLHNPERIEV 214



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 5/88 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--NNQPPIRRGDGPI---ALVLAPTRELAQQIQQVAADFGHTSY 167
           G+GKT  + LP +  +     P   +  GP     LVL PTRELA Q+      +     
Sbjct: 48  GTGKTGGFALPILERLFPGGHPDKSQRHGPRQPRVLVLTPTRELAAQVHDSFKVYARDLN 107

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIA 251
             + C+FGG     Q + + +GV++++A
Sbjct: 108 FISACIFGGVGMNPQVQAMAKGVDVLVA 135


>UniRef50_Q0RTL3 Cluster: Cold-shock DeaD box ATP-dependent RNA
           helicase; n=2; Bacteria|Rep: Cold-shock DeaD box
           ATP-dependent RNA helicase - Frankia alni (strain
           ACN14a)
          Length = 608

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 35/78 (44%), Positives = 49/78 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR +D + +GT  L     +VLDEAD MLDMGF   I  I+EQ    RQT+++SAT P  
Sbjct: 187 GRALDHMGRGTLRLDGLHTVVLDEADEMLDMGFAEDIDAILEQAPQKRQTVLFSATLPPR 246

Query: 437 VKKLAEDYLGDYIQINIG 490
           + ++A  +L D ++I IG
Sbjct: 247 MDQIARRHLRDPVRIQIG 264



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 38/85 (44%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD-GPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT A+ LP +  + +    R GD GP ALVL PTRELA Q+ +    +G     R  
Sbjct: 104 GTGKTAAFALPLLHRLTDD---RTGDHGPQALVLVPTRELAVQVSEAIHRYGRDLGARVL 160

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GGAP   Q R L +GV++V+AT
Sbjct: 161 PVYGGAPIGRQVRALVQGVDVVVAT 185


>UniRef50_Q0HYG8 Cluster: DEAD/DEAH box helicase domain protein;
           n=62; Proteobacteria|Rep: DEAD/DEAH box helicase domain
           protein - Shewanella sp. (strain MR-7)
          Length = 549

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +++      +   LVLDEADRMLDMGF   I+KI+  +   RQ LM+SAT+  E
Sbjct: 132 GRLLDLVQQNVVKFNQLEILVLDEADRMLDMGFIRDIKKILALLPAKRQNLMFSATFSDE 191

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAIT 514
           +++LA+  +   ++I++     +A T
Sbjct: 192 IRELAKGLVNQPVEISVTPRNAAANT 217



 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 31/84 (36%), Positives = 47/84 (55%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + LP +  ++     + G    ALVL PTRELA Q+ +    +G    +R+  
Sbjct: 48  GTGKTAGFTLPLLELLSKGNKAKAGQIR-ALVLTPTRELAAQVSESVETYGKYLPLRSAV 106

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGG P   Q + L  GV++++AT
Sbjct: 107 VFGGVPINPQIQKLRHGVDVLVAT 130


>UniRef50_A7BCL2 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 722

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 35/87 (40%), Positives = 52/87 (59%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +EKG  +L     LVLDEAD ML MGF   +  I      DR T ++SAT P  
Sbjct: 173 GRVIDLIEKGALDLSHVRMLVLDEADEMLRMGFAEDVETIASSAPDDRLTALFSATMPAA 232

Query: 437 VKKLAEDYLGDYIQINIGSLQLSAITT 517
           ++K+A ++L D +++ + S + S + T
Sbjct: 233 IEKVAREHLKDPVKVAV-STESSTVDT 258



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF-GHTSYVRNT 179
           G+GKT A+ LP +  ++      +     ALVLAPTRELA Q  Q   DF   T+ +   
Sbjct: 92  GTGKTAAFGLPLLAIVDADERNVQ-----ALVLAPTRELAMQSAQAIEDFAARTARLDVV 146

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            V+GG+P   Q   L+RG ++V+ T
Sbjct: 147 PVYGGSPYGPQIGALKRGAQVVVGT 171


>UniRef50_A5G1U8 Cluster: DEAD/DEAH box helicase domain protein;
           n=1; Acidiphilium cryptum JF-5|Rep: DEAD/DEAH box
           helicase domain protein - Acidiphilium cryptum (strain
           JF-5)
          Length = 525

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL+D +  G   L     +VLDEAD+MLD+GF P IR+I+ ++   RQ +M+SAT PK 
Sbjct: 189 GRLLDHVAAGVIRLDAVETVVLDEADQMLDLGFIPAIRQIMAKLPRQRQAVMFSATMPKP 248

Query: 437 VKKLAEDYLGD 469
           ++ LA ++L D
Sbjct: 249 IRALAGEFLRD 259



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 38/86 (44%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           G+GKT A++LP +  I  N   P  R     ALVLAPTRELA QI   A  +G  +    
Sbjct: 104 GTGKTAAFVLPILHRIAANRARPAPRACR--ALVLAPTRELATQIADAARTYGKFTRPSV 161

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V GGA    QAR +E GV++++AT
Sbjct: 162 AVVIGGAKPGPQARRMESGVDLLVAT 187


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 698,153,395
Number of Sequences: 1657284
Number of extensions: 14228269
Number of successful extensions: 41911
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 38765
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41117
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52892566912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -