SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9VIF0 Cluster: Nucleolar complex protein 2 homolog; n=...    58   2e-07
UniRef50_UPI0000D56E48 Cluster: PREDICTED: similar to CG9246-PA;...    53   8e-06
UniRef50_UPI0000E46DC6 Cluster: PREDICTED: hypothetical protein,...    49   1e-04
UniRef50_A0NDZ7 Cluster: ENSANGP00000031827; n=2; Culicidae|Rep:...    48   3e-04
UniRef50_Q4G0P3 Cluster: Hydrocephalus-inducing protein homolog;...    46   7e-04
UniRef50_UPI00015B5EF5 Cluster: PREDICTED: similar to CG9246-PA;...    43   0.009
UniRef50_Q9Y3T9 Cluster: Nucleolar complex protein 2 homolog; n=...    42   0.016
UniRef50_A4QN50 Cluster: Id:ibd5110 protein; n=7; Euteleostomi|R...    39   0.14 
UniRef50_UPI0000DB7B38 Cluster: PREDICTED: similar to CG9246-PA;...    38   0.19 
UniRef50_Q54PQ6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.19 
UniRef50_Q4HLJ0 Cluster: Probable membrane protein Cj0454c , put...    36   1.3  
UniRef50_UPI0000660167 Cluster: UPI0000660167 related cluster; n...    34   4.1  
UniRef50_Q95VE6 Cluster: ELL; n=10; melanogaster subgroup|Rep: E...    33   7.2  
UniRef50_Q5JQZ6 Cluster: Chromosome X open reading frame 30; n=6...    33   7.2  
UniRef50_Q8IK51 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  
UniRef50_A7SSA7 Cluster: Predicted protein; n=1; Nematostella ve...    33   9.5  
UniRef50_A2FVU1 Cluster: Putative uncharacterized protein; n=1; ...    33   9.5  

>UniRef50_Q9VIF0 Cluster: Nucleolar complex protein 2 homolog; n=2;
           Sophophora|Rep: Nucleolar complex protein 2 homolog -
           Drosophila melanogaster (Fruit fly)
          Length = 766

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 25/37 (67%), Positives = 32/37 (86%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSEETVRVLAFLCILRITRNQQA 611
           + K  L++L++LWST +ETVRVLAFLCIL+ITR QQA
Sbjct: 307 LGKTILKRLVVLWSTGDETVRVLAFLCILKITRKQQA 343


>UniRef50_UPI0000D56E48 Cluster: PREDICTED: similar to CG9246-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9246-PA - Tribolium castaneum
          Length = 701

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 24/37 (64%), Positives = 29/37 (78%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSEETVRVLAFLCILRITRNQQA 611
           I K  L++LI +W T+EE VRVLAFLCILRIT  Q+A
Sbjct: 274 ITKTILKRLITIWGTAEEGVRVLAFLCILRITNGQKA 310


>UniRef50_UPI0000E46DC6 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 806

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/34 (58%), Positives = 27/34 (79%)
 Frame = -2

Query: 724 RIAKMALRKLILLWSTSEETVRVLAFLCILRITR 623
           ++ K+ ++KL+ LWST EETVRVLAFLC+  I R
Sbjct: 427 KLVKVIIKKLVNLWSTGEETVRVLAFLCLFSIVR 460


>UniRef50_A0NDZ7 Cluster: ENSANGP00000031827; n=2; Culicidae|Rep:
           ENSANGP00000031827 - Anopheles gambiae str. PEST
          Length = 759

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 22/38 (57%), Positives = 31/38 (81%), Gaps = 1/38 (2%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSEE-TVRVLAFLCILRITRNQQA 611
           + K  L++LI +WST+EE T+RVLAF+CIL+IT  QQ+
Sbjct: 300 LTKPILKRLIGIWSTAEEETIRVLAFMCILKITHAQQS 337


>UniRef50_Q4G0P3 Cluster: Hydrocephalus-inducing protein homolog;
            n=25; Eutheria|Rep: Hydrocephalus-inducing protein
            homolog - Homo sapiens (Human)
          Length = 5120

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 25/68 (36%), Positives = 36/68 (52%)
 Frame = +3

Query: 303  GPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETIKPKKDLRISVYLNDKPA 482
            GP+ ++AG S  I FKNVF     F I VD   F ++   E+++PKK   I+V     P+
Sbjct: 5027 GPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTIRA-GESVRPKKINNITVSFEGNPS 5085

Query: 483  QGWTEVPT 506
               T + T
Sbjct: 5086 GSKTPITT 5093


>UniRef50_UPI00015B5EF5 Cluster: PREDICTED: similar to CG9246-PA;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           CG9246-PA - Nasonia vitripennis
          Length = 744

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSE-ETVRVLAFLCILRITRNQ 617
           + K  LR L+  WST+E ETVRV+AFLCI++I  NQ
Sbjct: 317 LRKPLLRILLKFWSTAEDETVRVVAFLCIVKIVSNQ 352


>UniRef50_Q9Y3T9 Cluster: Nucleolar complex protein 2 homolog; n=24;
           Euteleostomi|Rep: Nucleolar complex protein 2 homolog -
           Homo sapiens (Human)
          Length = 749

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 15/34 (44%), Positives = 29/34 (85%)
 Frame = -2

Query: 715 KMALRKLILLWSTSEETVRVLAFLCILRITRNQQ 614
           +M L++++++WST EE++RVLAFL + R+ R+++
Sbjct: 292 RMLLKRMVVVWSTGEESLRVLAFLVLSRVCRHKK 325


>UniRef50_A4QN50 Cluster: Id:ibd5110 protein; n=7; Euteleostomi|Rep:
           Id:ibd5110 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 478

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -2

Query: 706 LRKLILLWSTSEETVRVLAFLCILRITRNQ 617
           L+ LI  WST EETVRVLAFL + +I R++
Sbjct: 19  LKSLIKHWSTGEETVRVLAFLALNKICRHK 48


>UniRef50_UPI0000DB7B38 Cluster: PREDICTED: similar to CG9246-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG9246-PA
           - Apis mellifera
          Length = 710

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 19/38 (50%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = -2

Query: 721 IAKMALRKLILLWSTSEETVRVLAFLCILRI-TRNQQA 611
           + K  L+ L+  WS+ EETVRV++FL ILRI T N+++
Sbjct: 271 LTKPLLKILLKFWSSGEETVRVVSFLSILRIVTSNRKS 308


>UniRef50_Q54PQ6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 802

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 15/29 (51%), Positives = 24/29 (82%)
 Frame = -2

Query: 724 RIAKMALRKLILLWSTSEETVRVLAFLCI 638
           + +KM L+ L+  WS++EE+VR++AFLCI
Sbjct: 343 KYSKMLLKHLLNNWSSAEESVRIIAFLCI 371


>UniRef50_Q4HLJ0 Cluster: Probable membrane protein Cj0454c ,
           putative; n=1; Campylobacter lari RM2100|Rep: Probable
           membrane protein Cj0454c , putative - Campylobacter lari
           RM2100
          Length = 179

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 2/78 (2%)
 Frame = +3

Query: 348 KNVFDSSRMFKIYVDREEFYVKTMFE-TIKPKKDLRISVYLND-KPAQGWTEVPTGV*L* 521
           KN FD  ++  I + +E+ Y+K  FE  +K K       +LND +  +   E+ T V   
Sbjct: 98  KNYFDDVKINLIPIKKEQEYLKYQFEANVKMKNPQAFYSFLNDLQRYKNLIEISTPVEFK 157

Query: 522 RHTNQLNLKYTGLIFYRE 575
                +NLK+   +FY +
Sbjct: 158 SEEKHINLKFKIKVFYAQ 175


>UniRef50_UPI0000660167 Cluster: UPI0000660167 related cluster; n=1;
            Takifugu rubripes|Rep: UPI0000660167 UniRef100 entry -
            Takifugu rubripes
          Length = 2848

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 294  QAAGPYEVKAGGSTTIKFKNVFDSSRMFKIYV 389
            QA GP+ +K G S  I FKNVF  S  F   V
Sbjct: 2727 QAQGPFNIKPGRSFNIPFKNVFLQSTTFSFQV 2758


>UniRef50_Q95VE6 Cluster: ELL; n=10; melanogaster subgroup|Rep: ELL
           - Drosophila melanogaster (Fruit fly)
          Length = 1060

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +3

Query: 405 YVKTMFETIKPKKDLRISVYLNDKPAQGWTEVPTGV 512
           Y +TMF T++PKK  RIS Y  D P  G +    GV
Sbjct: 515 YDETMFSTVQPKKQ-RISHYKKDTPPSGTSYSSAGV 549


>UniRef50_Q5JQZ6 Cluster: Chromosome X open reading frame 30; n=6;
           Eutheria|Rep: Chromosome X open reading frame 30 - Homo
           sapiens (Human)
          Length = 175

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = +1

Query: 196 FEPTQLGVQNCKVSFKSTLAVNLFNIKGIATEPKPQARTKLRLVDLQLLNLKMSSIHREC 375
           F P Q G   CK+  KS   V  + ++GI  E +P+A+ +      + L   +   ++  
Sbjct: 15  FLPLQSGRYPCKILLKSRYDVRAYYVEGIVNEEQPEAKFEFETPAFEALTQNIPIKNQTN 74

Query: 376 SKYT 387
            K+T
Sbjct: 75  DKWT 78


>UniRef50_Q8IK51 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium falciparum 3D7|Rep: Putative uncharacterized
           protein - Plasmodium falciparum (isolate 3D7)
          Length = 394

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 18/57 (31%), Positives = 28/57 (49%)
 Frame = -2

Query: 181 FLFLMVPSNILYLFELKNEIPQL*NLFSHRFYFVFEAVKVYKYQNLS*IQGSSLCPG 11
           F+  ++P+ I Y  E  N IP++     +  Y + E  KV+KYQ    + G  L  G
Sbjct: 188 FILYLIPNTIYYTIEFINNIPEVELSLPNSLYEIMEE-KVHKYQIGGYVLGFGLLAG 243


>UniRef50_A7SSA7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 751

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = -2

Query: 718 AKMALRKLILLWSTSEETVRVLAFLCILRITR 623
           AK   ++L+ +W T +E VRV+AFL I ++ R
Sbjct: 334 AKRLQKRLVRMWGTGDEHVRVVAFLGINKLLR 365


>UniRef50_A2FVU1 Cluster: Putative uncharacterized protein; n=1;
            Trichomonas vaginalis G3|Rep: Putative uncharacterized
            protein - Trichomonas vaginalis G3
          Length = 2871

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 190  VWFEPTQLGVQNCKVSFKSTLAVNLFNIKGIATE 291
            + F+PT+ G   CKV   S   V +FNIKGI+ +
Sbjct: 2098 ITFKPTKAGEYPCKVVLLSENDVRVFNIKGISLQ 2131


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 687,991,948
Number of Sequences: 1657284
Number of extensions: 13381580
Number of successful extensions: 29176
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 28387
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29172
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 59090914597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -