SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120004.Seq
         (720 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P17500 Cluster: Major capsid protein; n=15; Nucleopolyh...   131   1e-29
UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata nucleopolyh...    95   2e-18
UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata ...    94   3e-18
UniRef50_P35840 Cluster: Major capsid protein; n=12; Nucleopolyh...    89   8e-17
UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxoph...    78   2e-13
UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP...    65   2e-09
UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum granulovir...    50   8e-05
UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3; Nuc...    49   1e-04
UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep: Vp3...    46   0.001
UniRef50_P41477 Cluster: Late expression factor 4; n=13; Nucleop...    44   0.003
UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostel...    44   0.005
UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -...    41   0.027
UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea o...    36   1.0  
UniRef50_A6S1X1 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_A3M7C3 Cluster: Putative transcriptional regulator; n=1...    33   5.4  
UniRef50_A7JYK0 Cluster: FAD/FMN-containing dehydrogenase; n=2; ...    33   7.1  
UniRef50_A0D4D7 Cluster: Chromosome undetermined scaffold_37, wh...    33   9.4  

>UniRef50_P17500 Cluster: Major capsid protein; n=15;
           Nucleopolyhedrovirus|Rep: Major capsid protein - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 351

 Score =  131 bits (317), Expect = 1e-29
 Identities = 86/219 (39%), Positives = 117/219 (53%), Gaps = 7/219 (3%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+  G++ R+   N CIF +I  FD+C+TY+SPCS DA  DDGWFIC+ HL  R K  
Sbjct: 1   MALVSPGVSSRRS-TNHCIFGAIEPFDSCVTYRSPCSSDASVDDGWFICDYHLKLRFKMS 59

Query: 265 KWFCPFSTKTTINSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*---S 435
           K   P   +     K R++   L   KE       +   +  R    TV   P       
Sbjct: 60  KMVLPIYDEDDNQYK-RTIARHLVGHKERG----VKRILVPTRANYMTVFNLPGMMLAEQ 114

Query: 436 FI*YITTKRRLT---LYATI*NIPKFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRD 606
            I ++    RL    + A++ N   F   T  V+ SVY+ TR+IL  T+P  +CSRV+ D
Sbjct: 115 LIFHLIYDNRLEVNRICASLKNNENFIDNTYSVVESVYSATRNILSLTDPQAYCSRVAND 174

Query: 607 ELRFFDVTNA-RTHRGGVGDQLFNNYSGFLQNLIRRAVA 720
           ++RFFD       ++ G GD +FNN  GFL+NLIRRAVA
Sbjct: 175 DVRFFDANVVDNNYQAGNGDTVFNNMPGFLRNLIRRAVA 213



 Score =  128 bits (309), Expect = 1e-28
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKMSKMVLPI+DEDDNQ+K TIARHLVG+KERG+KRIL+P+  NY  VFNL  MM AEQL
Sbjct: 56  FKMSKMVLPIYDEDDNQYKRTIARHLVGHKERGVKRILVPTRANYMTVFNLPGMMLAEQL 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTE 500
           IFHLIY+N   VN IC +LK  E
Sbjct: 116 IFHLIYDNRLEVNRICASLKNNE 138


>UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: VP39 - Clanis bilineata
           nucleopolyhedrosis virus
          Length = 350

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 74/218 (33%), Positives = 105/218 (48%), Gaps = 7/218 (3%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+  GMA  ++  N CIF S+  FDAC  Y+SPCS DA ++DGW IC+ HL  R K +
Sbjct: 1   MALVVSGMATGRIN-NYCIFGSVQPFDACGPYRSPCSDDAKNNDGWLICDYHLSTRFKME 59

Query: 265 KWFCPF--STKTTINSK*RSLGI*LEIKKEVSSEF*FQAQPITKR-----CLI*TV*CKP 423
           K   P   +  T +N   R+L   L   K +  E   +    TKR       I  +    
Sbjct: 60  KMVLPIPDADGTALN---RTLARSLVNHKAIGDE---RILVPTKRNYMSVLNILALQLAE 113

Query: 424 NN*SFI*YITTKRRLTLYATI*NIPKFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSR 603
                I Y     R  +   +    +F + T +V+ ++ A T +I+    PN +CSR   
Sbjct: 114 QYIFHIIYENDVERERICQMLEISERFENDTYKVVDTINARTSAIMAMVTPNRYCSRPLY 173

Query: 604 DELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAV 717
            + R + VT+       VG Q+FN    FLQNLI +AV
Sbjct: 174 TDDRIWSVTD----ENNVGGQVFNEMPPFLQNLISKAV 207



 Score = 79.4 bits (187), Expect = 8e-14
 Identities = 39/83 (46%), Positives = 51/83 (61%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKM KMVLPI D D      T+AR LV +K  G +RIL+P+  NY  V N+ ++  AEQ 
Sbjct: 56  FKMEKMVLPIPDADGTALNRTLARSLVNHKAIGDERILVPTKRNYMSVLNILALQLAEQY 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTE 500
           IFH+IY N+     IC  L+ +E
Sbjct: 116 IFHIIYENDVERERICQMLEISE 138


>UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata
           NPV-A|Rep: Vp39 capsid - Mamestra configurata NPV-A
          Length = 325

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 70/214 (32%), Positives = 100/214 (46%), Gaps = 2/214 (0%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL P G    Q + N CIF +I  FD C TY SPCS DA  +DGWFIC  HL  R + +
Sbjct: 1   MALTPYGS--NQPQSNNCIFGAIRPFDTCRTYSSPCSNDASQEDGWFICEYHLSIRFRME 58

Query: 265 KWFCPF-STKTTINSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SF- 438
           K   P    + TI +  RS+G  L I    S+      +   +  L       P    F 
Sbjct: 59  KMVLPIPDAEGTIYN--RSVGKSL-ISGTESNRVLIPTKTNYEDVLKLPSMSLPEQLIFH 115

Query: 439 I*YITTKRRLTLYATI*NIPKFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRDELRF 618
           + Y    ++  +   +     FHS   +V+  VY  T  +L  TNP  FC+RV+ +  R 
Sbjct: 116 MIYDEPDKQNEICKLLQYNENFHSDLYKVVERVYNKTAEVLAKTNPERFCARVNINNFRS 175

Query: 619 FDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVA 720
           +   +       + +  +N   GFL+NLI ++VA
Sbjct: 176 YGTAD----ETDIANVTYNAMPGFLKNLINKSVA 205



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 38/98 (38%), Positives = 56/98 (57%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           F+M KMVLPI D +   +  ++ + L+   E    R+LIP+ TNY++V  L SM   EQL
Sbjct: 55  FRMEKMVLPIPDAEGTIYNRSVGKSLISGTESN--RVLIPTKTNYEDVLKLPSMSLPEQL 112

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVSQRHATRYTQRLRN 545
           IFH+IY+  +  N IC  L+Y E       +  +R+ N
Sbjct: 113 IFHMIYDEPDKQNEICKLLQYNENFHSDLYKVVERVYN 150


>UniRef50_P35840 Cluster: Major capsid protein; n=12;
           Nucleopolyhedrovirus|Rep: Major capsid protein -
           Lymantria dispar multicapsid nuclear polyhedrosis virus
           (LdMNPV)
          Length = 356

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 43/98 (43%), Positives = 60/98 (61%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FK+ KMVLPI D + N +  T+ + LV +K  G  R+LIP+  NY+ V NLNSM  AEQL
Sbjct: 56  FKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQL 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVSQRHATRYTQRLRN 545
           + H+IY+N EA   +C  L++ E  Q    R  + + N
Sbjct: 116 VTHMIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFN 153



 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 59/214 (27%), Positives = 102/214 (47%), Gaps = 2/214 (0%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+   ++  ++R N C+F ++  FD C  Y SPCSPD+ ++DGWFIC+ H   R K +
Sbjct: 1   MALVSGALSTNRLR-NYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIE 59

Query: 265 KWFCPFSTKTTINSK*RSLGI*LEIKKEV-SSEF*FQAQPITKRCL-I*TV*CKPNN*SF 438
           K   P       N   R++G  L   K + ++      +   K  L + ++       + 
Sbjct: 60  KMVLPIPDAEG-NIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTH 118

Query: 439 I*YITTKRRLTLYATI*NIPKFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRDELRF 618
           + Y   + +  +   + +   F + T R+   ++  T +IL  TNP  +CS+V+ +  R 
Sbjct: 119 MIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARI 178

Query: 619 FDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVA 720
           +   +       V   +F +   FL+NLI  AVA
Sbjct: 179 WTTDDV-----NVAGNVFESMPPFLKNLINVAVA 207


>UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxophyes
           honmai NPV|Rep: Major capsid protein VP39 - Adoxophyes
           honmai nucleopolyhedrovirus
          Length = 312

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 38/83 (45%), Positives = 49/83 (59%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKM KM L I D D+     T+ R LV + E G  RIL+P+  NY+ V N+  +  AE L
Sbjct: 56  FKMEKMSLAIPDADNKVLFRTVGRSLVKHTEEGTARILVPNKNNYESVLNVQDLPLAEAL 115

Query: 432 IFHLIYNNEEAVNVICDNLKYTE 500
           I H+IY N E    IC+ LK+TE
Sbjct: 116 IIHMIYENLEKQKEICERLKFTE 138



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 28/61 (45%), Positives = 36/61 (59%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQ 264
           MAL+P G+   +   N CIFA + SFDAC  Y + CS DA  +DGW+IC  H     K +
Sbjct: 1   MALVPAGLTSSRSNSN-CIFAGVQSFDACYRYPNECSKDADSNDGWYICEYHASVHFKME 59

Query: 265 K 267
           K
Sbjct: 60  K 60



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = +1

Query: 526 IHSVYATTRSILDTTNPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLI 705
           +  +Y+ T S+L+  NP+ FC+ VS   LR F   +         D  F  +  F++NL+
Sbjct: 147 VQKLYSNTMSVLNMANPDHFCAEVSLTSLRQF---SNEIGNEPAQDTNFELFPKFIKNLV 203

Query: 706 RRAVA 720
            +AVA
Sbjct: 204 TKAVA 208


>UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP39
           - Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 302

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 32/83 (38%), Positives = 46/83 (55%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FK+ K  + I D    +    + + LV +  R   RILIP+  NYQ V N++ +  AE+L
Sbjct: 58  FKIEKTSIAIPDGTGQKLYRIVGKSLVSHNARANDRILIPTQENYQAVMNVSMLPPAERL 117

Query: 432 IFHLIYNNEEAVNVICDNLKYTE 500
           + HLIYNN  A   IC+ L+  E
Sbjct: 118 VLHLIYNNRTAAAEICNQLRQQE 140



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +1

Query: 85  MALMPVGMAPRQMRVNRCIFASI--VSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLK 258
           MAL+  G A  +M+ N CIF  +  + F+ C  Y+SPCS DA  +DG F+C  HL +  K
Sbjct: 1   MALVSGGNANSRMK-NYCIFQGVRPIEFNQCSNYRSPCSDDASQNDGVFMCQYHLSRFFK 59

Query: 259 CQK 267
            +K
Sbjct: 60  IEK 62


>UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum
           granulovirus|Rep: ORF086 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 292

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 27/90 (30%), Positives = 45/90 (50%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           FKM KMV+ I      +F M I + L+       +RI+IP  +N+     + +M   E+ 
Sbjct: 54  FKMEKMVVRIGSGVGPEFDMLIGKTLIQQNTEDARRIMIPLPSNFLTYLQVENMSATEKF 113

Query: 432 IFHLIYNNEEAVNVICDNLKYTEVSQRHAT 521
           +F+ IY  ++ +  +C  L    VSQ + T
Sbjct: 114 VFYSIYERQDLIAELCRGL----VSQEYYT 139



 Score = 40.3 bits (90), Expect = 0.047
 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +1

Query: 130 NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQK 267
           N CIF  +    F  C  Y+ PC    Y+DDG FIC  HL K  K +K
Sbjct: 12  NLCIFQGVQPPEFLNCRPYEPPCI-QPYNDDGTFICQYHLAKYFKMEK 58


>UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3;
           Nucleopolyhedrovirus|Rep: Major viral capsid protein 39
           - Neodiprion abietis nucleopolyhedrovirus
          Length = 315

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 16/45 (35%), Positives = 33/45 (73%)
 Frame = +3

Query: 357 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 491
           R+++P+  NY+++F +  +  + QL+FHL+Y N+ A++ IC ++K
Sbjct: 104 RVIVPTRRNYEDIFKVAYLPISYQLVFHLLYQNQSAIDKICQDVK 148


>UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep:
           Vp39-capsid - Adoxophyes orana granulovirus (AoGV)
          Length = 291

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 26/62 (41%), Positives = 33/62 (53%), Gaps = 6/62 (9%)
 Frame = +1

Query: 100 VGMAPRQMRVNRCIFASIVS----FDACITYKSPCSPDAYHD--DGWFICNSHLIKRLKC 261
           + + P ++  N CIF  +V     +  C  Y SPCSPDA +   DG FICN HL K  K 
Sbjct: 4   INVGPCELN-NYCIFQGVVGMMPDYYRCENYSSPCSPDASNSNLDGTFICNYHLNKYFKI 62

Query: 262 QK 267
            K
Sbjct: 63  LK 64



 Score = 36.7 bits (81), Expect = 0.58
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQ-FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQ 428
           FK+ K    I    DN+ FKM + + L+   +    +  +    +++     +S    E+
Sbjct: 60  FKILKSSFRIPSGKDNKSFKMLVGQSLLQQTDNDTNKNKVLIPLDHELYLKTSSRNSVER 119

Query: 429 LIFHLIYNNEEAVNVICDNLKYTEVSQRHA 518
           +I + IYN++E +  +CD L   E  ++ A
Sbjct: 120 MIIYTIYNDKEKIKDLCDILMKQEFFEQPA 149


>UniRef50_P41477 Cluster: Late expression factor 4; n=13;
          Nucleopolyhedrovirus|Rep: Late expression factor 4 -
          Autographa californica nuclear polyhedrosis virus
          (AcMNPV)
          Length = 464

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 19/22 (86%), Positives = 22/22 (100%)
 Frame = -1

Query: 66 MDHGNFMIEKEISYSINFSQDL 1
          MD+G+F+IEKEISYSINFSQDL
Sbjct: 1  MDYGDFVIEKEISYSINFSQDL 22


>UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF79 peptide - Plutella xylostella
           granulovirus
          Length = 320

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 5/85 (5%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQL 431
           F + KM L I       FK+ I + LV  ++   + I+IPS  NY +   +N+M  AE+ 
Sbjct: 54  FPLEKMTLEIPSGTGTSFKLLIGKSLV--QQDATRNIIIPSKANYIDYLRVNNMSPAEKF 111

Query: 432 IFHLIYNNEEA-----VNVICDNLK 491
           I + IY          +  +C++L+
Sbjct: 112 IMYSIYGESATEPTGLITQLCESLR 136



 Score = 40.7 bits (91), Expect = 0.035
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +1

Query: 106 MAPRQMRV-NRCIFASIVSFDA--CITYKSPCSPDAYHDDGWFICNSHL 243
           M+ RQ RV N CIF ++   ++  C      CS DA +DDG FICN HL
Sbjct: 2   MSLRQNRVYNNCIFQAVSYSNSSLCADPVLHCSKDASNDDGTFICNHHL 50


>UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 329

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%)
 Frame = +1

Query: 130 NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQK 267
           N CIF  +    F  C  Y  PCS D  + DG F+C+ HL +  K +K
Sbjct: 16  NLCIFQGVQPPEFMNCGIYTPPCSDDCVNKDGTFVCSYHLARYFKLKK 63



 Score = 38.3 bits (85), Expect = 0.19
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +3

Query: 252 FKMSKMVLPIFDEDDN-QFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQ 428
           FK+ K V  I    +N  FK  +   L+        RI IP+  NY    N+ +M   E+
Sbjct: 59  FKLKKEVFEIPSGVNNTSFKYLVGVSLIQQNVPTANRITIPAKDNYYSYLNVANMSSMEK 118

Query: 429 LIFHLIYNNEEAV 467
            +F+ IY+  + V
Sbjct: 119 YVFYSIYDEPDTV 131


>UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea
           operculella granulovirus|Rep: Capsid protein VP39 -
           Phthorimaea operculella granulovirus
          Length = 293

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
 Frame = +1

Query: 130 NRCIFASI-VSFDACITYKSPCSPDAYHD--DGWFICNSHLIKRLKCQK 267
           N CIF  +   FD C  Y   CS DA +   DG FICN HL K  +  K
Sbjct: 13  NYCIFQGVNYQFD-CDGYTRQCSEDARYSQLDGTFICNFHLGKYFRILK 60


>UniRef50_A6S1X1 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 978

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +1

Query: 445 YITTKRRLTLYATI*NIPKFHSGTQRVIHSVYATTRSILDTTNPNTFCSRVSRDELRFFD 624
           YI  +  L ++AT   +    S  +RVI  + AT R +   T P+T   R    +  F +
Sbjct: 316 YIKQENTLIIFATSMTVDPVLSRAKRVIEDLNATGRCVGVLTKPDTLSDRTGNTD--FEN 373

Query: 625 VTNARTHRGGVG 660
           + + + HR G G
Sbjct: 374 ILSGKEHRLGHG 385


>UniRef50_A3M7C3 Cluster: Putative transcriptional regulator; n=1;
           Acinetobacter baumannii ATCC 17978|Rep: Putative
           transcriptional regulator - Acinetobacter baumannii
           (strain ATCC 17978 / NCDC KC 755)
          Length = 266

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 25/89 (28%), Positives = 44/89 (49%)
 Frame = +3

Query: 279 IFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNE 458
           +FDE +  FKM      +   ER ++R L      +Q + +      A++L+ H    +E
Sbjct: 170 LFDEVEGFFKMKDVAEKLHLTERTLQRQLAKEGVTFQILLDQVRERHAKKLLNH----HE 225

Query: 459 EAVNVICDNLKYTEVSQRHATRYTQRLRN 545
            +++ I + L Y+EV+  H TR  +R  N
Sbjct: 226 YSISYISEKLGYSEVT--HFTRAFKRWTN 252


>UniRef50_A7JYK0 Cluster: FAD/FMN-containing dehydrogenase; n=2;
           Vibrio|Rep: FAD/FMN-containing dehydrogenase - Vibrio
           sp. Ex25
          Length = 563

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 19/63 (30%), Positives = 33/63 (52%)
 Frame = +3

Query: 354 KRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYTEVSQRHATRYTQ 533
           +R+L P       V  LN   Q E LIF+  Y ++  V V+C++ +  + +   ATR++ 
Sbjct: 54  ERLLTPLENTVSPVPGLNQY-QVESLIFNTRYQHQPFVIVMCESTQEVQQAYLTATRFSL 112

Query: 534 RLR 542
            +R
Sbjct: 113 PIR 115


>UniRef50_A0D4D7 Cluster: Chromosome undetermined scaffold_37, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_37,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 360

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 18/141 (12%)
 Frame = +3

Query: 213 RRMVYLQQPPHQTFKMSKMVLPIFDEDDNQF---KMTI---ARHLVGNKE--RGIKRILI 368
           +RM  LQQ  HQ+ K  + +L +F++  N+F   K  I      LV   E  R     L+
Sbjct: 122 QRMKILQQECHQSDKKKQEILTLFNDLQNEFDKYKQEIILNINELVNQSEEIRETSLTLV 181

Query: 369 PSATNYQEVFNL-------NSMMQAEQLIFHLIYNNEEAVNVICDNLKYTEVSQRHATRY 527
             +T+ +    L       +   Q   L  HLI  N+    +I    + T + ++ A  +
Sbjct: 182 DQSTDCEAKIKLLLLQLLKSCSPQLHSLKQHLITLNQTIYELIQQQQEQTNLIEQQAKEH 241

Query: 528 TQRL---RNYKKHSRHHKPEH 581
            QRL      +K  R  K +H
Sbjct: 242 KQRLLEIEEERKMEREQKIQH 262


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 684,949,531
Number of Sequences: 1657284
Number of extensions: 13248240
Number of successful extensions: 32332
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 31220
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32314
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -