SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00005863FB Cluster: PREDICTED: hypothetical protein,...    38   0.16 
UniRef50_A6FX95 Cluster: Putative uncharacterized protein; n=1; ...    37   0.37 
UniRef50_UPI0000499ED7 Cluster: hypothetical protein 234.t00003;...    36   0.86 
UniRef50_Q75WN1 Cluster: Limonene/borneol synthase; n=1; Chamaec...    36   1.1  
UniRef50_Q9GNN5 Cluster: Nuclear lamin; n=2; Branchiostoma lance...    36   1.1  
UniRef50_O44624 Cluster: Putative uncharacterized protein; n=2; ...    36   1.1  
UniRef50_A7F6L1 Cluster: Putative uncharacterized protein; n=1; ...    36   1.1  
UniRef50_UPI0000EBD2D0 Cluster: PREDICTED: hypothetical protein;...    35   1.5  
UniRef50_UPI0000E21B66 Cluster: PREDICTED: similar to type 1 col...    35   1.5  
UniRef50_Q4SRU0 Cluster: Chromosome 9 SCAF14490, whole genome sh...    35   1.5  
UniRef50_Q124T9 Cluster: Extracellular ligand-binding receptor p...    35   1.5  
UniRef50_A5P374 Cluster: Putative uncharacterized protein; n=1; ...    35   1.5  
UniRef50_A4TY81 Cluster: Putative uncharacterized protein; n=1; ...    35   1.5  
UniRef50_Q9GZJ8 Cluster: Mre11; n=1; Bombyx mori|Rep: Mre11 - Bo...    35   1.5  
UniRef50_P54817 Cluster: Capsid protein P40 [Contains: Assemblin...    35   1.5  
UniRef50_UPI0000586226 Cluster: PREDICTED: similar to excision r...    35   2.0  
UniRef50_Q62AC1 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_Q3S869 Cluster: Modular polyketide synthase; n=2; Strep...    35   2.0  
UniRef50_A5NTZ4 Cluster: Glutathione S-transferase, C-terminal d...    35   2.0  
UniRef50_A4LXN8 Cluster: Polymerase-like protein; n=1; Geobacter...    35   2.0  
UniRef50_UPI0000E473C1 Cluster: PREDICTED: similar to interleuki...    34   2.6  
UniRef50_Q6MZ19 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_A5DN50 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_P34713 Cluster: Multidrug resistance protein 3; n=4; Ca...    34   2.6  
UniRef50_A6W9I7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_A1U282 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_A0TJ43 Cluster: Putative uncharacterized protein precur...    34   3.5  
UniRef50_Q53MC3 Cluster: Similar to ribulose bisphosphate carbox...    34   3.5  
UniRef50_A2Y1Q1 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_Q4A6U5 Cluster: Putative ABC transporter protein, perip...    33   4.6  
UniRef50_Q2GK11 Cluster: Ankyrin repeat protein; n=1; Anaplasma ...    33   4.6  
UniRef50_Q2CHG7 Cluster: Parallel beta-helix repeat protein; n=4...    33   4.6  
UniRef50_A5KSV3 Cluster: Metal dependent phosphohydrolase; n=1; ...    33   4.6  
UniRef50_Q8ST71 Cluster: Putative uncharacterized protein ECU01_...    33   4.6  
UniRef50_Q6BI71 Cluster: Similar to CA4409|IPF13151 Candida albi...    33   4.6  
UniRef50_Q5KNW3 Cluster: Translation initiation factor eIF-2B ep...    33   4.6  
UniRef50_Q55I79 Cluster: Putative uncharacterized protein; n=2; ...    33   4.6  
UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1; ...    33   4.6  
UniRef50_Q9UPA5 Cluster: Protein bassoon; n=12; Eukaryota|Rep: P...    33   4.6  
UniRef50_UPI0000DD7B25 Cluster: PREDICTED: hypothetical protein;...    33   6.1  
UniRef50_Q4SE97 Cluster: Chromosome 4 SCAF14624, whole genome sh...    33   6.1  
UniRef50_Q2RZY4 Cluster: Iron(III) ABC transporter, ATP-binding ...    33   6.1  
UniRef50_A7CFA3 Cluster: Putative uncharacterized protein precur...    33   6.1  
UniRef50_A5P3R6 Cluster: LigA; n=1; Methylobacterium sp. 4-46|Re...    33   6.1  
UniRef50_A5NP45 Cluster: Peptidoglycan-binding domain 1 protein ...    33   6.1  
UniRef50_A2FWC9 Cluster: Putative uncharacterized protein; n=1; ...    33   6.1  
UniRef50_Q6MFH6 Cluster: Related to nucleoprotein TPR; n=3; Sord...    33   6.1  
UniRef50_UPI00015B58DA Cluster: PREDICTED: hypothetical protein;...    33   8.0  
UniRef50_UPI000155CA05 Cluster: PREDICTED: hypothetical protein;...    33   8.0  
UniRef50_UPI000023CBD6 Cluster: hypothetical protein FG05208.1; ...    33   8.0  
UniRef50_Q9DDV9 Cluster: Complement component C3-4; n=2; Clupeoc...    33   8.0  
UniRef50_Q5WCN8 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_Q18QP3 Cluster: TRAP transporter, 4TM/12TM fusion prote...    33   8.0  
UniRef50_Q7X6D4 Cluster: OSJNBa0014K14.16 protein; n=7; Oryza sa...    33   8.0  
UniRef50_Q2QLL0 Cluster: Expressed protein; n=1; Oryza sativa (j...    33   8.0  
UniRef50_A4S3Z7 Cluster: Predicted protein; n=1; Ostreococcus lu...    33   8.0  
UniRef50_Q38BG2 Cluster: Putative uncharacterized protein; n=2; ...    33   8.0  
UniRef50_A2FEY1 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_P50546 Cluster: DNA-directed RNA polymerase subunit bet...    33   8.0  

>UniRef50_UPI00005863FB Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 306

 Score = 38.3 bits (85), Expect = 0.16
 Identities = 15/32 (46%), Positives = 23/32 (71%)
 Frame = +3

Query: 6   IVASIFGTVLGIAGSTINNHLKMAEFRDMMEQ 101
           ++ SI GT++GI GSTI NH +M E R ++ +
Sbjct: 165 VIGSIVGTLIGILGSTIVNHKRMGELRTLVSE 196


>UniRef50_A6FX95 Cluster: Putative uncharacterized protein; n=1;
           Plesiocystis pacifica SIR-1|Rep: Putative
           uncharacterized protein - Plesiocystis pacifica SIR-1
          Length = 968

 Score = 37.1 bits (82), Expect = 0.37
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +2

Query: 281 HMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKD 433
           H+ ++  LV T + D +R+++ A       DAE  +AL  V + L EAD D
Sbjct: 343 HVDDETFLVRTDVADAQRMVLLADLGVEDPDAETIQALLTVTESLREADSD 393


>UniRef50_UPI0000499ED7 Cluster: hypothetical protein 234.t00003;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 234.t00003 - Entamoeba histolytica HM-1:IMSS
          Length = 328

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +2

Query: 284 MHNQEHLVE-TQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLEPAKVS 460
           M N+E ++  T +K  K       +   K    + +    + +DL+E+DKD  ++  ++ 
Sbjct: 168 MKNKEEIISRTNLKQSKESYSDIKRQLEKEKTTVQRQSDTI-EDLNESDKDIMIKKVEIK 226

Query: 461 LEPNQILTGIGIIVC 505
            E N++ T  G +VC
Sbjct: 227 KEKNELYTKNGTLVC 241


>UniRef50_Q75WN1 Cluster: Limonene/borneol synthase; n=1;
           Chamaecyparis obtusa|Rep: Limonene/borneol synthase -
           Chamaecyparis obtusa (Japanese cypress)
          Length = 605

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 7/111 (6%)
 Frame = +2

Query: 152 RQPGRHHGG--DEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKD 325
           R+ G HHG   D+D ++    + PK   DA EY+    +    +++M N     ++  ++
Sbjct: 54  RRTGNHHGNLWDDDFIQ----SLPKLPYDAPEYRERADRLVGEVKNMFNAVRAADSSSQN 109

Query: 326 LKRLIVTASQSSAKS-----DAEIAKALSVVHQDLDEADKDRDLEPAKVSL 463
           + RL+    +          + EIA+AL  V++  ++    +DL  A + L
Sbjct: 110 ILRLLEMVDKVERLGIGRHFETEIAEALDYVYRFWNDI-SSKDLNTAALGL 159


>UniRef50_Q9GNN5 Cluster: Nuclear lamin; n=2; Branchiostoma
           lanceolatum|Rep: Nuclear lamin - Branchiostoma
           lanceolatum (Common lancelet) (Amphioxus)
          Length = 630

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +2

Query: 224 EVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEI-AKALSV 400
           EVDAGE +     Q +L E M  Q  L    M++    + T   +S KSD+E  + ALSV
Sbjct: 246 EVDAGEAEFESRLQEALRE-MREQHELEARSMREELETMYTQKMTSMKSDSERGSNALSV 304

Query: 401 VHQDLDEADKDRDLEPAKVS 460
             +++ E+    D   ++VS
Sbjct: 305 AREEMRESRARIDSLMSQVS 324


>UniRef50_O44624 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 400

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 22/82 (26%), Positives = 39/82 (47%)
 Frame = +2

Query: 185 DRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSA 364
           D VRL  T   + E D  E  S F+   + I H+ N++    +++++LKRL+  + Q   
Sbjct: 112 DIVRLLATLEREKERDRKEVDSQFTILKNRINHLENEKEQCLSEVQELKRLLEDSEQDLK 171

Query: 365 KSDAEIAKALSVVHQDLDEADK 430
               E+ + +    +  D  DK
Sbjct: 172 DCKDEMNRLMEERVETADALDK 193


>UniRef50_A7F6L1 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 806

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 29/105 (27%), Positives = 39/105 (37%), Gaps = 13/105 (12%)
 Frame = +2

Query: 26  HGARYSRFDDK---QSPEDGRVQGHDGAADGPERERPVH----------HRGGRDRQPGR 166
           HG   + FD     Q  E      H G   GPE ERP H          H    D   G 
Sbjct: 458 HGQGLASFDAPDLDQFKEHHHGPPHAGPFHGPEHERPPHPHERPLKGPEHERPHDPHDGF 517

Query: 167 HHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEH 301
           HHG  +D     G  S + E+D  +++S   +        H++ H
Sbjct: 518 HHGLPQDGPHHEGPVSQETEIDRPQHESPEDQSAFHEPPPHDEPH 562


>UniRef50_UPI0000EBD2D0 Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 498

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 18/40 (45%), Positives = 20/40 (50%)
 Frame = +2

Query: 119 ERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           E P+H RGGR R+ G    G E   R P  T P  E  AG
Sbjct: 31  EPPLHPRGGRGRRGGEADAGAEPAARGPDGTQPATEPRAG 70


>UniRef50_UPI0000E21B66 Cluster: PREDICTED: similar to type 1
           collagen alpha 2; n=1; Pan troglodytes|Rep: PREDICTED:
           similar to type 1 collagen alpha 2 - Pan troglodytes
          Length = 122

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 19/62 (30%), Positives = 27/62 (43%)
 Frame = +2

Query: 59  QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAG 238
           Q+P++G+  GH     G E   P   +GGR    GR   G     RLP   +P+    A 
Sbjct: 49  QAPQEGK-GGHRRPGRGSEARAPREGKGGRQPPAGRAGSGAAKEQRLPAGPAPRLAATAA 107

Query: 239 EY 244
            +
Sbjct: 108 PH 109


>UniRef50_Q4SRU0 Cluster: Chromosome 9 SCAF14490, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 9
           SCAF14490, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1034

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +2

Query: 230 DAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQ 409
           DA EY     +  SL+     + H V+    DLKR      Q   K  AE+ +A++ +HQ
Sbjct: 710 DAREYVKELQRSQSLLTSAEAELHHVKEMNVDLKRHNALLEQEKLKLSAELKQAIAKLHQ 769


>UniRef50_Q124T9 Cluster: Extracellular ligand-binding receptor
           precursor; n=1; Polaromonas sp. JS666|Rep: Extracellular
           ligand-binding receptor precursor - Polaromonas sp.
           (strain JS666 / ATCC BAA-500)
          Length = 384

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 413 LDEA-DKDRDLEPAKVSLEPNQILTGIGIIVCFR*YSATFWAESVEMSIFSPDSGSLILE 589
           LD+A D  R +E  K+ +E N++   IG +      +A   AE  ++ +F+P  G+  + 
Sbjct: 82  LDDAYDPKRTVENTKLLIEQNKVFALIGYVATANLIAAMPLAEEAKVPMFAPLVGTTSIR 141

Query: 590 SGHIFYLF 613
             H  YLF
Sbjct: 142 LKHNHYLF 149


>UniRef50_A5P374 Cluster: Putative uncharacterized protein; n=1;
           Methylobacterium sp. 4-46|Rep: Putative uncharacterized
           protein - Methylobacterium sp. 4-46
          Length = 257

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVR 196
           GA ++   D   PE G+ +  D A   P+R      RG R R+ GR  GG+    R
Sbjct: 135 GAHHAGATDHGGPEQGKAEEEDAARQEPQRRPRPGGRGAR-RRGGRRRGGEHRLAR 189


>UniRef50_A4TY81 Cluster: Putative uncharacterized protein; n=1;
           Magnetospirillum gryphiswaldense|Rep: Putative
           uncharacterized protein - Magnetospirillum
           gryphiswaldense
          Length = 372

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 3/70 (4%)
 Frame = +2

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAE---IAKALSVVHQDLDEADKDR 436
           TSL+E M ++   VE ++ DL   IVT +   A  +A    IA+ ++ V + +DEA++  
Sbjct: 134 TSLLEQMAHKVEQVEEKIDDLPSRIVTETVDMAPVNANLETIAERVASVERKIDEANQ-I 192

Query: 437 DLEPAKVSLE 466
           D+ P + SL+
Sbjct: 193 DIAPLRESLD 202


>UniRef50_Q9GZJ8 Cluster: Mre11; n=1; Bombyx mori|Rep: Mre11 -
           Bombyx mori (Silk moth)
          Length = 610

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 287 HNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDR 436
           HN++ L        +R I    +S+A+++ EIA+ L V  ++LDEAD ++
Sbjct: 461 HNEDVLRRAFDAHKRRCIAALLESTAETEKEIAEQLEVCKRELDEADDEK 510


>UniRef50_P54817 Cluster: Capsid protein P40 [Contains: Assemblin
           (Protease) (EC 3.4.21.97); Capsid assembly protein];
           n=6; Varicellovirus|Rep: Capsid protein P40 [Contains:
           Assemblin (Protease) (EC 3.4.21.97); Capsid assembly
           protein] - Bovine herpesvirus 1.1 (strain Cooper)
           (BoHV-1) (Infectious bovinerhinotracheitis virus)
          Length = 621

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 24/55 (43%), Positives = 28/55 (50%), Gaps = 6/55 (10%)
 Frame = +2

Query: 71  DGR-VQGH--DGAA-DGPERERPV--HHRGGRDRQPGRHHGGDEDRVRLPGTTSP 217
           DGR VQ H  DG+  DGP   RP+    R   D   GR  GGD+D    PG  +P
Sbjct: 414 DGRRVQAHGADGSGYDGPLDRRPLAKRRRYNWDHPRGRSGGGDDDEAYYPGEGAP 468


>UniRef50_UPI0000586226 Cluster: PREDICTED: similar to excision
           repair protein; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to excision repair protein -
           Strongylocentrotus purpuratus
          Length = 494

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 19/56 (33%), Positives = 25/56 (44%)
 Frame = +2

Query: 32  ARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRL 199
           A+ S   D    ED   +G +G       ER +H RGG D  PG   G + +  RL
Sbjct: 189 AKLSGKSDAAHGEDHSDEGENGDGSSSTYERLLHDRGGSDDAPGPSKGKETEHERL 244


>UniRef50_Q62AC1 Cluster: Putative uncharacterized protein; n=1;
           Burkholderia mallei|Rep: Putative uncharacterized
           protein - Burkholderia mallei (Pseudomonas mallei)
          Length = 136

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 20/58 (34%), Positives = 24/58 (41%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLP 202
           GA+  R D   +P    V       D P R R   HR GR+ + G   GG   R R P
Sbjct: 59  GAKLPRVDRDATPVGAPVPARR-MDDAPRRARAPAHRAGREHRGGNRRGGRVARARTP 115


>UniRef50_Q3S869 Cluster: Modular polyketide synthase; n=2;
           Streptomyces|Rep: Modular polyketide synthase -
           Streptomyces neyagawaensis
          Length = 5006

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 19/46 (41%), Positives = 24/46 (52%)
 Frame = -3

Query: 533 PRMLPNIIGSTLLCRCLLGFDLVPATPWPVPGRGPCQPRRDLGARL 396
           PR  P+  GS +      G D +P  PWP+ GR P +  RD  ARL
Sbjct: 484 PRTAPDA-GSGVASGSASGVDPLPTVPWPLSGRSP-EALRDQAARL 527


>UniRef50_A5NTZ4 Cluster: Glutathione S-transferase, C-terminal
           domain precursor; n=1; Methylobacterium sp. 4-46|Rep:
           Glutathione S-transferase, C-terminal domain precursor -
           Methylobacterium sp. 4-46
          Length = 811

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 21/44 (47%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = +2

Query: 74  GRVQGHDGAADGPER--ERPVHHRGGRDRQPGRHHGGDEDRVRL 199
           GR  G   AA  P R   R +   GG  R PGR  GGD DR RL
Sbjct: 125 GRNHGGPAAAAPPRRLRVRGLLRGGGGLRHPGRRDGGDPDRARL 168


>UniRef50_A4LXN8 Cluster: Polymerase-like protein; n=1; Geobacter
           bemidjiensis Bem|Rep: Polymerase-like protein -
           Geobacter bemidjiensis Bem
          Length = 580

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = +2

Query: 56  KQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
           +Q P  G  +   G A G   ER   H+  RDR+ G  HGG E R
Sbjct: 291 RQPPLQGIPRDRGGRAGGDGGERHPRHQRRRDRRGGDSHGGGEHR 335


>UniRef50_UPI0000E473C1 Cluster: PREDICTED: similar to interleukin-16
            precursor; n=2; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to interleukin-16 precursor -
            Strongylocentrotus purpuratus
          Length = 2507

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 7/111 (6%)
 Frame = +2

Query: 191  VRLPGTTSPKFEVDAGE-----YKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQ 355
            +R P   SP F  D+GE     +K  F+ +++   H+   +     Q + L     + S 
Sbjct: 2210 LRSPSLRSPTFSEDSGEGDSFRFKPHFNPRSNR-THLKADDSKSSLQQRGLLERSFSESS 2268

Query: 356  SSA--KSDAEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQILTGIGIIV 502
            +S    S  E+ K +   +Q LDEAD D D+  A + L  +    G+G+ V
Sbjct: 2269 NSTILLSTGELEKLIEEANQSLDEAD-DSDI--AVIVLHKDDDNQGLGLTV 2316


>UniRef50_Q6MZ19 Cluster: Putative uncharacterized protein; n=1;
           Methylocystis sp. SC2|Rep: Putative uncharacterized
           protein - Methylocystis sp. SC2
          Length = 129

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
 Frame = +2

Query: 20  FWHGARYS--RFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDED 187
           FW  AR+S  RF   +SP   R+    G +   +R R    RGGR +  G  HG +ED
Sbjct: 14  FWRRARHSPLRFRSLRSPRADRIVPTRGGSSWDDRSR----RGGRLKVEGSVHGRNED 67


>UniRef50_A5DN50 Cluster: Putative uncharacterized protein; n=1;
           Pichia guilliermondii|Rep: Putative uncharacterized
           protein - Pichia guilliermondii (Yeast) (Candida
           guilliermondii)
          Length = 717

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 23/95 (24%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = +2

Query: 158 PGRHHGGDEDRVRLPGTTSPK-FEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKR 334
           P  ++  ++D ++     S + FE     YK+  ++     +H+   ++L+ + + D+ +
Sbjct: 328 PSTNNEDNDDEMKAALAASLREFEQQEAAYKNQTAQPPQQKQHLSLYDNLLPSLLSDVPQ 387

Query: 335 LIVTASQSSAKSD--AEIAKALSVVHQDLDEADKD 433
               +S S+  S   A  A+A   +HQDL +AD+D
Sbjct: 388 ASYPSSSSNPFSSEGAPKAQAPPPLHQDLTQADED 422


>UniRef50_P34713 Cluster: Multidrug resistance protein 3; n=4;
           Caenorhabditis|Rep: Multidrug resistance protein 3 -
           Caenorhabditis elegans
          Length = 1268

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = +3

Query: 18  IFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFA 197
           I G++LG AG T++  L+M  FR++M+Q  +      + +  G   SR   T+A   + A
Sbjct: 767 ISGSLLGKAGETMSGRLRMDVFRNIMQQDASYFDDSRHNV--GSLTSRL-ATDAPNVQAA 823

Query: 198 YQEQLAQNL 224
             ++LA+ L
Sbjct: 824 IDQRLAEVL 832


>UniRef50_A6W9I7 Cluster: Putative uncharacterized protein; n=1;
           Kineococcus radiotolerans SRS30216|Rep: Putative
           uncharacterized protein - Kineococcus radiotolerans
           SRS30216
          Length = 110

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 18/54 (33%), Positives = 22/54 (40%)
 Frame = +2

Query: 29  GARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
           GA   RF+ +  P         G  DGP     V  R G DR+P R   G+  R
Sbjct: 54  GAARERFELRSPPTAAASSASPGRGDGPRTSSWVLRRPGNDRRPRRTRRGETQR 107


>UniRef50_A1U282 Cluster: Putative uncharacterized protein; n=1;
           Marinobacter aquaeolei VT8|Rep: Putative uncharacterized
           protein - Marinobacter aquaeolei (strain ATCC 700491 /
           DSM 11845 / VT8)(Marinobacter hydrocarbonoclasticus
           (strain DSM 11845))
          Length = 319

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)
 Frame = +2

Query: 218 KFEVDAGEYKSSFSKQ-TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKAL 394
           +FE +  E   S  ++  SL E +      VET   ++++L V A++ + K   E  + L
Sbjct: 106 RFEGELSETGESLQERGASLEEKIAANAEKVETANSEIRKLWVVANERNRKQLEEHGQRL 165

Query: 395 SVVHQDLDEADKD-RDLE 445
           SV+ Q+L E  K   DLE
Sbjct: 166 SVLDQNLAETGKSVSDLE 183


>UniRef50_A0TJ43 Cluster: Putative uncharacterized protein
           precursor; n=12; Burkholderia|Rep: Putative
           uncharacterized protein precursor - Burkholderia
           ambifaria MC40-6
          Length = 740

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 3/50 (6%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDG-AADGPERERPVHHRGGRD--RQPGRHHG 175
           R  R DD+Q   D R   H G A  GP+RERP   R  R   R+   H G
Sbjct: 185 RDERHDDRQRNRDVRAAAHAGPAPPGPDRERPCGPREERQVLRRIAEHRG 234


>UniRef50_Q53MC3 Cluster: Similar to ribulose bisphosphate
           carboxylase/oxygenase activase b, chloroplastprecursor
           (Rubisco activase b) (Ra b) (Putative uncharacterized
           protein) (Os11g0707100 protein) (Expressed protein)
           (Ribulose bisphosphate carboxylase/oxygenase activase b,
           chloroplastprecursor (Rubisco activase b) (Ra
           b)-related); n=2; Oryza sativa|Rep: Similar to ribulose
           bisphosphate carboxylase/oxygenase activase b,
           chloroplastprecursor (Rubisco activase b) (Ra b)
           (Putative uncharacterized protein) (Os11g0707100
           protein) (Expressed protein) (Ribulose bisphosphate
           carboxylase/oxygenase activase b, chloroplastprecursor
           (Rubisco activase b) (Ra b)-related) - Oryza sativa
           subsp. japonica (Rice)
          Length = 366

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 4/76 (5%)
 Frame = +2

Query: 17  DFWHGARYSRFDDKQSPEDGR--VQGHDGAADGP-ERERPVHHRGGRDRQPGRHHGG-DE 184
           D W G  Y   DD+Q    G+  V     A  G    E  V   G ++ QPG+HHG   +
Sbjct: 61  DRWKGLAYDISDDQQDITRGKGLVDSLFQAPMGDGTHEARVPQPGSQNVQPGQHHGHISK 120

Query: 185 DRVRLPGTTSPKFEVD 232
           + ++LP      F+ D
Sbjct: 121 NLMKLPNIQGKSFQCD 136


>UniRef50_A2Y1Q1 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 249

 Score = 33.9 bits (74), Expect = 3.5
 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = +2

Query: 92  DGAADGPERERPVHHRGGR-DRQPGRHHGGDEDRVRLPGTTS 214
           D  AD     R VHH GGR DR+ G    G  DRV  P   S
Sbjct: 82  DKQADLQVMRRRVHHHGGRGDRRAGVRQRGGRDRVSSPSNAS 123


>UniRef50_Q4A6U5 Cluster: Putative ABC transporter protein,
           periplasmic component; n=1; Mycoplasma synoviae 53|Rep:
           Putative ABC transporter protein, periplasmic component
           - Mycoplasma synoviae (strain 53)
          Length = 517

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 6/86 (6%)
 Frame = +2

Query: 197 LPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHN------QEHLVETQMKDLKRLIVTASQS 358
           L G+ SP    D GE KS+     S+  +         Q HLV+    D + L+   +Q 
Sbjct: 431 LLGSLSPYSVSDLGEIKSNNELFDSVFNYGDESVDSWIQAHLVKNFNNDSEELVTLFNQG 490

Query: 359 SAKSDAEIAKALSVVHQDLDEADKDR 436
              +DAE+AK L  ++  L +   DR
Sbjct: 491 LPGTDAEVAKKLQDIYNRLLDQFADR 516


>UniRef50_Q2GK11 Cluster: Ankyrin repeat protein; n=1; Anaplasma
            phagocytophilum HZ|Rep: Ankyrin repeat protein -
            Anaplasma phagocytophilum (strain HZ)
          Length = 3373

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +2

Query: 80   VQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
            V G DG+A+G    RP+    GRD  P    GGD+ R
Sbjct: 2574 VPGQDGSAEGRTPGRPIPAARGRDLGPHGDDGGDKSR 2610


>UniRef50_Q2CHG7 Cluster: Parallel beta-helix repeat protein; n=4;
            cellular organisms|Rep: Parallel beta-helix repeat
            protein - Oceanicola granulosus HTCC2516
          Length = 3143

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 18/36 (50%), Positives = 19/36 (52%)
 Frame = +2

Query: 89   HDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVR 196
            HDGA  G +R      RGGR R   RH  GD DR R
Sbjct: 2495 HDGAGAGGDRRA---RRGGRPRGHRRHDAGDADRGR 2527


>UniRef50_A5KSV3 Cluster: Metal dependent phosphohydrolase; n=1;
           candidate division TM7 genomosp. GTL1|Rep: Metal
           dependent phosphohydrolase - candidate division TM7
           genomosp. GTL1
          Length = 503

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +3

Query: 6   IVASIFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAM- 182
           I+A++ G VLG+ G T+ NH + A      E+ MA++      I    T       + + 
Sbjct: 5   ILAALIGAVLGVGGVTVVNHRRGATAAQRAEKAMAKAQKEASNIVLKATDEAMKARDVLS 64

Query: 183 KTEFAYQEQLAQNLKLMQE 239
           K E   +++L +N   M E
Sbjct: 65  KEESERRKELKKNEDRMLE 83


>UniRef50_Q8ST71 Cluster: Putative uncharacterized protein
           ECU01_0020; n=1; Encephalitozoon cuniculi|Rep: Putative
           uncharacterized protein ECU01_0020 - Encephalitozoon
           cuniculi
          Length = 231

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 22/67 (32%), Positives = 30/67 (44%)
 Frame = -3

Query: 545 QLTLPRMLPNIIGSTLLCRCLLGFDLVPATPWPVPGRGPCQPRRDLGARLRGPSLFPRPT 366
           +L L R  P  +   LLC C+  + L PA       R P  PR+      R   L P P 
Sbjct: 169 RLLLFRSPPPFVAMPLLCACMCSYVLCPAATLSTSRRPPLLPRQ------RPFLLLPSPA 222

Query: 365 WRSTARR 345
            R+++RR
Sbjct: 223 CRTSSRR 229


>UniRef50_Q6BI71 Cluster: Similar to CA4409|IPF13151 Candida
           albicans IPF13151; n=1; Debaryomyces hansenii|Rep:
           Similar to CA4409|IPF13151 Candida albicans IPF13151 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 1016

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +2

Query: 218 KFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALS 397
           K+E    EYK S       I     +   + +++KDL+   + A     + D ++ K +S
Sbjct: 317 KYEYLNSEYKGSTHSNNDNISQSKQEIMHLNSKIKDLEYKYMNAKNMLEQKDDDLNKMMS 376

Query: 398 VVHQDLDEADK-DRDLE 445
            VH D    DK DR ++
Sbjct: 377 SVHDDKTIVDKLDRKVD 393


>UniRef50_Q5KNW3 Cluster: Translation initiation factor eIF-2B
           epsilon subunit, putative; n=1; Filobasidiella
           neoformans|Rep: Translation initiation factor eIF-2B
           epsilon subunit, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 757

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 12/58 (20%), Positives = 32/58 (55%)
 Frame = +2

Query: 215 PKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAK 388
           P   +DAG  K+ +S+  + ++  + ++H +E  + +L+ L++  +    ++  E+ K
Sbjct: 559 PSLSLDAGPDKAFYSEAAASLQRAYEEDHKIENALLELRTLVMGYNAGLERAREEVVK 616


>UniRef50_Q55I79 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 465

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 21/69 (30%), Positives = 27/69 (39%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTS 214
           R + FDD +  E+         A+G ER   V H  G  R+ GR  G             
Sbjct: 359 RDTPFDDDEEDEEEHEMYLSALAEGRERLPSVSHPAGEGRERGRRRGRGRKEEEEEEEDV 418

Query: 215 PKFEVDAGE 241
           P+  VD GE
Sbjct: 419 PESVVDIGE 427


>UniRef50_Q4PBU3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 588

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 20/69 (28%), Positives = 26/69 (37%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTS 214
           R  R     +P   R Q      +G  R  P+  R  R+R PGR   G   R R P    
Sbjct: 516 RTERSGSASAPSSSRQQRGGSVHNGASRPPPMGPRHDRERSPGRGGDGGYRRERSPDRRD 575

Query: 215 PKFEVDAGE 241
                D+G+
Sbjct: 576 DNRRYDSGQ 584


>UniRef50_Q9UPA5 Cluster: Protein bassoon; n=12; Eukaryota|Rep:
            Protein bassoon - Homo sapiens (Human)
          Length = 3926

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 18/53 (33%), Positives = 23/53 (43%)
 Frame = +2

Query: 32   ARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
            AR+S  D  + PE+G +  HD    G       H  G   R  GRH G +  R
Sbjct: 3613 ARHSYHDYDEPPEEG-LWPHDEGGPGRHASAKEHRHGDHGRHSGRHTGEEPGR 3664


>UniRef50_UPI0000DD7B25 Cluster: PREDICTED: hypothetical protein;
           n=1; Homo sapiens|Rep: PREDICTED: hypothetical protein -
           Homo sapiens
          Length = 131

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 16/33 (48%), Positives = 17/33 (51%)
 Frame = -3

Query: 482 LGFDLVPATPWPVPGRGPCQPRRDLGARLRGPS 384
           LG+   PA PWP P  G C     LG   RGPS
Sbjct: 58  LGWGNPPADPWPPPRAGLCARICTLGRGARGPS 90


>UniRef50_Q4SE97 Cluster: Chromosome 4 SCAF14624, whole genome shotgun
            sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 4
            SCAF14624, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1773

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 21/97 (21%), Positives = 52/97 (53%), Gaps = 5/97 (5%)
 Frame = +2

Query: 146  RDRQPGRHHGGDED-----RVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVE 310
            R +Q G H    +D     R +L   ++ K E++  E+ S   K    +E +  +  L++
Sbjct: 864  RSKQDGEHLTSLQDELEMLREQLQEASADKKELEK-EHSSEKMKLEKRVEELEKENALLK 922

Query: 311  TQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDE 421
            ++ +++ ++I+  S SSA   + ++++ + + ++LD+
Sbjct: 923  SEKEEMNQIILQQSLSSAGGGSIVSQSEASLQKELDQ 959


>UniRef50_Q2RZY4 Cluster: Iron(III) ABC transporter, ATP-binding
           protein; n=3; Bacteria|Rep: Iron(III) ABC transporter,
           ATP-binding protein - Salinibacter ruber (strain DSM
           13855)
          Length = 363

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 25/80 (31%), Positives = 35/80 (43%)
 Frame = +2

Query: 140 GGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQM 319
           G  DR+P    GG + RV L  T +P  E D       FS   +L+     QE     + 
Sbjct: 131 GFEDRRPQHLSGGQQQRVALARTLAP--EPDLILLDEPFSNLDALLRQETRQEVRELLKN 188

Query: 320 KDLKRLIVTASQSSAKSDAE 379
           K +  + VT +Q  A S A+
Sbjct: 189 KGMSAVFVTHNQEEALSFAD 208


>UniRef50_A7CFA3 Cluster: Putative uncharacterized protein
           precursor; n=1; Ralstonia pickettii 12D|Rep: Putative
           uncharacterized protein precursor - Ralstonia pickettii
           12D
          Length = 489

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%)
 Frame = +2

Query: 5   HRCLDFWHGARYSRFDDKQSPEDGRVQG-HDGAADGPERERPVHHRGGRDRQPGRHHGGD 181
           H   D  HG       D     DG   G HD   DG       HH G  DR    HHGGD
Sbjct: 276 HHGGDHDHGGDGHHGGDHDHGGDGHHGGDHDHGGDG-------HHGGDHDRGGDGHHGGD 328

Query: 182 ED 187
            D
Sbjct: 329 HD 330



 Score = 32.7 bits (71), Expect = 8.0
 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 1/59 (1%)
 Frame = +2

Query: 17  DFWHGARYSRFDDKQSPEDGRVQG-HDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
           D  HG       D     DG   G HD   DG       HH G  D     HHGGD DR
Sbjct: 268 DHDHGGDGHHGGDHDHGGDGHHGGDHDHGGDG-------HHGGDHDHGGDGHHGGDHDR 319


>UniRef50_A5P3R6 Cluster: LigA; n=1; Methylobacterium sp. 4-46|Rep:
           LigA - Methylobacterium sp. 4-46
          Length = 975

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDE 184
           +D Q PE  R +G   A   P R R V   GGR R+ G   GGD+
Sbjct: 853 EDVQRPEAVRREGQGAAVGRPGRRRRVGS-GGRQRRRGAAGGGDD 896


>UniRef50_A5NP45 Cluster: Peptidoglycan-binding domain 1 protein
            precursor; n=1; Methylobacterium sp. 4-46|Rep:
            Peptidoglycan-binding domain 1 protein precursor -
            Methylobacterium sp. 4-46
          Length = 1476

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 22/59 (37%), Positives = 30/59 (50%)
 Frame = +2

Query: 83   QGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFS 259
            +GH+G   GP R R +  RGGRD Q  RH  G  +  R PG +  +    A   ++S S
Sbjct: 891  RGHEGGRGGPGRLRGL--RGGRDDQGQRHREGAGEAPR-PGCSQHRLASCACVPRTSLS 946


>UniRef50_A2FWC9 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 405

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 29/87 (33%), Positives = 39/87 (44%), Gaps = 1/87 (1%)
 Frame = +3

Query: 39  IAGSTINNHLKMAEFRDMMEQQMARSASVLYT-IAGGGTASRADITEAMKTEFAYQEQLA 215
           I  S I  H     + D+ME Q     ++L+  I       +  I + MK E  +Q+QLA
Sbjct: 224 ILESKIPKHQAEKSYDDIMEMQ--EKTNILFQQINSFEDQIKLSIND-MKNEEEHQDQLA 280

Query: 216 QNLKLMQENINHLSASKLPLSNTCTIR 296
            NLK+ Q N   L   KL L  T   R
Sbjct: 281 NNLKIEQRNSKEL-MQKLGLQETKVTR 306


>UniRef50_Q6MFH6 Cluster: Related to nucleoprotein TPR; n=3;
            Sordariomycetes|Rep: Related to nucleoprotein TPR -
            Neurospora crassa
          Length = 2115

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +2

Query: 275  IEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVH-QDLDEADKDRDLEPA 451
            +E + +Q+  +ET+++ LK  + TA     ++ AE+A+  S  H  D +  D +   +PA
Sbjct: 1525 LESVKSQKAALETELESLKAELATAIAERDEARAEVARLQSSTHGTDTEMQDVEAPAQPA 1584

Query: 452  KVSLEPNQILTGI 490
                 P Q  TG+
Sbjct: 1585 SAP-APAQEGTGL 1596


>UniRef50_UPI00015B58DA Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 265

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 20/85 (23%), Positives = 35/85 (41%)
 Frame = +2

Query: 47  FDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFE 226
           ++ K    D   +G D   +G   E   HH+GG ++    H G  E++       + + E
Sbjct: 164 YEKKHDFYDEFHEGDDHEKNGGHHEHHDHHKGGHEKAGHEHAGKHEEK------KAHRKE 217

Query: 227 VDAGEYKSSFSKQTSLIEHMHNQEH 301
              G ++          EH H+Q+H
Sbjct: 218 HHHGHHQHKHKGHEEKGEHSHHQDH 242


>UniRef50_UPI000155CA05 Cluster: PREDICTED: hypothetical protein;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein - Ornithorhynchus anatinus
          Length = 787

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 24  GTVLGIA-GSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMK 185
           GTVL  A G + +   + AEF   +EQ++   A +L  + G     RAD+T A K
Sbjct: 615 GTVLDAAQGVSCDIDFRAAEFESALEQKIGVLAEILAKVKGFRADLRADLTRAPK 669


>UniRef50_UPI000023CBD6 Cluster: hypothetical protein FG05208.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05208.1 - Gibberella zeae PH-1
          Length = 1095

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 6/99 (6%)
 Frame = +2

Query: 218 KFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALS 397
           +F++D       FS +   ++ +++Q   +  Q   LKR I    + + KSDAE  + L+
Sbjct: 497 EFDIDEAFSLPGFSNR---VQWLYSQTTTLANQKSILKRQIKQQRELNNKSDAEKDEELA 553

Query: 398 VVHQDLDE-----ADKDRDLEPAKVSLEPN-QILTGIGI 496
              ++LDE     A  +RD   A   LE   + L G G+
Sbjct: 554 RKQEELDETQVLLARAERDASTAHAMLEQTLEQLEGTGV 592


>UniRef50_Q9DDV9 Cluster: Complement component C3-4; n=2;
           Clupeocephala|Rep: Complement component C3-4 -
           Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
          Length = 1684

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +2

Query: 572 GSLILESGHIFYLFISINGLLFKSLYLSVN 661
           G  +L+  HI   F  IN LL KSLY+SVN
Sbjct: 248 GKAVLKRQHINKTFTDINMLLHKSLYISVN 277


>UniRef50_Q5WCN8 Cluster: Putative uncharacterized protein; n=1;
           Bacillus clausii KSM-K16|Rep: Putative uncharacterized
           protein - Bacillus clausii (strain KSM-K16)
          Length = 187

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 26/111 (23%), Positives = 39/111 (35%)
 Frame = +2

Query: 86  GHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQ 265
           G    +D PE E+P H   G D     HHG       +P       E D   Y    SK 
Sbjct: 18  GCGAGSDNPEPEQPAHEETG-DHNSEHHHGDHSSSGEVPEGLK---EADNPSYPVG-SKA 72

Query: 266 TSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLD 418
           T    HM   +    T +          S +    +A +     V+H++++
Sbjct: 73  TMEANHMPGMKGTEATIVGAYTTTAYAVSYTPTTGEAPVENHKWVIHEEVE 123


>UniRef50_Q18QP3 Cluster: TRAP transporter, 4TM/12TM fusion protein;
           n=2; Desulfitobacterium hafniense|Rep: TRAP transporter,
           4TM/12TM fusion protein - Desulfitobacterium hafniense
           (strain DCB-2)
          Length = 649

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 11/31 (35%), Positives = 19/31 (61%)
 Frame = -3

Query: 536 LPRMLPNIIGSTLLCRCLLGFDLVPATPWPV 444
           LP ++ ++IG+T +C  + G+   P   WPV
Sbjct: 573 LPIIITSVIGTTAICMAIQGYAFTPIRHWPV 603


>UniRef50_Q7X6D4 Cluster: OSJNBa0014K14.16 protein; n=7; Oryza
           sativa|Rep: OSJNBa0014K14.16 protein - Oryza sativa
           (Rice)
          Length = 622

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  DKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPG--TTSPKFE 226
           +  S E+ RV    GA DG    + +   G R     R   G ED   + G      K +
Sbjct: 245 ESSSSENKRVDSPGGAVDGAVPRKSIDTFGQRT-SIYRGIDGQEDMKLICGIIAVGEKAK 303

Query: 227 VDAGEYKSSFSKQTSLIEHMHNQEHL 304
           V  G+  S++ K+   ++HM  QE++
Sbjct: 304 VARGDRMSNYEKELEEMKHMTRQEYI 329


>UniRef50_Q2QLL0 Cluster: Expressed protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Expressed protein - Oryza
           sativa subsp. japonica (Rice)
          Length = 594

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 16/37 (43%), Positives = 19/37 (51%)
 Frame = +2

Query: 74  GRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDE 184
           G V+G  GAADGP  +  V  RG      G  H GD+
Sbjct: 348 GHVRGAPGAADGPAADEVVGVRGAGGVDGGVQHDGDD 384


>UniRef50_A4S3Z7 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 1069

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 2/73 (2%)
 Frame = +3

Query: 84  RDMMEQQMARSASVLYTIAGGGTASRADIT--EAMKTEFAYQEQLAQNLKLMQENINHLS 257
           R+ +   +AR          GG A RA  T  EA+   F Y   +A ++ L   +I H S
Sbjct: 189 REDVVSALARGVLATEEETMGGDARRAPATLREALCRAFGYSPAIADHVALTA-SIEHGS 247

Query: 258 ASKLPLSNTCTIR 296
            + LPLS  C  R
Sbjct: 248 NASLPLSEACVDR 260


>UniRef50_Q38BG2 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 246

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = +2

Query: 26  HGARYSRFDDKQSP-EDGRVQ-GHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRL 199
           +GA   R D K    E G+VQ G  G     E+ER      G     G+   G+E +V  
Sbjct: 142 NGAGGGRSDSKNDKAESGKVQSGSGGKGKEEEKEREGEGENGNGNGKGKGKDGEETQVGK 201

Query: 200 PGTTSPKFE 226
            GTT+   E
Sbjct: 202 KGTTNASNE 210


>UniRef50_A2FEY1 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 360

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query: 218 KFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKD-LKRLIVTASQSSAKSDAEIAKAL 394
           K  +  G+ ++S  + T+ IE++  ++++ ++Q  + L  L       S +S A I++A 
Sbjct: 286 KASIKCGQIQNSIEESTTNIENI--KKNMSQSQTNEMLGELTQKCQNCSDESKAAISEAK 343

Query: 395 SVVHQDLDEADKD 433
            +V Q +DE DK+
Sbjct: 344 DIVKQTVDEFDKN 356


>UniRef50_P50546 Cluster: DNA-directed RNA polymerase subunit beta;
           n=177; Spermatophyta|Rep: DNA-directed RNA polymerase
           subunit beta - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1072

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 9   VASIFGTVLGIAGSTINNHLKMAEFRDMMEQQMAR 113
           V  IF   LG+AGS ++ H ++A F +  EQ+ +R
Sbjct: 865 VGQIFECSLGLAGSLLDRHYRIAPFDERYEQEASR 899


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 651,187,789
Number of Sequences: 1657284
Number of extensions: 13973091
Number of successful extensions: 55997
Number of sequences better than 10.0: 59
Number of HSP's better than 10.0 without gapping: 51953
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55841
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50000004659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -