SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P17500 Cluster: Major capsid protein; n=15; Nucleopolyh...   129   5e-29
UniRef50_P35840 Cluster: Major capsid protein; n=12; Nucleopolyh...    88   1e-16
UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata nucleopolyh...    81   3e-14
UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxoph...    79   7e-14
UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata ...    76   9e-13
UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP...    66   7e-10
UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum granulovir...    52   1e-05
UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3; Nuc...    49   1e-04
UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostel...    46   8e-04
UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep: Vp3...    46   8e-04
UniRef50_P41477 Cluster: Late expression factor 4; n=13; Nucleop...    44   0.002
UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -...    41   0.022
UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea o...    36   0.84 
UniRef50_Q16SU8 Cluster: Vacuolar protein sorting-associated pro...    35   2.0  

>UniRef50_P17500 Cluster: Major capsid protein; n=15;
           Nucleopolyhedrovirus|Rep: Major capsid protein - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 351

 Score =  129 bits (312), Expect = 5e-29
 Identities = 61/85 (71%), Positives = 69/85 (81%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKMSKMVLPI+DEDDNQ+K TIARHLVG+KERG+KRIL+P+  NY  VFNL  MM AEQL
Sbjct: 56  FKMSKMVLPIYDEDDNQYKRTIARHLVGHKERGVKRILVPTRANYMTVFNLPGMMLAEQL 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVF 506
           IFHLIY+N   VN IC +LK  E F
Sbjct: 116 IFHLIYDNRLEVNRICASLKNNENF 140



 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 34/65 (52%), Positives = 43/65 (66%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+  G++ R+   N CIF +I  FD+C+TY+SPCS DA  DDGWFIC+ HL  R K  
Sbjct: 1   MALVSPGVSSRRS-TNHCIFGAIEPFDSCVTYRSPCSSDASVDDGWFICDYHLKLRFKMS 59

Query: 265 KWFCP 279
           K   P
Sbjct: 60  KMVLP 64



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +2

Query: 500 SFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRDELRFFD 625
           +F   T  V+ SVY+ TR+IL  T+P  +CSRV+ D++RFFD
Sbjct: 139 NFIDNTYSVVESVYSATRNILSLTDPQAYCSRVANDDVRFFD 180


>UniRef50_P35840 Cluster: Major capsid protein; n=12;
           Nucleopolyhedrovirus|Rep: Major capsid protein -
           Lymantria dispar multicapsid nuclear polyhedrosis virus
           (LdMNPV)
          Length = 356

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 41/85 (48%), Positives = 56/85 (65%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FK+ KMVLPI D + N +  T+ + LV +K  G  R+LIP+  NY+ V NLNSM  AEQL
Sbjct: 56  FKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQL 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVF 506
           + H+IY+N EA   +C  L++ E F
Sbjct: 116 VTHMIYDNVEAQGAVCKALQHNENF 140



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 28/65 (43%), Positives = 41/65 (63%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+   ++  ++R N C+F ++  FD C  Y SPCSPD+ ++DGWFIC+ H   R K +
Sbjct: 1   MALVSGALSTNRLR-NYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIE 59

Query: 265 KWFCP 279
           K   P
Sbjct: 60  KMVLP 64


>UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: VP39 - Clanis bilineata
           nucleopolyhedrosis virus
          Length = 350

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 40/85 (47%), Positives = 52/85 (61%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKM KMVLPI D D      T+AR LV +K  G +RIL+P+  NY  V N+ ++  AEQ 
Sbjct: 56  FKMEKMVLPIPDADGTALNRTLARSLVNHKAIGDERILVPTKRNYMSVLNILALQLAEQY 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVF 506
           IFH+IY N+     IC  L+ +E F
Sbjct: 116 IFHIIYENDVERERICQMLEISERF 140



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 33/65 (50%), Positives = 42/65 (64%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+  GMA  ++  N CIF S+  FDAC  Y+SPCS DA ++DGW IC+ HL  R K +
Sbjct: 1   MALVVSGMATGRIN-NYCIFGSVQPFDACGPYRSPCSDDAKNNDGWLICDYHLSTRFKME 59

Query: 265 KWFCP 279
           K   P
Sbjct: 60  KMVLP 64



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +2

Query: 488 KIYRSFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRDELRFFDVTNGPN 643
           +I   F + T +V+ ++ A T +I+    PN +CSR    + R + VT+  N
Sbjct: 135 EISERFENDTYKVVDTINARTSAIMAMVTPNRYCSRPLYTDDRIWSVTDENN 186


>UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxophyes
           honmai NPV|Rep: Major capsid protein VP39 - Adoxophyes
           honmai nucleopolyhedrovirus
          Length = 312

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 39/85 (45%), Positives = 50/85 (58%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKM KM L I D D+     T+ R LV + E G  RIL+P+  NY+ V N+  +  AE L
Sbjct: 56  FKMEKMSLAIPDADNKVLFRTVGRSLVKHTEEGTARILVPNKNNYESVLNVQDLPLAEAL 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVF 506
           I H+IY N E    IC+ LK+TE F
Sbjct: 116 IIHMIYENLEKQKEICERLKFTEHF 140



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 28/61 (45%), Positives = 36/61 (59%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+P G+   +   N CIFA + SFDAC  Y + CS DA  +DGW+IC  H     K +
Sbjct: 1   MALVPAGLTSSRSNSN-CIFAGVQSFDACYRYPNECSKDADSNDGWYICEYHASVHFKME 59

Query: 265 K 267
           K
Sbjct: 60  K 60



 Score = 33.5 bits (73), Expect = 4.5
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +2

Query: 527 IHSVYATTRSILDTTNPNTFCSRVSRDELRFF--DVTNGP 640
           +  +Y+ T S+L+  NP+ FC+ VS   LR F  ++ N P
Sbjct: 147 VQKLYSNTMSVLNMANPDHFCAEVSLTSLRQFSNEIGNEP 186


>UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata
           NPV-A|Rep: Vp39 capsid - Mamestra configurata NPV-A
          Length = 325

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 37/85 (43%), Positives = 52/85 (61%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           F+M KMVLPI D +   +  ++ + L+   E    R+LIP+ TNY++V  L SM   EQL
Sbjct: 55  FRMEKMVLPIPDAEGTIYNRSVGKSLISGTESN--RVLIPTKTNYEDVLKLPSMSLPEQL 112

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVF 506
           IFH+IY+  +  N IC  L+Y E F
Sbjct: 113 IFHMIYDEPDKQNEICKLLQYNENF 137



 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 33/65 (50%), Positives = 38/65 (58%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL P G    Q + N CIF +I  FD C TY SPCS DA  +DGWFIC  HL  R + +
Sbjct: 1   MALTPYGS--NQPQSNNCIFGAIRPFDTCRTYSSPCSNDASQEDGWFICEYHLSIRFRME 58

Query: 265 KWFCP 279
           K   P
Sbjct: 59  KMVLP 63



 Score = 39.1 bits (87), Expect = 0.091
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +2

Query: 500 SFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRDELRFF 622
           +FHS   +V+  VY  T  +L  TNP  FC+RV+ +  R +
Sbjct: 136 NFHSDLYKVVERVYNKTAEVLAKTNPERFCARVNINNFRSY 176


>UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP39
           - Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 302

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 33/85 (38%), Positives = 47/85 (55%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FK+ K  + I D    +    + + LV +  R   RILIP+  NYQ V N++ +  AE+L
Sbjct: 58  FKIEKTSIAIPDGTGQKLYRIVGKSLVSHNARANDRILIPTQENYQAVMNVSMLPPAERL 117

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVF 506
           + HLIYNN  A   IC+ L+  E F
Sbjct: 118 VLHLIYNNRTAAAEICNQLRQQENF 142



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASI--VSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLK 258
           MAL+  G A  +M+ N CIF  +  + F+ C  Y+SPCS DA  +DG F+C  HL +  K
Sbjct: 1   MALVSGGNANSRMK-NYCIFQGVRPIEFNQCSNYRSPCSDDASQNDGVFMCQYHLSRFFK 59

Query: 259 CQK 267
            +K
Sbjct: 60  IEK 62


>UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum
           granulovirus|Rep: ORF086 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 292

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/86 (29%), Positives = 43/86 (50%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKM KMV+ I      +F M I + L+       +RI+IP  +N+     + +M   E+ 
Sbjct: 54  FKMEKMVVRIGSGVGPEFDMLIGKTLIQQNTEDARRIMIPLPSNFLTYLQVENMSATEKF 113

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVFT 509
           +F+ IY  ++ +  +C  L   E +T
Sbjct: 114 VFYSIYERQDLIAELCRGLVSQEYYT 139



 Score = 40.3 bits (90), Expect = 0.039
 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +1

Query: 130 NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQK 267
           N CIF  +    F  C  Y+ PC    Y+DDG FIC  HL K  K +K
Sbjct: 12  NLCIFQGVQPPEFLNCRPYEPPCI-QPYNDDGTFICQYHLAKYFKMEK 58


>UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3;
           Nucleopolyhedrovirus|Rep: Major viral capsid protein 39
           - Neodiprion abietis nucleopolyhedrovirus
          Length = 315

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 16/45 (35%), Positives = 33/45 (73%)
 Frame = +3

Query: 357 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 491
           R+++P+  NY+++F +  +  + QL+FHL+Y N+ A++ IC ++K
Sbjct: 104 RVIVPTRRNYEDIFKVAYLPISYQLVFHLLYQNQSAIDKICQDVK 148


>UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF79 peptide - Plutella xylostella
           granulovirus
          Length = 320

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 5/91 (5%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           F + KM L I       FK+ I + LV  ++   + I+IPS  NY +   +N+M  AE+ 
Sbjct: 54  FPLEKMTLEIPSGTGTSFKLLIGKSLV--QQDATRNIIIPSKANYIDYLRVNNMSPAEKF 111

Query: 432 IFHLIYNNEEA-----VNVICDNLKYTEVFT 509
           I + IY          +  +C++L+  + +T
Sbjct: 112 IMYSIYGESATEPTGLITQLCESLRSQDFYT 142



 Score = 40.7 bits (91), Expect = 0.030
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +1

Query: 106 MAPRQMRV-NRCIFASIVSFDA--CITYKSPCSPDAYHDDGWFICNSHL 243
           M+ RQ RV N CIF ++   ++  C      CS DA +DDG FICN HL
Sbjct: 2   MSLRQNRVYNNCIFQAVSYSNSSLCADPVLHCSKDASNDDGTFICNHHL 50


>UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep:
           Vp39-capsid - Adoxophyes orana granulovirus (AoGV)
          Length = 291

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 26/62 (41%), Positives = 33/62 (53%), Gaps = 6/62 (9%)
 Frame = +1

Query: 100 VGMAPRQMRVNRCIFASIVS----FDACITYKSPCSPDAYHD--DGWFICNSHLIKRLKC 261
           + + P ++  N CIF  +V     +  C  Y SPCSPDA +   DG FICN HL K  K 
Sbjct: 4   INVGPCELN-NYCIFQGVVGMMPDYYRCENYSSPCSPDASNSNLDGTFICNYHLNKYFKI 62

Query: 262 QK 267
            K
Sbjct: 63  LK 64



 Score = 37.9 bits (84), Expect = 0.21
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQ-FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQ 428
           FK+ K    I    DN+ FKM + + L+   +    +  +    +++     +S    E+
Sbjct: 60  FKILKSSFRIPSGKDNKSFKMLVGQSLLQQTDNDTNKNKVLIPLDHELYLKTSSRNSVER 119

Query: 429 LIFHLIYNNEEAVNVICDNLKYTEVF 506
           +I + IYN++E +  +CD L   E F
Sbjct: 120 MIIYTIYNDKEKIKDLCDILMKQEFF 145


>UniRef50_P41477 Cluster: Late expression factor 4; n=13;
          Nucleopolyhedrovirus|Rep: Late expression factor 4 -
          Autographa californica nuclear polyhedrosis virus
          (AcMNPV)
          Length = 464

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/22 (86%), Positives = 22/22 (100%)
 Frame = -3

Query: 66 MDHGNFMIEKEISYSINFSQDL 1
          MD+G+F+IEKEISYSINFSQDL
Sbjct: 1  MDYGDFVIEKEISYSINFSQDL 22


>UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 329

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +1

Query: 130 NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQK 267
           N CIF  +    F  C  Y  PCS D  + DG F+C+ HL +  K +K
Sbjct: 16  NLCIFQGVQPPEFMNCGIYTPPCSDDCVNKDGTFVCSYHLARYFKLKK 63



 Score = 38.3 bits (85), Expect = 0.16
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDN-QFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQ 428
           FK+ K V  I    +N  FK  +   L+        RI IP+  NY    N+ +M   E+
Sbjct: 59  FKLKKEVFEIPSGVNNTSFKYLVGVSLIQQNVPTANRITIPAKDNYYSYLNVANMSSMEK 118

Query: 429 LIFHLIYNNEEAV 467
            +F+ IY+  + V
Sbjct: 119 YVFYSIYDEPDTV 131


>UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea
           operculella granulovirus|Rep: Capsid protein VP39 -
           Phthorimaea operculella granulovirus
          Length = 293

 Score = 35.9 bits (79), Expect = 0.84
 Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
 Frame = +1

Query: 130 NRCIFASI-VSFDACITYKSPCSPDAYHD--DGWFICNSHLIKRLKCQK 267
           N CIF  +   FD C  Y   CS DA +   DG FICN HL K  +  K
Sbjct: 13  NYCIFQGVNYQFD-CDGYTRQCSEDARYSQLDGTFICNFHLGKYFRILK 60


>UniRef50_Q16SU8 Cluster: Vacuolar protein sorting-associated protein;
            n=3; Fungi/Metazoa group|Rep: Vacuolar protein
            sorting-associated protein - Aedes aegypti (Yellowfever
            mosquito)
          Length = 3659

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +3

Query: 270  VLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIY 449
            VLPIF+ED    K+ + R  + N     KRI I    N+   FN+ +     Q  F+ + 
Sbjct: 2252 VLPIFEEDVEDEKLFVVR--IENLSNAQKRITIEGQINF---FNMTTQRLKIQYKFYKVI 2306

Query: 450  NNEE----AVNVICDNLKYTEVFTAARNALYTAF 539
             N E    + + + D      VF AA N    +F
Sbjct: 2307 PNSEKHYVSTSFLIDGGSNANVFGAANNKNQQSF 2340


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 622,104,374
Number of Sequences: 1657284
Number of extensions: 11675696
Number of successful extensions: 28219
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 27320
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28210
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 48955894634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -