SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P41431 Cluster: Uncharacterized 14.6 kDa protein in EGT...   163   4e-39
UniRef50_P41435 Cluster: Apoptosis inhibitor 1; n=13; Nucleopoly...   162   7e-39
UniRef50_O55581 Cluster: ORF26 protein; n=3; Nucleopolyhedroviru...    61   2e-08
UniRef50_Q0N483 Cluster: Ac26-like protein; n=1; Clanis bilineat...    60   4e-08
UniRef50_Q9J815 Cluster: ORF125; n=3; Nucleopolyhedrovirus|Rep: ...    58   2e-07
UniRef50_Q71A58 Cluster: Putative uncharacterized protein; n=3; ...    56   9e-07
UniRef50_Q8V5W3 Cluster: ORF25; n=3; Nucleopolyhedrovirus|Rep: O...    52   2e-05
UniRef50_Q9YMT8 Cluster: LdOrf-36 peptide; n=1; Lymantria dispar...    51   3e-05
UniRef50_Q9E232 Cluster: Iap; n=3; Nucleopolyhedrovirus|Rep: Iap...    46   0.001
UniRef50_Q4KT41 Cluster: IAP-3; n=2; Nucleopolyhedrovirus|Rep: I...    45   0.002
UniRef50_Q9EN27 Cluster: AMV021; n=1; Amsacta moorei entomopoxvi...    42   0.016
UniRef50_Q7T5S1 Cluster: Iap-3; n=1; Cryptophlebia leucotreta gr...    42   0.016
UniRef50_Q462E3 Cluster: Orf23; n=2; Nucleopolyhedrovirus|Rep: O...    41   0.027
UniRef50_Q7QJ55 Cluster: ENSANGP00000009540; n=1; Anopheles gamb...    41   0.036
UniRef50_UPI000051A5A0 Cluster: PREDICTED: similar to Inhibitor ...    39   0.11 
UniRef50_Q6ZM93 Cluster: Baculoviral IAP repeat-containing 3; n=...    39   0.11 
UniRef50_Q91ET9 Cluster: ORF116 IAP-5; n=5; Granulovirus|Rep: OR...    39   0.11 
UniRef50_Q9J827 Cluster: ORF110 iap-3; n=1; Spodoptera exigua MN...    39   0.15 
UniRef50_Q9DVT5 Cluster: PxORF98 peptide; n=1; Plutella xylostel...    39   0.15 
UniRef50_Q6QXG6 Cluster: ORF106; n=1; Agrotis segetum granulovir...    39   0.15 
UniRef50_A5IZV8 Cluster: Iap-5; n=1; Spodoptera litura granulovi...    39   0.15 
UniRef50_Q7T9R6 Cluster: Iap-5; n=1; Adoxophyes orana granulovir...    38   0.19 
UniRef50_Q6R7I2 Cluster: ORF42; n=1; Ostreid herpesvirus 1|Rep: ...    38   0.25 
UniRef50_Q55KX6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.25 
UniRef50_Q8QL95 Cluster: Inhibitor of apoptosis-3 IAP-3; n=2; Nu...    38   0.33 
UniRef50_P41436 Cluster: Apoptosis inhibitor IAP; n=12; root|Rep...    38   0.33 
UniRef50_Q8WRD9 Cluster: Inhibitor of apotosis protein 1-like pr...    37   0.44 
UniRef50_Q9YVJ4 Cluster: ORF MSV248 putative inhibitor of apopto...    37   0.59 
UniRef50_Q80LK8 Cluster: Inhibitor of apoptosis protein 3; n=1; ...    37   0.59 
UniRef50_Q7T9S6 Cluster: Iap-3; n=1; Adoxophyes orana granulovir...    37   0.59 
UniRef50_Q6JPG0 Cluster: Inhibitor of apoptosis protein; n=1; Ne...    37   0.59 
UniRef50_Q0N438 Cluster: IAP-2; n=1; Clanis bilineata nucleopoly...    37   0.59 
UniRef50_UPI0000D55797 Cluster: PREDICTED: similar to CG8293-PA,...    36   0.77 
UniRef50_Q98R36 Cluster: NITROGEN FIXATION PROTEIN NIFU; n=1; My...    36   0.77 
UniRef50_Q6JKE3 Cluster: Inhibitor of apoptosis; n=1; Neodiprion...    36   1.0  
UniRef50_Q2PQQ2 Cluster: Inhibitor of apoptosis 2 protein; n=1; ...    36   1.0  
UniRef50_A4VEM9 Cluster: Putative uncharacterized protein; n=1; ...    36   1.0  
UniRef50_P41437 Cluster: Apoptosis inhibitor 3; n=2; Nucleopolyh...    36   1.0  
UniRef50_UPI00015B5932 Cluster: PREDICTED: similar to inhibitor ...    36   1.4  
UniRef50_A0EYV7 Cluster: Iap-2; n=1; Ecotropis obliqua NPV|Rep: ...    36   1.4  
UniRef50_A0Y3W0 Cluster: Uncharacterized periplasmic substrate-b...    36   1.4  
UniRef50_Q0UPJ0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.4  
UniRef50_Q2PQQ3 Cluster: Inhibitor of apoptosis 1 protein; n=1; ...    35   1.8  
UniRef50_Q0ZP59 Cluster: Inhibitor of apoptosis; n=1; Neodiprion...    35   2.4  
UniRef50_Q7QJ54 Cluster: ENSANGP00000016568; n=4; Anopheles gamb...    35   2.4  
UniRef50_Q4FZ23 Cluster: Phosphoglycan beta 1,2 arabinosyltransf...    35   2.4  
UniRef50_Q59QN1 Cluster: Putative uncharacterized protein; n=2; ...    35   2.4  
UniRef50_Q12603 Cluster: Beta-1,4-xylanase; n=3; Bacteria|Rep: B...    35   2.4  
UniRef50_UPI00006A201E Cluster: UPI00006A201E related cluster; n...    34   3.1  
UniRef50_Q4KT18 Cluster: IAP-2; n=2; Nucleopolyhedrovirus|Rep: I...    34   3.1  
UniRef50_Q287F3 Cluster: IAP-3; n=1; Agrotis segetum nucleopolyh...    34   3.1  
UniRef50_Q1A4L2 Cluster: IAP-3; n=3; Baculoviridae|Rep: IAP-3 - ...    34   4.1  
UniRef50_A1YJA1 Cluster: Inhibitor of apoptosis 3; n=1; Spodopte...    34   4.1  
UniRef50_Q8IIL3 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_Q2H209 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_Q24307 Cluster: Apoptosis 2 inhibitor; n=4; Sophophora|...    34   4.1  
UniRef50_UPI00006A221A Cluster: Baculoviral IAP repeat-containin...    33   5.5  
UniRef50_UPI00006CCCD8 Cluster: hypothetical protein TTHERM_0034...    33   7.2  
UniRef50_Q7R4B1 Cluster: GLP_480_43666_50334; n=1; Giardia lambl...    33   7.2  
UniRef50_UPI00015A57A9 Cluster: UPI00015A57A9 related cluster; n...    33   9.5  
UniRef50_Q4T660 Cluster: Chromosome undetermined SCAF8908, whole...    33   9.5  
UniRef50_A5PLG7 Cluster: Zgc:165605 protein; n=4; Euteleostomi|R...    33   9.5  
UniRef50_A5D8Q0 Cluster: Xxiap protein; n=3; Xenopus|Rep: Xxiap ...    33   9.5  
UniRef50_Q9YMI9 Cluster: Apoptosis inhibitor; n=1; Lymantria dis...    33   9.5  
UniRef50_Q9DSW8 Cluster: Putative inhibitor apoptosis protein-3;...    33   9.5  
UniRef50_A5FI83 Cluster: Putative uncharacterized protein; n=2; ...    33   9.5  
UniRef50_Q22YL2 Cluster: TPR Domain containing protein; n=4; Tet...    33   9.5  
UniRef50_Q1RPV2 Cluster: Zinc finger protein; n=1; Ciona intesti...    33   9.5  
UniRef50_A7T0Y6 Cluster: Predicted protein; n=1; Nematostella ve...    33   9.5  
UniRef50_Q7S9P5 Cluster: Putative uncharacterized protein NCU066...    33   9.5  
UniRef50_Q6CGG1 Cluster: Similar to sp|O14064 Schizosaccharomyce...    33   9.5  

>UniRef50_P41431 Cluster: Uncharacterized 14.6 kDa protein in
           EGT-IAP1 intergenic region; n=12;
           Nucleopolyhedrovirus|Rep: Uncharacterized 14.6 kDa
           protein in EGT-IAP1 intergenic region - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 129

 Score =  163 bits (396), Expect = 4e-39
 Identities = 78/84 (92%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   SVVSMCVDNAFAYTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISEL 181
           SV SMCVDNAFAYTTDDLLKNI FSHSKCAPFKLQNYTVLKRLSNGFIDK VDV SISEL
Sbjct: 4   SVASMCVDNAFAYTTDDLLKNIPFSHSKCAPFKLQNYTVLKRLSNGFIDKYVDVCSISEL 63

Query: 182 QKFNFKINRLTSYISNIFEYEFVV 253
           QKFNFKI+RLT+YISNIFEYEFVV
Sbjct: 64  QKFNFKIDRLTNYISNIFEYEFVV 87



 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 41/49 (83%), Positives = 42/49 (85%)
 Frame = +1

Query: 232 FRVRVCSLEHNLSTVHVINAETKTKLGHINVSLNQNDPNVLILTVTLTS 378
           F      LEH+LSTVHVINAETKTKLGHINVSLNQND NVLILTVTLTS
Sbjct: 81  FEYEFVVLEHDLSTVHVINAETKTKLGHINVSLNQNDANVLILTVTLTS 129


>UniRef50_P41435 Cluster: Apoptosis inhibitor 1; n=13;
           Nucleopolyhedrovirus|Rep: Apoptosis inhibitor 1 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 286

 Score =  162 bits (394), Expect = 7e-39
 Identities = 73/74 (98%), Positives = 73/74 (98%)
 Frame = +1

Query: 508 NTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEH 687
           NTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAE 
Sbjct: 43  NTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAER 102

Query: 688 ESFGDNITINAVLV 729
           ESFGDNITINAVLV
Sbjct: 103 ESFGDNITINAVLV 116



 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 35/41 (85%), Positives = 37/41 (90%)
 Frame = +2

Query: 383 MNEDTPPFYFINTRDNFRDNIAEHVFDMLLERHGSFENYPI 505
           MNEDTPPFYFI+  DNFRDN AEHVFDML+ERH SFENYPI
Sbjct: 1   MNEDTPPFYFISVCDNFRDNTAEHVFDMLIERHSSFENYPI 41



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 520 INSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFG 699
           I ++   G  Y    D  VC +C+  +++W  +E     H   +P C +   +   E   
Sbjct: 150 ITNIAEAGLFYTGRGDETVCFFCDCCVRDWHTNEDTWQRHAAENPQCYFVLSVKGKEFCQ 209

Query: 700 DNITINAV 723
           ++IT+  V
Sbjct: 210 NSITVTHV 217


>UniRef50_O55581 Cluster: ORF26 protein; n=3;
           Nucleopolyhedrovirus|Rep: ORF26 protein - Leucania
           separata nuclear polyhedrosis virus (LsNPV)
          Length = 137

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 35/89 (39%), Positives = 50/89 (56%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           YT+ DLLKN  +S SK        Y  +  LS G +  +VD  ++ EL K NFKI+ +T 
Sbjct: 3   YTSHDLLKNTPYS-SKLE-LSFDRYMNVIYLSKGLVPINVDENTLGELAKINFKIDPVTR 60

Query: 218 YISNIFEYEFVV*NIIYPQCTSLTPRQKL 304
           Y+SNI +YEFVV +        + P+ K+
Sbjct: 61  YVSNILDYEFVVKDYDVTVVYVINPKNKV 89


>UniRef50_Q0N483 Cluster: Ac26-like protein; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: Ac26-like protein - Clanis
           bilineata nucleopolyhedrosis virus
          Length = 136

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           +T+D LLKN ++  ++  PF + +Y  L  L+ G +   +   SI +L+K  F ++ L  
Sbjct: 7   FTSDQLLKNTAYVSNQ--PFGINHYYALLMLARGLVSSDISQSSIVQLEKLGFHVDLLID 64

Query: 218 YISNIFEYE-FVV*NIIYPQCTSLTPRQKL 304
           YI+NIFEYE FV  N I     +   RQKL
Sbjct: 65  YITNIFEYEMFVKDNDISEIYVTTHDRQKL 94


>UniRef50_Q9J815 Cluster: ORF125; n=3; Nucleopolyhedrovirus|Rep:
           ORF125 - Spodoptera exigua MNPV
          Length = 135

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 26/72 (36%), Positives = 43/72 (59%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           +TT DLLKN SFS      F   +Y  L  L  G +  ++++ S+ +L+K N  ++ LT 
Sbjct: 3   FTTSDLLKNASFSSKLYNRF--DHYMTLLNLCKGVVSANINIDSVKQLEKLNLIVDPLTD 60

Query: 218 YISNIFEYEFVV 253
           Y++NIF+Y+  +
Sbjct: 61  YVTNIFDYDMYI 72


>UniRef50_Q71A58 Cluster: Putative uncharacterized protein; n=3;
           Nucleopolyhedrovirus|Rep: Putative uncharacterized
           protein - Mamestra configurata NPV-A
          Length = 119

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 26/72 (36%), Positives = 45/72 (62%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           ++T DLL+N S+S      F  ++Y  L  L+ G +  +++V S+ EL+K + KI+ LT 
Sbjct: 3   FSTSDLLQNASYSAKHYCKF--EHYMTLINLAKGIVPVTLNVESLKELEKVHLKIDPLTD 60

Query: 218 YISNIFEYEFVV 253
           Y++NIF+Y   +
Sbjct: 61  YVTNIFDYALYI 72


>UniRef50_Q8V5W3 Cluster: ORF25; n=3; Nucleopolyhedrovirus|Rep:
           ORF25 - Helicoverpa zea SNPV
          Length = 158

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 42/74 (56%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           Y  ++LLK+  +S+     FK   Y +   L+ G +     + S+ ELQK  F+I+ +T+
Sbjct: 3   YNCNNLLKHTPYSNKLNLSFK--RYMITLSLAKGVVPSLATLESVKELQKLKFQIDPVTN 60

Query: 218 YISNIFEYEFVV*N 259
           YISN  +YE +V N
Sbjct: 61  YISNALDYEMIVQN 74


>UniRef50_Q9YMT8 Cluster: LdOrf-36 peptide; n=1; Lymantria dispar
           MNPV|Rep: LdOrf-36 peptide - Lymantria dispar
           multicapsid nuclear polyhedrosis virus (LdMNPV)
          Length = 123

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/72 (37%), Positives = 40/72 (55%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           Y++D LLKN+ F+     P+ +  +  L  L+ G I   +   SI EL+  NF ++ LT 
Sbjct: 4   YSSDKLLKNMPFATKN--PYTINQHLSLMGLARGEICNRITHESIGELKSLNFDVDPLTD 61

Query: 218 YISNIFEYEFVV 253
            I NIF+YE  V
Sbjct: 62  RIKNIFDYELYV 73


>UniRef50_Q9E232 Cluster: Iap; n=3; Nucleopolyhedrovirus|Rep: Iap -
           Helicoverpa zea SNPV
          Length = 268

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWS-EDECIEYAHVTLSPYCAYANKI 678
           GF Y   DDHV C +C+ E+ NW  ED+ +E  H   +P C+Y   I
Sbjct: 41  GFYYLNKDDHVKCAFCKVEMMNWQHEDDPLE-EHARWAPQCSYVKSI 86


>UniRef50_Q4KT41 Cluster: IAP-3; n=2; Nucleopolyhedrovirus|Rep:
           IAP-3 - Chrysodeixis chalcites nucleopolyhedrovirus
          Length = 278

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           L +NGF Y    D V C YC+ EI  W +++ ++  H   +P C +  K+
Sbjct: 33  LAMNGFYYLGSGDQVRCAYCKVEICKWQQNDVVDRDHKKYAPQCPFVKKL 82


>UniRef50_Q9EN27 Cluster: AMV021; n=1; Amsacta moorei entomopoxvirus
           'L'|Rep: AMV021 - Amsacta moorei entomopoxvirus (AmEPV)
          Length = 264

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/66 (31%), Positives = 30/66 (45%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDN 705
           S   NGF Y   +D V C YC  +I  W E +  E  H   SP C++       +  G+N
Sbjct: 29  SFASNGFYYIGENDTVKCVYCGVQINKWVEGDKPEIDHKKFSPNCSFLKSNDGIDECGNN 88

Query: 706 ITINAV 723
             I+ +
Sbjct: 89  KNISNI 94


>UniRef50_Q7T5S1 Cluster: Iap-3; n=1; Cryptophlebia leucotreta
           granulovirus|Rep: Iap-3 - Cryptophlebia leucotreta
           granulosis virus (ClGV) (Cryptophlebialeucotreta
           granulovirus)
          Length = 255

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCA 663
           L  NGF Y    D V C +C+ EI  W ED+  E  H   SP C+
Sbjct: 24  LAKNGFYYLGRSDEVRCAFCKVEIMRWKEDDDPETEHRKWSPQCS 68



 Score = 36.3 bits (80), Expect = 0.77
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESF 696
           GF Y    D V+C YC+ ++  W  DE     H      CA+  K+ + E F
Sbjct: 122 GFFYTGKGDRVICYYCDGKLSMWERDEDPWEEHARWYGSCAFL-KLVKGEEF 172


>UniRef50_Q462E3 Cluster: Orf23; n=2; Nucleopolyhedrovirus|Rep:
           Orf23 - Trichoplusia ni SNPV
          Length = 142

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           Y +  LL N +FS SK    +  +Y  L  L+ G I   +D  SI EL+KFN  I   ++
Sbjct: 3   YQSRYLLSNTAFS-SKSG-IRFTHYNNLINLAKGVIPSPIDPISIVELKKFNMIIEPDSN 60

Query: 218 YISNIFEY 241
           Y+SNI ++
Sbjct: 61  YVSNIHDF 68


>UniRef50_Q7QJ55 Cluster: ENSANGP00000009540; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000009540 - Anopheles gambiae
           str. PEST
          Length = 297

 Score = 40.7 bits (91), Expect = 0.036
 Identities = 19/51 (37%), Positives = 23/51 (45%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           N L   GF Y   DD V C +C  EI  W   + +   H+  SPYC    K
Sbjct: 28  NVLARYGFYYVGTDDTVKCYFCRVEIGLWEPQDDVIQEHLRWSPYCPLLKK 78


>UniRef50_UPI000051A5A0 Cluster: PREDICTED: similar to Inhibitor of
           apoptosis 2 CG8293-PA, isoform A; n=1; Apis
           mellifera|Rep: PREDICTED: similar to Inhibitor of
           apoptosis 2 CG8293-PA, isoform A - Apis mellifera
          Length = 518

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHE 690
           GF Y+   DHV C +C+  ++NW   +     H    P C + N +   E
Sbjct: 258 GFYYDGYSDHVRCFHCDGGLRNWETTDDAWIEHAKWFPKCEFVNLVRGQE 307



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 21/98 (21%), Positives = 37/98 (37%)
 Frame = +1

Query: 373 TS*NERGHSSVLFYQHARQLSRQHRRTRIRHVTRKTWLV*KLSHCNTAFINSLIVNGFKY 552
           +S  E   ++++ YQ       +  + + R ++ +          +     +L   GF Y
Sbjct: 92  SSSTEISQNNIIEYQSTNSYQYKESQKKYRIMSHRLQSFTNWPLSSVILPENLAKAGFYY 151

Query: 553 NQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
            Q DD V C YC   +K W   +     H    P C +
Sbjct: 152 LQRDDEVQCIYCGGILKKWELGDDPNKKHRKYFPDCNF 189


>UniRef50_Q6ZM93 Cluster: Baculoviral IAP repeat-containing 3; n=8;
           Clupeocephala|Rep: Baculoviral IAP repeat-containing 3 -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 654

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           SL   GF Y  + D V C  C     NW   +C    H  LSP C++   +
Sbjct: 75  SLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQLSPNCSFIQSL 125


>UniRef50_Q91ET9 Cluster: ORF116 IAP-5; n=5; Granulovirus|Rep:
           ORF116 IAP-5 - Cydia pomonella granulosis virus (CpGV)
           (Cydia pomonellagranulovirus)
          Length = 275

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 2/70 (2%)
 Frame = +1

Query: 514 AFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIA--EH 687
           + ++ L  NGF Y  + D V C  C    K+W+ +  +   HV L+  C      A   +
Sbjct: 121 SLVSDLSANGFYYTNIGDAVCCYACLIIAKDWTMNSDVRQIHVRLNARCPLLQLAALNHN 180

Query: 688 ESFGDNITIN 717
            +  DN  +N
Sbjct: 181 NNSNDNCVVN 190



 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSED-ECIEYAHVTLSPYCAY 666
           L + GF ++ + D +VC YC+ ++ N++   E     H   SP+C +
Sbjct: 23  LALMGFYFSGMGDQIVCHYCKLDLYNFATGAEDSVRDHKRYSPHCPF 69


>UniRef50_Q9J827 Cluster: ORF110 iap-3; n=1; Spodoptera exigua
           MNPV|Rep: ORF110 iap-3 - Spodoptera exigua MNPV
          Length = 313

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           L ++GF Y    D V C +C+ EI NW E +     H   +P C +A  +
Sbjct: 52  LALSGFYYIGRGDEVRCAFCKVEIMNWREGDDPIVDHNRWAPQCKFAQNV 101


>UniRef50_Q9DVT5 Cluster: PxORF98 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF98 peptide - Plutella xylostella
           granulovirus
          Length = 281

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +1

Query: 520 INSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           +  L + GF Y+   D ++C YC   +  ++ DE ++  H   SP+C
Sbjct: 25  VRKLSLLGFYYSGHQDQIICAYCNLTLDRFTGDEDVQTDHRRFSPHC 71



 Score = 35.9 bits (79), Expect = 1.0
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           L ++G  Y  V D VVC  C   IK WS D+  +  H  ++  C     I
Sbjct: 131 LSLSGLYYTNVGDAVVCYVCNFCIKGWSVDDEPDQVHYLINSRCELIKNI 180


>UniRef50_Q6QXG6 Cluster: ORF106; n=1; Agrotis segetum
           granulovirus|Rep: ORF106 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 283

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y    D V+C +C+ ++ N+S++    Y H   SP+C +
Sbjct: 27  GFYYTGQSDRVICAFCKLDLYNFSKNTNALYDHKRYSPHCPF 68


>UniRef50_A5IZV8 Cluster: Iap-5; n=1; Spodoptera litura
           granulovirus|Rep: Iap-5 - Spodoptera litura granulovirus
          Length = 263

 Score = 38.7 bits (86), Expect = 0.15
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           L V GF Y  + D+V C  C  ++ +W  ++     H   +PYC
Sbjct: 135 LCVAGFYYTNIGDYVCCYVCGIKVNHWYANDSPMQKHYNFNPYC 178


>UniRef50_Q7T9R6 Cluster: Iap-5; n=1; Adoxophyes orana
           granulovirus|Rep: Iap-5 - Adoxophyes orana granulovirus
           (AoGV)
          Length = 279

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +1

Query: 520 INSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           +N L V+GF Y    D V C  C+   ++W  D  +   H+  +  C Y
Sbjct: 128 VNDLCVSGFYYTNTGDLVCCYACKVLCRDWKIDANVHNVHMNANKNCQY 176


>UniRef50_Q6R7I2 Cluster: ORF42; n=1; Ostreid herpesvirus 1|Rep:
           ORF42 - Ostreid herpesvirus 1
          Length = 364

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 475 KTWLV*KLSHCNTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSP 654
           K+  + K  H     I+S++  GF++    D V C +C+  ++NW   +     H   +P
Sbjct: 128 KSTFLGKWPHSEYISIDSMVAEGFEFIGPGDRVQCRHCKVILRNWETTDIPSSEHERNAP 187

Query: 655 YC 660
            C
Sbjct: 188 RC 189


>UniRef50_Q55KX6 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 683

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 5/101 (4%)
 Frame = +1

Query: 412 YQHARQLSRQHRRTRIRHVTRKTWLV*KLSHCNTAFINSLIVNGFKYN---QVDDHVVCE 582
           Y+ A  L +      +R  T K W   K        + +L   GF YN   +  D V+C 
Sbjct: 114 YETANSLPQSAESIEVRAQTFKKWWPHKQKSGWLPTVKALARAGFVYNPSTESKDAVICP 173

Query: 583 YCEAEIKNWSEDECIEYAHVTLSPYCAY--ANKIAEHESFG 699
           YCE  ++ W   +     H +  P C +  A  + E E  G
Sbjct: 174 YCEYGVEGWEATDDPWEIHQSKVPDCHFFRATLVGEAEGSG 214


>UniRef50_Q8QL95 Cluster: Inhibitor of apoptosis-3 IAP-3; n=2;
           Nucleopolyhedrovirus|Rep: Inhibitor of apoptosis-3 IAP-3
           - Mamestra configurata NPV-A
          Length = 276

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)
 Frame = +1

Query: 529 LIVNGFKYNQ---VDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFG 699
           L VNGF + +     D+V C +C+ EI  W   + +E  H   +P C    K+ + +  G
Sbjct: 32  LAVNGFYHFKDAVYSDNVRCAFCKVEICRWQAHDNVEEDHKRWAPQCKLVRKLVDID--G 89

Query: 700 DNITIN 717
           D  T N
Sbjct: 90  DYNTTN 95


>UniRef50_P41436 Cluster: Apoptosis inhibitor IAP; n=12; root|Rep:
           Apoptosis inhibitor IAP - Cydia pomonella granulosis
           virus (CpGV) (Cydia pomonellagranulovirus)
          Length = 275

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 17/47 (36%), Positives = 21/47 (44%)
 Frame = +1

Query: 538 NGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           NGF Y    D V C +C+ EI  W E E     H   +P C +   I
Sbjct: 30  NGFYYLGRSDEVRCAFCKVEIMRWKEGEDPAADHKKWAPQCPFVKGI 76



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 18/62 (29%), Positives = 26/62 (41%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGDNITINA 720
           GF Y    D+  C YC+  +K+W  ++     HV     CAY   +   +     IT   
Sbjct: 133 GFFYTGYGDNTKCFYCDGGLKDWEPEDVPWEQHVRWFDRCAYVQLVKGRDYVQKVITEAC 192

Query: 721 VL 726
           VL
Sbjct: 193 VL 194


>UniRef50_Q8WRD9 Cluster: Inhibitor of apotosis protein 1-like
           protein; n=6; Aedes/Ochlerotatus group|Rep: Inhibitor of
           apotosis protein 1-like protein - Aedes triseriatus
           (Mosquito) (Ochlerotatus triseriatus)
          Length = 403

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           GF Y   +D V C +C  EI  W  ++ +   H+  SPYC    K
Sbjct: 63  GFYYVGPNDMVKCYFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRK 107


>UniRef50_Q9YVJ4 Cluster: ORF MSV248 putative inhibitor of apoptosis
           protein (IAP), similar to Orgyia pseudotsugata NPV
           GB:U75930; n=1; Melanoplus sanguinipes
           entomopoxvirus|Rep: ORF MSV248 putative inhibitor of
           apoptosis protein (IAP), similar to Orgyia pseudotsugata
           NPV GB:U75930 - Melanoplus sanguinipes entomopoxvirus
           (MsEPV)
          Length = 150

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 26/66 (39%), Positives = 30/66 (45%), Gaps = 4/66 (6%)
 Frame = +1

Query: 520 INSLIVNGFKYNQVDDHVVCEYCEAEIKNW--SEDECIEYAHVTLSPYCAYA--NKIAEH 687
           IN L   GF Y  + D  VC  C  +IKNW    D  IE  H   SP C Y   NK  + 
Sbjct: 34  INRLCEAGFFYTNIGDITVCFNCGLKIKNWLYYNDPWIE--HSKWSPNCNYIIFNKGKKF 91

Query: 688 ESFGDN 705
            +F  N
Sbjct: 92  INFAKN 97


>UniRef50_Q80LK8 Cluster: Inhibitor of apoptosis protein 3; n=1;
           Adoxophyes honmai NPV|Rep: Inhibitor of apoptosis
           protein 3 - Adoxophyes honmai nucleopolyhedrovirus
          Length = 283

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +1

Query: 526 SLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           +L  NGF +    D V C +C+ EI ++  D+ +   H   SP C Y
Sbjct: 37  ALAENGFYHFGYLDTVRCAFCKLEIGSFDPDDVVHQEHFKYSPMCPY 83


>UniRef50_Q7T9S6 Cluster: Iap-3; n=1; Adoxophyes orana
           granulovirus|Rep: Iap-3 - Adoxophyes orana granulovirus
           (AoGV)
          Length = 254

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           + L + GF Y    D   C YC  EI+ W  D+     H   SP C
Sbjct: 32  HQLSICGFYYTGNQDTTKCPYCNLEIEKWEADDDPFEEHFKFSPLC 77



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y  V D V C YC+  +K+W   +     H   +  C Y
Sbjct: 122 GFFYTNVGDRVRCFYCDVGLKDWEPTDTAWGQHARWTSLCEY 163


>UniRef50_Q6JPG0 Cluster: Inhibitor of apoptosis protein; n=1;
           Neodiprion lecontii NPV|Rep: Inhibitor of apoptosis
           protein - Neodiprion lecontii NPV
          Length = 260

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 18/50 (36%), Positives = 23/50 (46%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           L  +GF Y  + D V C  C  EIK+W E +   Y H   S  C    +I
Sbjct: 29  LAKSGFYYTGISDIVRCFDCRIEIKHWKEHDDPTYEHRRWSERCRMVREI 78


>UniRef50_Q0N438 Cluster: IAP-2; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: IAP-2 - Clanis bilineata
           nucleopolyhedrosis virus
          Length = 306

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +1

Query: 493 KLSHCNTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           K SH +T  +  L+ NGF  N  D+ + C  C+  +   ++ + I   H   SP C +
Sbjct: 113 KHSH-STHIVRELVTNGFYLNHNDNKIYCCLCKIVLLKLNKKDSIRLLHQVYSPKCKF 169


>UniRef50_UPI0000D55797 Cluster: PREDICTED: similar to CG8293-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG8293-PA, isoform A - Tribolium castaneum
          Length = 338

 Score = 36.3 bits (80), Expect = 0.77
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +1

Query: 565 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEH 687
           D V C +C+AEI +W +D+     HV  SP C +A + +++
Sbjct: 96  DLVKCAFCKAEICSWEQDDEPLSEHVRWSPNCPFAKEKSQN 136



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y  V+DH +C  C   +++W +++     H    P C +
Sbjct: 201 GFYYRGVEDHTICFSCGGALRDWKDEDEPWEEHAKWYPRCEF 242


>UniRef50_Q98R36 Cluster: NITROGEN FIXATION PROTEIN NIFU; n=1;
           Mycoplasma pulmonis|Rep: NITROGEN FIXATION PROTEIN NIFU
           - Mycoplasma pulmonis
          Length = 144

 Score = 36.3 bits (80), Expect = 0.77
 Identities = 24/80 (30%), Positives = 42/80 (52%)
 Frame = +2

Query: 50  DLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTSYISN 229
           +++KNISF+ S CA F      +L+++ N  ID+ +D+   +     N K N     + N
Sbjct: 53  NIVKNISFNGSGCAIFISSTDLLLEQIKNKNIDEVLDIIE-NYKNMINAKENVKDDKLGN 111

Query: 230 IFEYEFVV*NIIYPQCTSLT 289
           +  +E V  ++   +C SLT
Sbjct: 112 LVIFENVKKHLNRAKCASLT 131


>UniRef50_Q6JKE3 Cluster: Inhibitor of apoptosis; n=1; Neodiprion
           sertifer NPV|Rep: Inhibitor of apoptosis - Neodiprion
           sertifer NPV
          Length = 181

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           GF Y   +D   C  C   +K+W  +E I   HV  SP C +  K
Sbjct: 43  GFYYTGFNDTTKCYECGVTLKDWMPEEDIWEQHVKWSPNCYHVQK 87


>UniRef50_Q2PQQ2 Cluster: Inhibitor of apoptosis 2 protein; n=1;
           Glossina morsitans morsitans|Rep: Inhibitor of apoptosis
           2 protein - Glossina morsitans morsitans (Savannah
           tsetse fly)
          Length = 526

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 12/46 (26%), Positives = 23/46 (50%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           G  Y +VDD V C +C   +++W +++   + H    P C +   +
Sbjct: 238 GLYYQEVDDQVRCFHCNMGLRSWEKEDDPWFEHAKWYPQCPFVRLV 283



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 577 CEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           C +C   I NW   + +E  H T+SP C +
Sbjct: 41  CNWCHCRISNWEYGDVVERRHRTVSPQCEF 70


>UniRef50_A4VEM9 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 224

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 31/140 (22%), Positives = 65/140 (46%), Gaps = 3/140 (2%)
 Frame = +1

Query: 157 GRGLYQRVAKV*F*DKSANQLHIKHFRVRVCSLEHNLSTVHVINAETKTKLGHINVSLNQ 336
           G G YQ++ K+        +++ ++ ++     +H+  +V++   +  TK  H   S  Q
Sbjct: 37  GEGSYQQMLKL-------VKVYTQNKKINYLLSDHSKESVYIFTIKRSTKHDHFIQSTTQ 89

Query: 337 NDPNVLILTVTLTS*NERGHSSVLFYQHARQL---SRQHRRTRIRHVTRKTWLV*KLSHC 507
           + PN+  +++ LTS + R H     YQ   ++   S+  R T++  +    +   K+   
Sbjct: 90  S-PNICFVSIRLTSTHFRRHKIRSSYQGFSEISICSKSFRNTKVSQLNYIFFSQKKILRL 148

Query: 508 NTAFINSLIVNGFKYNQVDD 567
           N +  N L+++  K    DD
Sbjct: 149 NISMKNFLLMH--KEQSYDD 166


>UniRef50_P41437 Cluster: Apoptosis inhibitor 3; n=2;
           Nucleopolyhedrovirus|Rep: Apoptosis inhibitor 3 - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 268

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIA 681
           +  +GF Y    D V C +C+ EI NW   +  E  H   +P C +    A
Sbjct: 38  MAASGFYYLGRGDEVRCAFCKVEITNWVRGDDPETDHKRWAPQCPFVRNNA 88


>UniRef50_UPI00015B5932 Cluster: PREDICTED: similar to inhibitor of
           apoptosis 2 protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to inhibitor of apoptosis 2 protein -
           Nasonia vitripennis
          Length = 602

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y    D V C +C+  ++NW E +     H    P C Y
Sbjct: 276 GFYYVGAQDQVRCFHCDGGLRNWEETDDAWIEHARWFPKCGY 317


>UniRef50_A0EYV7 Cluster: Iap-2; n=1; Ecotropis obliqua NPV|Rep:
           Iap-2 - Ecotropis obliqua NPV
          Length = 332

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 15/63 (23%), Positives = 33/63 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGD 702
           +++  NGF YN   +++ C  C+  I   ++++ I+  H   SP+C +  K  + ++   
Sbjct: 105 DAMAQNGFYYNGNTENIQCCKCKVVILKLNKNDDIKIIHKIYSPHCGFNRKQQQQQTSLS 164

Query: 703 NIT 711
            +T
Sbjct: 165 KLT 167


>UniRef50_A0Y3W0 Cluster: Uncharacterized periplasmic
           substrate-binding protein; n=1; Alteromonadales
           bacterium TW-7|Rep: Uncharacterized periplasmic
           substrate-binding protein - Alteromonadales bacterium
           TW-7
          Length = 307

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +2

Query: 32  FAYTTDDLLKNISFSHSKCAPFKLQNYT--VLKRLSNGFIDKSVDVGSISELQKFNFKIN 205
           F+   D L+KNI   +S    +  +N +  V+ RLS GF+D S+D   +++      + N
Sbjct: 158 FSNRIDTLIKNIMHDNSSSFSWSSENESQAVIARLSRGFLDYSIDYPFMADYFNKQGRFN 217

Query: 206 RLTS 217
            +TS
Sbjct: 218 NITS 221


>UniRef50_Q0UPJ0 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 581

 Score = 35.5 bits (78), Expect = 1.4
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +1

Query: 565 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYA 669
           D+V C  C  ++  W E +   Y H+T SP C +A
Sbjct: 66  DNVQCWACNCQLDGWEEADVPAYEHLTHSPSCGFA 100


>UniRef50_Q2PQQ3 Cluster: Inhibitor of apoptosis 1 protein; n=1;
           Glossina morsitans morsitans|Rep: Inhibitor of apoptosis
           1 protein - Glossina morsitans morsitans (Savannah
           tsetse fly)
          Length = 366

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 15/46 (32%), Positives = 21/46 (45%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           N L + G  Y   +D   C +CE EI  W  ++     H+  SP C
Sbjct: 37  NELAMTGMFYMGEEDKCKCYFCEVEIGRWEREDQPMSEHLRWSPNC 82


>UniRef50_Q0ZP59 Cluster: Inhibitor of apoptosis; n=1; Neodiprion
           abietis nucleopolyhedrovirus|Rep: Inhibitor of apoptosis
           - Neodiprion abietis nucleopolyhedrovirus
          Length = 202

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           L   GF Y  + D+V C  C  EI NW +++   Y H   S  C
Sbjct: 29  LAKTGFYYTGIADNVRCFDCRIEINNWEKNDDPVYEHRRWSERC 72


>UniRef50_Q7QJ54 Cluster: ENSANGP00000016568; n=4; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000016568 - Anopheles gambiae
           str. PEST
          Length = 330

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           GF Y    D V C +C  E+  W E + +   H+  SP C    K
Sbjct: 49  GFFYTGYRDCVRCYFCHIELGGWDEHDVVIEEHLKWSPDCRLMTK 93


>UniRef50_Q4FZ23 Cluster: Phosphoglycan beta 1,2
           arabinosyltransferase, putative; n=4; Leishmania|Rep:
           Phosphoglycan beta 1,2 arabinosyltransferase, putative -
           Leishmania major
          Length = 942

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = -3

Query: 723 YSVDGNVVAKRFVLSNLVGIRAIRRQGYVCIFNTLVFGPIF 601
           ++ D N+   R+  SNL G  AIRR+G  C+       PIF
Sbjct: 449 FTPDTNLPYVRYSASNLYGFNAIRREGQYCLVTNAEVKPIF 489


>UniRef50_Q59QN1 Cluster: Putative uncharacterized protein; n=2;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 1278

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 4/64 (6%)
 Frame = +1

Query: 523 NSLIVNGFKYNQ---VDDHVVCEYCEAEIKNWSEDECIEYAHV-TLSPYCAYANKIAEHE 690
           NSL   GF Y+     DD V C YC+  +  W ED+     H+   S YC Y   +  +E
Sbjct: 154 NSLSHAGFIYSPRSIEDDRVRCMYCQCALDYWEEDDDPIQEHIRNESTYC-YFLDLYNNE 212

Query: 691 SFGD 702
             GD
Sbjct: 213 QDGD 216


>UniRef50_Q12603 Cluster: Beta-1,4-xylanase; n=3; Bacteria|Rep:
           Beta-1,4-xylanase - Dictyoglomus thermophilum
          Length = 352

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +2

Query: 116 VLKRLSNGFID---KSVDVGSISELQKFNFKINRLTSYISNIFEYEFVV*NIIYPQCTSL 286
           +L   S GF+    K +++ S+ E+ K  F I    S++ NI+ YE    N++     SL
Sbjct: 14  ILLTFSLGFLKEEAKGMEIPSLKEVYKDYFTIGAAVSHL-NIYHYE----NLLKKHFNSL 68

Query: 287 TPRQKLNWAI 316
           TP  ++ W +
Sbjct: 69  TPENQMKWEV 78


>UniRef50_UPI00006A201E Cluster: UPI00006A201E related cluster; n=3;
           Xenopus tropicalis|Rep: UPI00006A201E UniRef100 entry -
           Xenopus tropicalis
          Length = 332

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 15/52 (28%), Positives = 22/52 (42%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESF 696
           GF Y    D V C  C  E+ NW   +     H    P+C+Y   ++   S+
Sbjct: 169 GFFYVGPGDRVRCFSCGGEVDNWEPGDVPLTGHQLFFPHCSYVQGLSIRHSY 220


>UniRef50_Q4KT18 Cluster: IAP-2; n=2; Nucleopolyhedrovirus|Rep:
           IAP-2 - Chrysodeixis chalcites nucleopolyhedrovirus
          Length = 309

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/51 (35%), Positives = 23/51 (45%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           NSL VNGF Y   +  + C  C   I   +  +  E  H   SP C + NK
Sbjct: 123 NSLAVNGFYYYGKNIEIRCAGCRLTIVKLNRTDRAEDIHRKYSPECEFNNK 173


>UniRef50_Q287F3 Cluster: IAP-3; n=1; Agrotis segetum
           nucleopolyhedrovirus|Rep: IAP-3 - Agrotis segetum
           nuclear polyhedrosis virus (AsNPV)
          Length = 271

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 17/54 (31%), Positives = 23/54 (42%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHE 690
           L   GF Y    D V C +C+ EI  W   +     H   +P+C Y  +I   E
Sbjct: 25  LAAAGFYYLNRGDEVRCAFCKVEIMRWRPGDDPLADHKRWAPHCKYVCQIDGEE 78


>UniRef50_Q1A4L2 Cluster: IAP-3; n=3; Baculoviridae|Rep: IAP-3 -
           Choristoneura occidentalis granulovirus
          Length = 283

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 14/46 (30%), Positives = 20/46 (43%)
 Frame = +1

Query: 538 NGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           NGF Y    D V C +C  E   W +++     H   +P C +  K
Sbjct: 66  NGFYYLNRGDEVRCAFCNVEFMKWEDNDDPAEFHKKWAPRCPFVIK 111


>UniRef50_A1YJA1 Cluster: Inhibitor of apoptosis 3; n=1; Spodoptera
           frugiperda MNPV|Rep: Inhibitor of apoptosis 3 -
           Spodoptera frugiperda nuclear polyhedrosis virus (SfNPV)
          Length = 287

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +1

Query: 529 LIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYA 669
           L + GF Y   +D V C +C+ EI  W   +     H   +P C +A
Sbjct: 25  LALAGFYYTGRNDEVRCAFCKVEIMKWKYGDNPILDHKKWAPQCKFA 71



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 17/69 (24%), Positives = 30/69 (43%)
 Frame = +1

Query: 520 INSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFG 699
           ++ +   GF YN+ D   VC      I +W   +     H    P C Y N I   +   
Sbjct: 128 LDDMACAGFYYNRDDSTFVCFQGGCTIVHWERRDDPWREHARWFPNCEYVNYIKGRDFVQ 187

Query: 700 DNITINAVL 726
           ++I+++ V+
Sbjct: 188 ESISLSCVI 196


>UniRef50_Q8IIL3 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 2480

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = +1

Query: 445 RRTRIRHVTRKTWLV*KLSHCNTAFI--NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSED 618
           R++R+ H+          +HCN+  +  NS ++  ++ N   +H++ E C   I N  E+
Sbjct: 692 RQSRVIHLNNSNSYY--YNHCNSIEVDYNSCVLEKYQTNNQTNHIITEQCNYNINNLKEE 749

Query: 619 E 621
           E
Sbjct: 750 E 750


>UniRef50_Q2H209 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 753

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = +1

Query: 565 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGD 702
           D+VVC  CE  +  W E +     H+  SP C +A   A    +G+
Sbjct: 57  DNVVCFLCEKSLDGWEESDNPLEEHLKHSPTCGWAIMAAIEAGYGN 102


>UniRef50_Q24307 Cluster: Apoptosis 2 inhibitor; n=4;
           Sophophora|Rep: Apoptosis 2 inhibitor - Drosophila
           melanogaster (Fruit fly)
          Length = 498

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 12/48 (25%), Positives = 25/48 (52%)
 Frame = +1

Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           ++L   G  Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278


>UniRef50_UPI00006A221A Cluster: Baculoviral IAP repeat-containing
           protein 7 (Kidney inhibitor of apoptosis protein) (KIAP)
           (Melanoma inhibitor of apoptosis protein) (ML-IAP)
           (Livin).; n=2; Tetrapoda|Rep: Baculoviral IAP
           repeat-containing protein 7 (Kidney inhibitor of
           apoptosis protein) (KIAP) (Melanoma inhibitor of
           apoptosis protein) (ML-IAP) (Livin). - Xenopus
           tropicalis
          Length = 369

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y    DHV C +C+  ++NW + +     H    P C +
Sbjct: 141 GFFYTGHRDHVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDF 182


>UniRef50_UPI00006CCCD8 Cluster: hypothetical protein
           TTHERM_00340000; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00340000 - Tetrahymena
           thermophila SB210
          Length = 1126

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 25/90 (27%), Positives = 39/90 (43%)
 Frame = +2

Query: 38  YTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLTS 217
           Y   D L +    H        QN   +  + N  ID    V S  +++K  F +N+L S
Sbjct: 567 YFIKDALNDQGIDHDHATYVAKQNSMQVYFIVNDIIDYFRLVNSQLDIKKNWFTVNQLQS 626

Query: 218 YISNIFEYEFVV*NIIYPQCTSLTPRQKLN 307
            IS IFE +     I +  C+ +   +K+N
Sbjct: 627 DISLIFEEQMKERCINFEFCSLIDQSEKIN 656


>UniRef50_Q7R4B1 Cluster: GLP_480_43666_50334; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_480_43666_50334 - Giardia lamblia
           ATCC 50803
          Length = 2222

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 20/80 (25%), Positives = 39/80 (48%)
 Frame = +2

Query: 35  AYTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQKFNFKINRLT 214
           AY    + K +      C   K+     + R+ +G +  S  V  ISEL++F FK +   
Sbjct: 386 AYFEHTIFKILEEPDVPCGELKMGILAHIGRIFSGDVLNSTFVFGISELERFAFKYSYPN 445

Query: 215 SYISNIFEYEFVV*NIIYPQ 274
             + ++ +YE+V   +++P+
Sbjct: 446 HELLDVNDYEYV--KLLFPR 463


>UniRef50_UPI00015A57A9 Cluster: UPI00015A57A9 related cluster; n=1;
           Danio rerio|Rep: UPI00015A57A9 UniRef100 entry - Danio
           rerio
          Length = 456

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y    D+V C +C+  ++NW   +     H    P C Y
Sbjct: 121 GFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQCEY 162


>UniRef50_Q4T660 Cluster: Chromosome undetermined SCAF8908, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF8908, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 414

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y    D+V C YC+  ++NW   +     H    P C +
Sbjct: 176 GFFYTGHGDNVKCYYCDGGLRNWEPGDDPWQEHAKWFPRCEF 217


>UniRef50_A5PLG7 Cluster: Zgc:165605 protein; n=4; Euteleostomi|Rep:
           Zgc:165605 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 309

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF Y    D+V C +C+  ++NW   +     H    P C Y
Sbjct: 164 GFFYTGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQCEY 205


>UniRef50_A5D8Q0 Cluster: Xxiap protein; n=3; Xenopus|Rep: Xxiap
           protein - Xenopus laevis (African clawed frog)
          Length = 475

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYAN 672
           GF Y    D V C  C A +++W   +     H  +SP C + N
Sbjct: 49  GFYYTGDGDRVKCFSCMAMVEDWQHGDTAIGKHRKISPNCKFIN 92


>UniRef50_Q9YMI9 Cluster: Apoptosis inhibitor; n=1; Lymantria dispar
           MNPV|Rep: Apoptosis inhibitor - Lymantria dispar
           multicapsid nuclear polyhedrosis virus (LdMNPV)
          Length = 155

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/42 (38%), Positives = 17/42 (40%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           GF      D V C YC  EI NWS        H   SP C +
Sbjct: 29  GFYCANRQDFVKCAYCHIEIGNWSIGSDAMSDHKRYSPACRF 70


>UniRef50_Q9DSW8 Cluster: Putative inhibitor apoptosis protein-3;
           n=1; Diadromus pulchellus ascovirus 4a|Rep: Putative
           inhibitor apoptosis protein-3 - Diadromus pulchellus
           ascovirus 4a
          Length = 187

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +1

Query: 565 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANK 675
           D VVC +C  ++ +W   +  E  H  L P C ++ K
Sbjct: 106 DGVVCSHCNLKLNDWKCSDDPEICHRELRPKCIFSKK 142


>UniRef50_A5FI83 Cluster: Putative uncharacterized protein; n=2;
            Bacteroidetes|Rep: Putative uncharacterized protein -
            Flavobacterium johnsoniae UW101
          Length = 2481

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +1

Query: 241  RVCSLEHNLSTVHVINAETKTKLGHINVSLNQNDPNVLI-LTVTLTS*NERGHSSVLFYQ 417
            R  S E  + + +   A  +  L  INV++NQ   + L  LT + T  NE   S  L YQ
Sbjct: 2272 RYKSFEEQIQSYNTDEATGRKALFEINVNINQEQIDALYHLTASKTEANELSDSIALKYQ 2331

Query: 418  HA 423
            H+
Sbjct: 2332 HS 2333


>UniRef50_Q22YL2 Cluster: TPR Domain containing protein; n=4;
           Tetrahymena thermophila SB210|Rep: TPR Domain containing
           protein - Tetrahymena thermophila SB210
          Length = 1619

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 1/66 (1%)
 Frame = +2

Query: 11  SMCVDN-AFAYTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISELQK 187
           + C +N   AY    LL     S+ KC     QNY     L   +  K +   +I   QK
Sbjct: 542 NFCYNNLGIAYNEKGLLDEAIQSYQKCLEINPQNYVCYNNLGIAYNQKGLQDEAIQSYQK 601

Query: 188 FNFKIN 205
           F  KIN
Sbjct: 602 F-IKIN 606


>UniRef50_Q1RPV2 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 863

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/51 (31%), Positives = 21/51 (41%)
 Frame = +1

Query: 514 AFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666
           A I  +   GF Y    D V C YC   ++NW  D+     H    P C +
Sbjct: 616 ATIQQIAKAGFFYLGERDRVKCWYCNGGLQNWDPDDEPWTEHAKWFPTCEF 666


>UniRef50_A7T0Y6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 332

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/40 (35%), Positives = 18/40 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    D V C  C   ++NW  D+     H   SP+C
Sbjct: 103 GFYYLGDQDSVKCYKCGVALRNWEPDDLPWVEHEKWSPHC 142


>UniRef50_Q7S9P5 Cluster: Putative uncharacterized protein
           NCU06621.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU06621.1 - Neurospora crassa
          Length = 745

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +1

Query: 565 DHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAEHESFGD 702
           D+V C  CE     W+  +     H+  SP+C +A   A   + GD
Sbjct: 62  DNVTCFLCENSFDGWTPGDHPIQEHLKHSPFCGWAVTAAVEANLGD 107


>UniRef50_Q6CGG1 Cluster: Similar to sp|O14064 Schizosaccharomyces
           pombe Bir1 protein; n=1; Yarrowia lipolytica|Rep:
           Similar to sp|O14064 Schizosaccharomyces pombe Bir1
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 634

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%)
 Frame = +1

Query: 541 GFKYN---QVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKIAE 684
           GF +N   +  D+V C  CE  +  W  D+C    H+  S  C++A  +++
Sbjct: 39  GFYFNPRVESPDNVTCFLCECSLDGWELDDCPLKEHLEHSRGCSWATILSK 89


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 643,741,586
Number of Sequences: 1657284
Number of extensions: 11881697
Number of successful extensions: 34204
Number of sequences better than 10.0: 71
Number of HSP's better than 10.0 without gapping: 32853
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34183
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59265488880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -